Citrus Sinensis ID: 001262


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110--
MAHSHRDRDREKEKEKHREKSRRSEREQSTDSDEDKHDKEKEKDKHRDRDRRRDRDRDRDREKEREEKRERAREKEREREKRDREREDRERERERERERRERDREREKRERERDRDKEKDRERKSRDREKRRKVESDDSDEDKDRDRKRRRRHDDDHKERVRERSLSRSNRHRDENDESPREKLVEDDSDKKEKKTREEELEDEQRKLDEEMEKRRRRVQEWQELKRKKEESERENRGDANVEEPKAGRNWTLDREDSDDEEVPQTGKSETDMDADEEPKPSENQVGDAMLVDSDGGSAAPALQIGAAEDEDIDPLDAFMNSMVLPEVEKLKNTVEPSFTDGNNVESKKMDRKGDRRSNGEQPKKSSNKSLGRIIPGEDSDSDYGDLENDEKPLEDEDDDEFMKRVKKTKAEKLSIVDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLKALADSFMAKVNQGLEQAHGTGYGGSGFKFNEEEDEKRKAAKKAQAKEYGFEEDKSDSDDEDEGIRKAGGDISQQDALAKISAIAAASKASASMPTPISAAQLLPNAGLPISLPGVLGLSIPGAAPTVSATGLPVVPNDGAARAAALAAAINLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFPPSRIAGPGERKLYLFIEGPTEQSVKRAKAELKRVLEDFTNQALSLPGGAQPGRYSVV
cccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHcccHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHHccccEEEcccccEEEEcccccccccccHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccEEEEEEccccHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHccccccEEEEEcccccccccccccEEEEcccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccEEEEcccccccHHHccccEEEEccEEEccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEc
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccHHHccccccccccccHHHHHHHHHcccccHHHHcccccccccccccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHcccHHHHccccccccccccccHccccccccccccccccccHcccccccHHcccHHHHHHHHHccccHEccccccccccccccccccccccccccccccccccHHcccccccccccccccccHcccHHHcHHHHccccHHHHHHHHHHHccccccccccccccccccccccEcccHHHHHccHHHHHHHHHHccEEEEcccccccccHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHcccEEEEEcccHHHHHHHHccccEEccEEEEEEEHHHHHHHHHccccHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEccccEEccccEEEEEEEccHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHcccccEEEEEcHHHccccHccEEEEEEcccccccHHHEEEcccccccccccEEEEEEcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHEEEEEccccccccEEEEccHHHHHHHHHHcccEEEEccEEccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEc
mahshrdrdrekEKEKHREKsrrsereqstdsdedkhdkekekdkhrdrdrrrdrdrdrDREKEREEKRERAREKEREREKRDREREDRERERERERERRERDREREKRERERDRDKEKDRErksrdrekrrkvesddsdedkdrdrkrrrrhdddhkERVRERSLsrsnrhrdendespreklveddsdkkeKKTREEELEDEQRKLDEEMEKRRRRVQEWQELKRKKEESerenrgdanveepkagrnwtldredsddeevpqtgksetdmdadeepkpsenqvgdamlvdsdggsaapalqigaaededidpldafmnsmvlpeveklkntvepsftdgnnveskkmdrkgdrrsngeqpkkssnkslgriipgedsdsdygdlendekplededdDEFMKRVKKTkaeklsivdhskidyqpfrKNFYIEVKEIARMTPEEVSAYRKQLELKihgkdvpkpiktwhqtglTSKIMETIRKLnyekpmpiqaqalpvimsgrdcigvaktgsgktlAFVLPMlrhikdqppvaagdgpvglimaPTRELVQQIHSDIRKFAKVMGvrcvpvyggsgvAQQISElkrgteivvctpgrMIDILCtsggkitnlrrVTYLVMDEADrmfdmgfepqITRIVqnirpdrqtvlfsatFPRQVEILARKVlnkpveiqvggrsvvnkDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLkhgypclslhgakdqtdrestisDFKSNVCNLLIATSVaargldvkeLELVInfdapnhyedyvhrvgrtgragrkgcaitfiseedakyspDLVKALELSEQVVPDDLKALADSFMAKVNQGleqahgtgyggsgfkfneEEDEKRKAAKKAQAKeygfeedksdsddedegirkaggdisQQDALAKISAIAAASkasasmptpisaaqllpnaglpislpgvlglsipgaaptvsatglpvvpndGAARAAALAAAINLQHNLAKIQAdampehyeaeleindfpqnarwkvthketlgpisewtgaaittrgqyfppsriagpgerklylfiegptEQSVKRAKAELKRVLEDFTNqalslpggaqpgrysvv
mahshrdrdrekekekhreksrrsereqstdsdedkhdkekekdkhrdrdrrrdrdrdrdrekereekrerarekererekrdreredrerererererrerdrerekrererdrdkekdrerksrdrekrrkvesddsdedkdrdrkrrrrhdddhkervrerslsrsnrhrdendespreklveddsdkkekktreeeledeqrkldeemekrrrrvqewqelkrkkeeserenrgdanveepkagrnwtldredsddeevpqtgksetdmdadeepkPSENQVGDAMLVDSDGGSAAPALQIGAAEDEDIDPLDAFMNSMVLPEVEklkntvepsftdgnnveskkmdrkgdrrsngeqpkkssnkslgriipgedsdsdygdlendekplededddefMKRVKktkaeklsivdhskidyqpfrkNFYIEVKEIARMTPEEVSAYRKQLElkihgkdvpkpiktwhqtgltsKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGsgvaqqiselkrgteivvctPGRMIDIlctsggkitnlrrVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILarkvlnkpveiqvggrsvvnkditqlvevrpesdrFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLLIATSVAARGLDVKELELVINfdapnhyedYVHRvgrtgragrKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLKALADSFMAKVNQGLEQAHGTGYGGSGFKFNEEEDEKRKAAKkaqakeygfeedksdsddeDEGIRKaggdisqqDALAKISAIAAASKASASMPTPISAAQLLPNAGLPISLPGVLGLSIPGAAPTVSATGLPVVPNDGAARAAALAAAINLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFPPSRIAGPGERKLYLFIEGPTEQSVKRAKAELKRVLEDFtnqalslpggaqpgrysvv
MAHShrdrdrekekekhreksrrsereQSTdsdedkhdkekekdkhrdrdrrrdrdrdrdrekereekrerarekererekrdreredrerererererrerdrerekrererdrdkekdrerksrdrekrrkvesddsdedkdrdrkrrrrhdddhkervrerSLSRSNRHRDENDESPReklveddsdkkekktreeeledeqrkldeeMEKRRRRVQEWQelkrkkeeserenrGDANVEEPKAGRNWTLDREDSDDEEVPQTGKSETDMDADEEPKPSENQVGDAMLVDSDGGSAAPALQIGAAEDEDIDPLDAFMNSMVLPEVEKLKNTVEPSFTDGNNVESKKMDRKGDRRSNGEQPKKSSNKSLGRIIPGEDSDSDYGdlendekplededddeFMKRVKKTKAEKLSIVDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLKALADSFMAKVNQGLEQAHGTGYGGSGFKFNeeedekrkaakkaqakeYGFeedksdsddedeGIRKAGGDISQQDALakisaiaaaskasasMPTPISAAQLLPNAGLPISLPGVLGLSIPGAAPTVSATGLPVVPNDGaaraaalaaaINLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFPPSRIAGPGERKLYLFIEGPTEQSVKRAKAELKRVLEDFTNQALSLPGGAQPGRYSVV
*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LSIVDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAK*******TISDFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLKALADSFMAKV*******************************************************************************************LLPNAGLPISLPGVLGLSIPGAAPTVSATGLPVVPNDGAARAAALAAAINLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFPPSRIAGPGERKLYLFIEG***************************************
*************************************************************************************************************************************************************************************************************************************************************************************************************************DPLDAFMN***********************************************************************************************VDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLK***********************************************************************************************************************************************************************YEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFP*******GERKLYLFIEGPTEQSVKRAKAELKRVLE*****************YSVV
**************************************************************************************************************************************************************************************************************KLDEEMEKRRRRVQEWQE********************PKAGRNWTL******************************NQVGDAMLVDSDGGSAAPALQIGAAEDEDIDPLDAFMNSMVLPEVEKLKNTVEPSFTDGNN**************************LGRIIPGEDSDSDYGDLENDEKPLEDEDDDEFMKRVKKTKAEKLSIVDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGA*********ISDFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLKALADSFMAKVNQGLEQAHGTGYGGSGFKFN*********************************IRKAGGDISQQDALAKISAI***********TPISAAQLLPNAGLPISLPGVLGLSIPGAAPTVSATGLPVVPNDGAARAAALAAAINLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFPPSRIAGPGERKLYLFIEGPTEQSVKRAKAELKRVLEDFTNQALSLPGGAQPGRYSVV
**************************************************************************************************************************************************************************************************************KLDEEMEKRRRRVQEWQELKRKKE*********************************************************************************DIDPLDAFMNSMVLP***************************************************************D***LEDEDDDEFMKRVKKTKAEKLSIVDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLKALADSFMAKVNQGLEQAHGT*YGGSGFKFNEEEDEKRKA************************************************************AQLLPNAGLPISLPGVLGLSIPGAAP****TGLPVVPNDGAARAAALAAAINLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFPPSRIAGPGERKLYLFIEGPTEQSVKRAKAELKRVLEDFTNQALSLP***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHSHRDRDREKEKEKHREKSRRSEREQSTDSDEDKHDKEKEKDKHRDRDRRRDRDRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEKDRERKSRDREKRRKVESDDSDEDKDRDRKRRRRHDDDHKERVRERSLSRSNRHRDENDESPREKLVEDDSDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxERENRGDANVEEPKAGRNWTLDREDSDDEEVPQTGKSETDMDADEEPKPSENQVGDAMLVDSDGGSAAPALQIGAAEDEDIDPLDAFMNSMVLPEVEKLKNTVEPSFTDGNNVESKKMDRKGDRRSNGEQPKKSSNKSLGRIIPGEDSDSDYGDLENDEKPLEDEDDDEFMKRVKKTKAEKLSIVDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLKALADSFMAKVNQGLEQAHGTGYGGSGFKFNEEEDEKRKAAKKAQAKEYGFEEDKSDSDDEDEGIRKAGGDISQQDALAKISAIAAASKASASMPTPISAAQLLPNAGLPISLPGVLGLSIPGAAPTVSATGLPVVPNDGAARAAALAAAINLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFPPSRIAGPGERKLYLFIEGPTxxxxxxxxxxxxxxxxxxxxxALSLPGGAQPGRYSVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1112 2.2.26 [Sep-21-2011]
Q8H0U81166 DEAD-box ATP-dependent RN yes no 0.857 0.817 0.754 0.0
Q9SF41989 DEAD-box ATP-dependent RN no no 0.877 0.986 0.652 0.0
Q0J7Y8947 DEAD-box ATP-dependent RN yes no 0.768 0.902 0.650 0.0
Q4TVV31018 Probable ATP-dependent RN yes no 0.768 0.839 0.445 0.0
Q569Z51032 Probable ATP-dependent RN yes no 0.758 0.816 0.453 0.0
Q627801032 Probable ATP-dependent RN yes no 0.749 0.807 0.451 0.0
Q7L0141031 Probable ATP-dependent RN yes no 0.758 0.818 0.451 0.0
Q5R6D81032 Probable ATP-dependent RN yes no 0.758 0.817 0.451 0.0
Q1DHB21197 Pre-mRNA-processing ATP-d N/A no 0.678 0.630 0.474 0.0
Q553B11151 ATP-dependent RNA helicas yes no 0.608 0.588 0.498 0.0
>sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 Back     alignment and function desciption
 Score = 1412 bits (3656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 745/988 (75%), Positives = 848/988 (85%), Gaps = 35/988 (3%)

Query: 134  VESDDSDEDKDRDRKRRRRHDDDHKERVRERSLSRSNRHRDENDESPREKLVEDDSDKKE 193
            V +++SD+D  RD KRRR+   + KE+ RE+S+ RS+RH D    SP+ K VED+ +KKE
Sbjct: 205  VGNEESDDDVKRDLKRRRKEGGERKEKEREKSVGRSSRHED----SPKRKSVEDNGEKKE 260

Query: 194  KKTREEELEDEQRKLDEEMEKRRRRVQEWQELKRKKEESERENRGDANVEEPKAGRNWTL 253
            KKTREEELEDEQ+KLDEE+EKRRRRVQEWQELKRKKEE+E E++GDA+  EPKAG+ WTL
Sbjct: 261  KKTREEELEDEQKKLDEEVEKRRRRVQEWQELKRKKEEAESESKGDADGNEPKAGKAWTL 320

Query: 254  DREDSDDEEVPQTGKSETDMDADEEPKPSENQVGDAMLVDSDGGSAAPALQI---GAAED 310
            + E SDDEE     KSET+MD DEE KP  +  GDA +VD +  +AA   +    GA ++
Sbjct: 321  EGE-SDDEEGHPEEKSETEMDVDEETKPEND--GDAKMVDLENETAATVSESGGDGAVDE 377

Query: 311  EDIDPLDAFMNSMVLPEVEKLKNTV-EPSFTDGNNVESKKMDRKGDRRSNGEQPKKSSNK 369
            E+IDPLDAFMN+MVLPEVEK  N    P+  DG       +D K + + +G++PKK  NK
Sbjct: 378  EEIDPLDAFMNTMVLPEVEKFCNGAPPPAVNDGT------LDSKMNGKESGDRPKKGFNK 431

Query: 370  SLGRIIPGEDSDSDYGDLENDEKPLEDEDDDEFMKRVKKTKAEKLSIVDHSKIDYQPFRK 429
            +LGRII GEDSDSDY + +ND+ P  DEDD+EFMKRVKKTKAEKLS+VDHSKI+Y+PFRK
Sbjct: 432  ALGRIIQGEDSDSDYSEPKNDDDPSLDEDDEEFMKRVKKTKAEKLSLVDHSKIEYEPFRK 491

Query: 430  NFYIEVKEIARMTPEEVSAYRKQLELKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEK 489
            NFYIEVK+I+RMT EEV+ YRK+LELK+HGKDVP+PIK WHQTGLTSKI++T++KLNYEK
Sbjct: 492  NFYIEVKDISRMTQEEVNTYRKELELKVHGKDVPRPIKFWHQTGLTSKILDTMKKLNYEK 551

Query: 490  PMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPT 549
            PMPIQ QALP+IMSGRDCIGVAKTGSGKTL FVLPMLRHIKDQPPV AGDGP+GL+MAPT
Sbjct: 552  PMPIQTQALPIIMSGRDCIGVAKTGSGKTLGFVLPMLRHIKDQPPVEAGDGPIGLVMAPT 611

Query: 550  RELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSG 609
            RELVQQIHSDIRKF+K +G+RCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTS 
Sbjct: 612  RELVQQIHSDIRKFSKPLGIRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSS 671

Query: 610  GKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKV 669
            GKITNLRRVT+LVMDEADRMFDMGFEPQITRI+QNIRP+RQTVLFSATFPRQVE LARKV
Sbjct: 672  GKITNLRRVTFLVMDEADRMFDMGFEPQITRIIQNIRPERQTVLFSATFPRQVETLARKV 731

Query: 670  LNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDA 729
            LNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEW EKGKIL+FV SQEKCDA
Sbjct: 732  LNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWSEKGKILVFVQSQEKCDA 791

Query: 730  LFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLLIATSVAARGLDVKELELVINF 789
            L+RD++K  YPCLSLHG KDQTDRESTISDFK++VCNLLIATSVAARGLDVKELELV+NF
Sbjct: 792  LYRDMIKSSYPCLSLHGGKDQTDRESTISDFKNDVCNLLIATSVAARGLDVKELELVVNF 851

Query: 790  DAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLKALAD 849
            DAPNHYEDYVHRVGRTGRAGRKGCA+TFISE+DAKY+PDLVKALELSEQ VPDDLKALAD
Sbjct: 852  DAPNHYEDYVHRVGRTGRAGRKGCAVTFISEDDAKYAPDLVKALELSEQPVPDDLKALAD 911

Query: 850  SFMAKVNQGLEQAHGTGYGGSGFKFNEEEDEKRKAAKKAQAKEYGFEEDKSDSDDEDEGI 909
             FM KV QG+EQAHGTGYGGSGFKFNEEE+E RKAAKKAQAKEYGFEEDKSDS+DE++ +
Sbjct: 912  GFMVKVKQGIEQAHGTGYGGSGFKFNEEEEEVRKAAKKAQAKEYGFEEDKSDSEDENDVV 971

Query: 910  RKA-GGDISQQDAL---AKISAIAAASKASASMPTPISAAQLLPNAGLPISLPGVLGLSI 965
            RKA GG+ISQQ A        A AA + A+A +  P++A QLL N G   ++PGVL +++
Sbjct: 972  RKAGGGEISQQQATFAQIAAIAAAAKAAAAAPVSAPVTANQLLANGGGLAAMPGVLPVTV 1031

Query: 966  PGAAPTVSATGLPVVPNDGAARAAALAAAINLQHNLAKIQADAMPEHYEAELEINDFPQN 1025
                        P +P++GA RAAA+ AA+NLQHNLAKIQADAMPEHYEAELEINDFPQN
Sbjct: 1032 ------------PTLPSEGAGRAAAMVAAMNLQHNLAKIQADAMPEHYEAELEINDFPQN 1079

Query: 1026 ARWKVTHKETLGPISEWTGAAITTRGQYFPPSRIAGPGERKLYLFIEGPTEQSVKRAKAE 1085
            ARWKVTHKETLGPISEWTGAAITTRGQ++P  RI GPGERKLYLFIEGP+E+SVK AKAE
Sbjct: 1080 ARWKVTHKETLGPISEWTGAAITTRGQFYPTGRIPGPGERKLYLFIEGPSEKSVKHAKAE 1139

Query: 1086 LKRVLEDFTNQAL-SLPGGAQPGRYSVV 1112
            LKRVLED TNQA+ SLPGGA  GRYSV+
Sbjct: 1140 LKRVLEDITNQAMSSLPGGAS-GRYSVL 1166





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9SF41|RH45_ARATH DEAD-box ATP-dependent RNA helicase 45 OS=Arabidopsis thaliana GN=RH45 PE=2 SV=1 Back     alignment and function description
>sp|Q0J7Y8|RH45_ORYSJ DEAD-box ATP-dependent RNA helicase 45 OS=Oryza sativa subsp. japonica GN=Os08g0154200 PE=3 SV=2 Back     alignment and function description
>sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 Back     alignment and function description
>sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 Back     alignment and function description
>sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 Back     alignment and function description
>sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 Back     alignment and function description
>sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 Back     alignment and function description
>sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 Back     alignment and function description
>sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1112
2555787931173 dead box ATP-dependent RNA helicase, put 0.847 0.803 0.836 0.0
4494391471118 PREDICTED: DEAD-box ATP-dependent RNA he 0.947 0.942 0.732 0.0
4494391491040 PREDICTED: DEAD-box ATP-dependent RNA he 0.911 0.975 0.772 0.0
3564973671104 PREDICTED: DEAD-box ATP-dependent RNA he 0.943 0.950 0.709 0.0
3574455031148 DEAD box ATP-dependent RNA helicase [Med 0.847 0.820 0.754 0.0
3565388211107 PREDICTED: DEAD-box ATP-dependent RNA he 0.860 0.864 0.772 0.0
2240656351112 predicted protein [Populus trichocarpa] 0.787 0.787 0.797 0.0
4495257021098 PREDICTED: LOW QUALITY PROTEIN: DEAD-box 0.929 0.941 0.711 0.0
224083374895 predicted protein [Populus trichocarpa] 0.799 0.993 0.804 0.0
152180711166 DEAD-box ATP-dependent RNA helicase 42 [ 0.857 0.817 0.754 0.0
>gi|255578793|ref|XP_002530253.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223530219|gb|EEF32123.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1579 bits (4089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 801/958 (83%), Positives = 870/958 (90%), Gaps = 16/958 (1%)

Query: 162  RERSLSRSNRHRDENDESPREKLVEDDSDKKEKKTREEELEDEQRKLDEEMEKRRRRVQE 221
            RE+S SRS+RHRDE+D SPR+K  ED+ DKKEKKTREEELEDEQ++LDEEMEKRRRRVQE
Sbjct: 225  REQSTSRSSRHRDESDGSPRKKSGEDELDKKEKKTREEELEDEQKRLDEEMEKRRRRVQE 284

Query: 222  WQELKRKKEESERENRGDA-NVEEPKAGRNWTLDREDSDDEEVPQTGKSETDMDADEEPK 280
            WQEL+RKKEESERE  G+A N +EP+ G+ WTL+ E SDDEE P  GKSET+MD DE  K
Sbjct: 285  WQELRRKKEESEREKHGEASNADEPQTGKTWTLEGE-SDDEEAPLAGKSETNMDLDENAK 343

Query: 281  PSENQVGDAMLVDSDGGSAAPALQIG---AAEDEDIDPLDAFMNSMVLPEVEKLKNTVEP 337
            P E ++GDAM+VDS  G+A    + G     EDE+IDPLDAFMNSMVLPEVEKL N V  
Sbjct: 344  PDE-EIGDAMVVDSYNGTATS--ENGDNDVIEDEEIDPLDAFMNSMVLPEVEKLNNAV-- 398

Query: 338  SFTDGNNVESKKMDRKGDRRSNGEQPKKSSNKSLGRIIPGEDSDSDYGDLENDEKPLEDE 397
              T+  +    ++ +K +  + GE+ KK SNKSLGRIIPGEDSDSDYGDLENDE PL+DE
Sbjct: 399  -ITETVDENKVELKKKKEEGNEGEKLKKGSNKSLGRIIPGEDSDSDYGDLENDEGPLDDE 457

Query: 398  DDDEFMKRVKKTKAEKLSIVDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKI 457
            DDDEFMKRVKKTKAEKLS+VDHSKIDY+PFRKNFYIEVKEI+RM PEEV+AYRKQLELKI
Sbjct: 458  DDDEFMKRVKKTKAEKLSVVDHSKIDYKPFRKNFYIEVKEISRMAPEEVAAYRKQLELKI 517

Query: 458  HGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGK 517
            HGKDVPKP+KTWHQTGL SKI+ETI+KLNYEKPMPIQAQALP+IMSGRDCIG+AKTGSGK
Sbjct: 518  HGKDVPKPVKTWHQTGLASKILETIKKLNYEKPMPIQAQALPIIMSGRDCIGIAKTGSGK 577

Query: 518  TLAFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGG 577
            TLAFVLPMLRHIKDQP V AGDGP+GLIMAPTRELVQQIHSDI+KFAKV+G+RCVPVYGG
Sbjct: 578  TLAFVLPMLRHIKDQPLVEAGDGPIGLIMAPTRELVQQIHSDIKKFAKVLGIRCVPVYGG 637

Query: 578  SGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQ 637
            SGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQ
Sbjct: 638  SGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQ 697

Query: 638  ITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPE 697
            ITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPE
Sbjct: 698  ITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPE 757

Query: 698  SDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTI 757
            S+RFLRLLELLGEW EKGKILIFV SQ+KCDALFRDLLKHGYPCLSLHGAKDQTDRESTI
Sbjct: 758  SERFLRLLELLGEWNEKGKILIFVQSQDKCDALFRDLLKHGYPCLSLHGAKDQTDRESTI 817

Query: 758  SDFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITF 817
            SDFKSNVCNLLIATS+AARGLDVKEL+LV+NFD PNHYEDYVHRVGRTGRAGRKGCAITF
Sbjct: 818  SDFKSNVCNLLIATSIAARGLDVKELDLVVNFDVPNHYEDYVHRVGRTGRAGRKGCAITF 877

Query: 818  ISEEDAKYSPDLVKALELSEQVVPDDLKALADSFMAKVNQGLEQAHGTGYGGSGFKFNEE 877
            ISEEDA+Y+PDLVKALELSEQVVP+DLKALAD FM KVNQGLEQAHGTGYGGSGFKFNEE
Sbjct: 878  ISEEDARYAPDLVKALELSEQVVPEDLKALADGFMVKVNQGLEQAHGTGYGGSGFKFNEE 937

Query: 878  EDEKRKAAKKAQAKEYGFEEDKSDSDDEDEGIRKAGGDISQQD-ALA-KISAIAAASKAS 935
            EDEKR AAKKAQAKEYGFEEDKSDS+DEDEGIRKAGGDIS+ + ALA ++ AIAAASK++
Sbjct: 938  EDEKRIAAKKAQAKEYGFEEDKSDSEDEDEGIRKAGGDISRHNAALAQQLVAIAAASKST 997

Query: 936  AS-MPTPISAAQLLPNAGLPISLPGVLGLSIPGAAPTVSATGLPVVPNDGAARAAALAAA 994
             S  PTPI+A QLLP  GLP+SLPGV+GL+IPG A  V   GLPV+ ND  A+  A+AAA
Sbjct: 998  TSATPTPITAGQLLPPGGLPVSLPGVIGLTIPGPAAVVPGAGLPVINNDNTAK--AIAAA 1055

Query: 995  INLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYF 1054
            INLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPIS+WTGAAITTRGQ+F
Sbjct: 1056 INLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISDWTGAAITTRGQFF 1115

Query: 1055 PPSRIAGPGERKLYLFIEGPTEQSVKRAKAELKRVLEDFTNQALSLPGGAQPGRYSVV 1112
            PP RI GPGERKLYLFIEGP+E SVK+AKAELKRVLED TNQALSLPGGAQPGRYSV+
Sbjct: 1116 PPGRIPGPGERKLYLFIEGPSETSVKKAKAELKRVLEDITNQALSLPGGAQPGRYSVI 1173




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449439147|ref|XP_004137349.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 42-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439149|ref|XP_004137350.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 42-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356497367|ref|XP_003517532.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 42-like [Glycine max] Back     alignment and taxonomy information
>gi|357445503|ref|XP_003593029.1| DEAD box ATP-dependent RNA helicase [Medicago truncatula] gi|355482077|gb|AES63280.1| DEAD box ATP-dependent RNA helicase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356538821|ref|XP_003537899.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 42-like [Glycine max] Back     alignment and taxonomy information
>gi|224065635|ref|XP_002301895.1| predicted protein [Populus trichocarpa] gi|222843621|gb|EEE81168.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449525702|ref|XP_004169855.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 42-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224083374|ref|XP_002307002.1| predicted protein [Populus trichocarpa] gi|222856451|gb|EEE93998.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15218071|ref|NP_173516.1| DEAD-box ATP-dependent RNA helicase 42 [Arabidopsis thaliana] gi|108861895|sp|Q8H0U8.2|RH42_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 42 gi|4836896|gb|AAD30599.1|AC007369_9 Similar to RNA helicases [Arabidopsis thaliana] gi|332191919|gb|AEE30040.1| DEAD-box ATP-dependent RNA helicase 42 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1112
TAIR|locus:20374161166 RCF1 "regulator of CBF gene ex 0.830 0.791 0.686 0.0
TAIR|locus:2074899989 AT3G09620 [Arabidopsis thalian 0.428 0.481 0.724 9.8e-251
MGI|MGI:19208951032 Ddx46 "DEAD (Asp-Glu-Ala-Asp) 0.516 0.556 0.522 2.5e-192
RGD|7084801032 Ddx46 "DEAD (Asp-Glu-Ala-Asp) 0.516 0.556 0.522 8.4e-192
UNIPROTKB|Q627801032 Ddx46 "Probable ATP-dependent 0.516 0.556 0.522 8.4e-192
UNIPROTKB|F1PK901032 DDX46 "Uncharacterized protein 0.516 0.556 0.522 4.6e-191
UNIPROTKB|Q7L0141031 DDX46 "Probable ATP-dependent 0.516 0.556 0.522 4.6e-191
UNIPROTKB|I3LR201032 DDX46 "Uncharacterized protein 0.516 0.556 0.522 7.5e-191
UNIPROTKB|F1MX401032 DDX46 "Uncharacterized protein 0.516 0.556 0.522 7.5e-191
FB|FBgn00306311224 CG6227 [Drosophila melanogaste 0.417 0.379 0.605 5.5e-188
TAIR|locus:2037416 RCF1 "regulator of CBF gene expression 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3250 (1149.1 bits), Expect = 0., P = 0.
 Identities = 656/956 (68%), Positives = 732/956 (76%)

Query:   165 SLSRSNRHRDENDESPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMEKRRRRVQEWQX 224
             S+ RS+RH D    SP+                              +EKRRRRVQEWQ 
Sbjct:   236 SVGRSSRHED----SPKRKSVEDNGEKKEKKTREEELEDEQKKLDEEVEKRRRRVQEWQE 291

Query:   225 XXXXXXXXXXXXXGDANVEEPKAGRNWTLDREDSDDEEVPQTGKSETDMDADEEPKPSEN 284
                          GDA+  EPKAG+ WTL+ E SDDEE     KSET+MD DEE KP EN
Sbjct:   292 LKRKKEEAESESKGDADGNEPKAGKAWTLEGE-SDDEEGHPEEKSETEMDVDEETKP-EN 349

Query:   285 QVGDAMLVDSDGGSAAPALQIG---AAEDEDIDPLDAFMNSMVLPEVEKLKNTVEPSFTD 341
               GDA +VD +  +AA   + G   A ++E+IDPLDAFMN+MVLPEVEK  N   P   +
Sbjct:   350 D-GDAKMVDLENETAATVSESGGDGAVDEEEIDPLDAFMNTMVLPEVEKFCNGAPPPAVN 408

Query:   342 GNNVESKKMDRKGDRRSNGEQPKKSSNKSLGRIIPGEDSDSDYGXXXXXXXXXXXXXXXX 401
                ++SK M+ K     +G++PKK  NK+LGRII GEDSDSDY                 
Sbjct:   409 DGTLDSK-MNGK----ESGDRPKKGFNKALGRIIQGEDSDSDYSEPKNDDDPSLDEDDEE 463

Query:   402 FMKRVKKTKAEKLSIVDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKIHGKD 461
             FMKRVKKTKAEKLS+VDHSKI+Y+PFRKNFYIEVK+I+RMT EEV+ YRK+LELK+HGKD
Sbjct:   464 FMKRVKKTKAEKLSLVDHSKIEYEPFRKNFYIEVKDISRMTQEEVNTYRKELELKVHGKD 523

Query:   462 VPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAF 521
             VP+PIK WHQTGLTSKI++T++KLNYEKPMPIQ QALP+IMSGRDCIGVAKTGSGKTL F
Sbjct:   524 VPRPIKFWHQTGLTSKILDTMKKLNYEKPMPIQTQALPIIMSGRDCIGVAKTGSGKTLGF 583

Query:   522 VLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVA 581
             VLPMLRHIKDQPPV AGDGP+GL+MAPTRELVQQIHSDIRKF+K +G+RCVPVYGGSGVA
Sbjct:   584 VLPMLRHIKDQPPVEAGDGPIGLVMAPTRELVQQIHSDIRKFSKPLGIRCVPVYGGSGVA 643

Query:   582 QQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRI 641
             QQISELKRGTEIVVCTPGRMIDILCTS GKITNLRRVT+LVMDEADRMFDMGFEPQITRI
Sbjct:   644 QQISELKRGTEIVVCTPGRMIDILCTSSGKITNLRRVTFLVMDEADRMFDMGFEPQITRI 703

Query:   642 VQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRF 701
             +QNIRP+RQTVLFSATFPRQVE LARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRF
Sbjct:   704 IQNIRPERQTVLFSATFPRQVETLARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRF 763

Query:   702 LRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFK 761
             LRLLELLGEW EKGKIL+FV SQEKCDAL+RD++K  YPCLSLHG KDQTDRESTISDFK
Sbjct:   764 LRLLELLGEWSEKGKILVFVQSQEKCDALYRDMIKSSYPCLSLHGGKDQTDRESTISDFK 823

Query:   762 SNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEE 821
             ++VCNLLIATSVAARGLDVKELELV+NFDAPNHYEDYVHRVGRTGRAGRKGCA+TFISE+
Sbjct:   824 NDVCNLLIATSVAARGLDVKELELVVNFDAPNHYEDYVHRVGRTGRAGRKGCAVTFISED 883

Query:   822 DAKYSPDLVKALELSEQVVPDDLKALADSFMAKVNQGLEQAHGTGYGGSGFKFNXXXXXX 881
             DAKY+PDLVKALELSEQ VPDDLKALAD FM KV QG+EQAHGTGYGGSGFKFN      
Sbjct:   884 DAKYAPDLVKALELSEQPVPDDLKALADGFMVKVKQGIEQAHGTGYGGSGFKFNEEEEEV 943

Query:   882 XXXXXXXXXXXYGFXXXXXXXXXXXXGIRKAGG-DISQQDA-LXXXXXXXXXXXXXXXMP 939
                        YGF             +RKAGG +ISQQ A                  P
Sbjct:   944 RKAAKKAQAKEYGFEEDKSDSEDENDVVRKAGGGEISQQQATFAQIAAIAAAAKAAAAAP 1003

Query:   940 T--PISAAQLLPNAGLPISLPGVLGLSIPGAAPTVSATGLPVVPNDGXXXXXXXXXXINL 997
                P++A QLL N G   ++PGVL +++P             +P++G          +NL
Sbjct:  1004 VSAPVTANQLLANGGGLAAMPGVLPVTVP------------TLPSEGAGRAAAMVAAMNL 1051

Query:   998 QHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFPPS 1057
             QHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQ++P  
Sbjct:  1052 QHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQFYPTG 1111

Query:  1058 RIAGPGERKLYLFIEGPTEQSVKRAKAELKRVLEDFTNQALS-LPGGAQPGRYSVV 1112
             RI GPGERKLYLFIEGP+E+SVK AKAELKRVLED TNQA+S LPGGA  GRYSV+
Sbjct:  1112 RIPGPGERKLYLFIEGPSEKSVKHAKAELKRVLEDITNQAMSSLPGGAS-GRYSVL 1166




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
TAIR|locus:2074899 AT3G09620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1920895 Ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708480 Ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q62780 Ddx46 "Probable ATP-dependent RNA helicase DDX46" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK90 DDX46 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L014 DDX46 "Probable ATP-dependent RNA helicase DDX46" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LR20 DDX46 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX40 DDX46 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0030631 CG6227 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0J7Y8RH45_ORYSJ3, ., 6, ., 4, ., 1, 30.65010.76880.9028yesno
Q8H0U8RH42_ARATH3, ., 6, ., 4, ., 1, 30.75400.85700.8173yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.991
3rd Layer3.6.40.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1112
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 1e-145
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-121
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-90
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 7e-88
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 3e-78
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-69
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-69
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 1e-65
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-65
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 3e-65
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-61
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 4e-61
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 3e-60
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-54
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 7e-41
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-35
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-25
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-22
PRK12678672 PRK12678, PRK12678, transcription termination fact 9e-21
PRK12678672 PRK12678, PRK12678, transcription termination fact 3e-17
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 3e-17
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 8e-16
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 8e-16
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-14
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-14
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 3e-14
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 7e-14
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 4e-13
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-12
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-12
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-11
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-11
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-11
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 9e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-10
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-10
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-10
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-10
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 2e-10
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-10
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 3e-10
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 4e-10
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-10
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 5e-10
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 6e-10
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 7e-10
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-09
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-09
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-09
PRK12678672 PRK12678, PRK12678, transcription termination fact 3e-09
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-09
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-09
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 4e-09
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 4e-09
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-09
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-09
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-09
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-09
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 1e-08
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-08
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-08
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-08
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-08
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 2e-08
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 2e-08
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 3e-08
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 3e-08
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-08
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 3e-08
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 4e-08
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 5e-08
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 5e-08
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 5e-08
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-08
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 7e-08
pfam02029431 pfam02029, Caldesmon, Caldesmon 9e-08
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-07
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-07
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 1e-07
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-07
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-07
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-07
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-07
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-07
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 3e-07
COG1203733 COG1203, COG1203, CRISPR-associated helicase Cas3 3e-07
COG1205 851 COG1205, COG1205, Distinct helicase family with a 5e-07
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-07
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 7e-07
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 7e-07
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 9e-07
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 9e-07
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 1e-06
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 2e-06
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-06
COG52714600 COG5271, MDN1, AAA ATPase containing von Willebran 2e-06
COG52714600 COG5271, MDN1, AAA ATPase containing von Willebran 2e-06
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 2e-06
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 3e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-06
PRK05306746 PRK05306, infB, translation initiation factor IF-2 4e-06
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 5e-06
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-06
pfam02029431 pfam02029, Caldesmon, Caldesmon 5e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-06
PRK05306746 PRK05306, infB, translation initiation factor IF-2 6e-06
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 7e-06
PRK13766773 PRK13766, PRK13766, Hef nuclease; Provisional 7e-06
PRK12678672 PRK12678, PRK12678, transcription termination fact 8e-06
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 8e-06
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 9e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-05
pfam02724583 pfam02724, CDC45, CDC45-like protein 1e-05
PTZ002661021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 1e-05
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 1e-05
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 1e-05
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 2e-05
pfam04147809 pfam04147, Nop14, Nop14-like family 2e-05
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 2e-05
TIGR00934800 TIGR00934, 2a38euk, potassium uptake protein, Trk 2e-05
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-05
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 3e-05
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 3e-05
COG1202830 COG1202, COG1202, Superfamily II helicase, archaea 3e-05
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 3e-05
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-05
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 4e-05
PHA02896616 PHA02896, PHA02896, A-type inclusion like protein; 4e-05
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-05
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 5e-05
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 6e-05
PHA02896616 PHA02896, PHA02896, A-type inclusion like protein; 6e-05
pfam03344715 pfam03344, Daxx, Daxx Family 6e-05
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 7e-05
pfam04615728 pfam04615, Utp14, Utp14 protein 7e-05
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 1e-04
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 1e-04
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 1e-04
pfam04615728 pfam04615, Utp14, Utp14 protein 1e-04
pfam03879105 pfam03879, Cgr1, Cgr1 family 1e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 2e-04
PRK12585197 PRK12585, PRK12585, putative monovalent cation/H+ 2e-04
TIGR026801353 TIGR02680, TIGR02680, TIGR02680 family protein 2e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 2e-04
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 2e-04
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 2e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 2e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 2e-04
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 3e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-04
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 3e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-04
PTZ002661021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 3e-04
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 3e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 3e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 3e-04
COG1269660 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su 3e-04
COG5296521 COG5296, COG5296, Transcription factor involved in 3e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-04
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 4e-04
pfam12037276 pfam12037, DUF3523, Domain of unknown function (DU 4e-04
pfam04006613 pfam04006, Mpp10, Mpp10 protein 4e-04
pfam06375561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 4e-04
COG2268548 COG2268, COG2268, Uncharacterized protein conserve 4e-04
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 4e-04
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-04
pfam02724583 pfam02724, CDC45, CDC45-like protein 5e-04
PRK12705508 PRK12705, PRK12705, hypothetical protein; Provisio 5e-04
pfam09736141 pfam09736, Bud13, Pre-mRNA-splicing factor of RES 5e-04
pfam11671146 pfam11671, Apis_Csd, Complementary sex determiner 5e-04
pfam06991277 pfam06991, Prp19_bind, Splicing factor, Prp19-bind 5e-04
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 6e-04
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 6e-04
COG52714600 COG5271, MDN1, AAA ATPase containing von Willebran 7e-04
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 8e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 8e-04
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 8e-04
COG0610962 COG0610, COG0610, Type I site-specific restriction 8e-04
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 0.001
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 0.001
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 0.001
pfam04615728 pfam04615, Utp14, Utp14 protein 0.001
TIGR026801353 TIGR02680, TIGR02680, TIGR02680 family protein 0.001
TIGR026801353 TIGR02680, TIGR02680, TIGR02680 family protein 0.001
PRK05035695 PRK05035, PRK05035, electron transport complex pro 0.001
pfam08017393 pfam08017, Fibrinogen_BP, Fibrinogen binding prote 0.001
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.002
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.002
PHA02896616 PHA02896, PHA02896, A-type inclusion like protein; 0.002
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.002
pfam06375561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 0.002
PRK12705508 PRK12705, PRK12705, hypothetical protein; Provisio 0.002
TIGR01554384 TIGR01554, major_cap_HK97, phage major capsid prot 0.002
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 0.002
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 0.002
pfam04514363 pfam04514, BTV_NS2, Bluetongue virus non-structura 0.002
TIGR006061311 TIGR00606, rad50, rad50 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 0.003
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
COG52714600 COG5271, MDN1, AAA ATPase containing von Willebran 0.003
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 0.003
PRK12585197 PRK12585, PRK12585, putative monovalent cation/H+ 0.004
pfam05672171 pfam05672, MAP7, MAP7 (E-MAP-115) family 0.004
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 0.004
pfam06495182 pfam06495, Transformer, Fruit fly transformer prot 0.004
pfam05764238 pfam05764, YL1, YL1 nuclear protein 0.004
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
 Score =  447 bits (1151), Expect = e-145
 Identities = 207/463 (44%), Positives = 298/463 (64%), Gaps = 11/463 (2%)

Query: 413 KLSIVDHSKIDYQPFRKNFYIEVKEIARMTPEEVSAYRKQLELKI-HGKDVPKPIKTWHQ 471
           +L  +D   I+  PF KNFY E  E++ ++ +EV   RK+ E+ I  G++VPKP+ ++  
Sbjct: 75  RLQPIDWKSINLVPFEKNFYKEHPEVSALSSKEVDEIRKEKEITIIAGENVPKPVVSFEY 134

Query: 472 TGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKD 531
           T     I+++++   + +P PIQ Q  P+ +SGRD IG+A+TGSGKTLAF+LP + HI  
Sbjct: 135 TSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGRDMIGIAETGSGKTLAFLLPAIVHINA 194

Query: 532 QPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGT 591
           QP +  GDGP+ L++APTREL +QI     KF     +R    YGG     QI  L+RG 
Sbjct: 195 QPLLRYGDGPIVLVLAPTRELAEQIREQCNKFGASSKIRNTVAYGGVPKRGQIYALRRGV 254

Query: 592 EIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQT 651
           EI++  PGR+ID L ++   +TNLRRVTYLV+DEADRM DMGFEPQI +IV  IRPDRQT
Sbjct: 255 EILIACPGRLIDFLESN---VTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQT 311

Query: 652 VLFSATFPRQVEILARKVL-NKPVEIQVGGRSV-VNKDITQLVEVRPESDRFLRLLELLG 709
           +++SAT+P++V+ LAR +   +PV + VG   +    +I Q V V  E ++  +L  LL 
Sbjct: 312 LMWSATWPKEVQSLARDLCKEEPVHVNVGSLDLTACHNIKQEVFVVEEHEKRGKLKMLLQ 371

Query: 710 EWYEKG-KILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLL 768
                G KILIFV +++  D L ++L   G+P L +HG K Q +R   +++FK+    ++
Sbjct: 372 RIMRDGDKILIFVETKKGADFLTKELRLDGWPALCIHGDKKQEERTWVLNEFKTGKSPIM 431

Query: 769 IATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPD 828
           IAT VA+RGLDVK+++ VINFD PN  EDYVHR+GRTGRAG KG + TF++ +  + + D
Sbjct: 432 IATDVASRGLDVKDVKYVINFDFPNQIEDYVHRIGRTGRAGAKGASYTFLTPDKYRLARD 491

Query: 829 LVKALELSEQVVPDDLKALADSFMAKVNQGLEQAHGTGYGGSG 871
           LVK L  ++Q VP +L+ L++      + G E+    GYG   
Sbjct: 492 LVKVLREAKQPVPPELEKLSNE----RSNGTERRRWGGYGRFS 530


Length = 545

>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|130009 TIGR00934, 2a38euk, potassium uptake protein, Trk family Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|165222 PHA02896, PHA02896, A-type inclusion like protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|165222 PHA02896, PHA02896, A-type inclusion like protein; Provisional Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|146486 pfam03879, Cgr1, Cgr1 family Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|227615 COG5296, COG5296, Transcription factor involved in TATA site selection and in elongation by RNA polymerase II [Transcription] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) Back     alignment and domain information
>gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex Back     alignment and domain information
>gnl|CDD|152107 pfam11671, Apis_Csd, Complementary sex determiner protein Back     alignment and domain information
>gnl|CDD|219256 pfam06991, Prp19_bind, Splicing factor, Prp19-binding domain Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|223683 COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|116627 pfam08017, Fibrinogen_BP, Fibrinogen binding protein Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|165222 PHA02896, PHA02896, A-type inclusion like protein; Provisional Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|113290 pfam04514, BTV_NS2, Bluetongue virus non-structural protein NS2 Back     alignment and domain information
>gnl|CDD|129694 TIGR00606, rad50, rad50 Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed Back     alignment and domain information
>gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|219061 pfam06495, Transformer, Fruit fly transformer protein Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1112
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0343758 consensus RNA Helicase [RNA processing and modific 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
COG1200677 RecG RecG-like helicase [DNA replication, recombin 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
PRK09200790 preprotein translocase subunit SecA; Reviewed 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 100.0
COG11971139 Mfd Transcription-repair coupling factor (superfam 100.0
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
PRK13766773 Hef nuclease; Provisional 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
KOG0354746 consensus DEAD-box like helicase [General function 99.98
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.98
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
PRK04914956 ATP-dependent helicase HepA; Validated 99.97
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.97
PRK05580679 primosome assembly protein PriA; Validated 99.97
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 99.97
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 99.96
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK09694878 helicase Cas3; Provisional 99.96
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.96
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.96
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.96
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.95
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.95
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.95
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.95
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.94
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.94
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.93
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.93
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.93
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.92
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.91
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.91
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.91
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 99.91
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 99.9
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.9
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 99.9
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.89
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.88
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.87
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.87
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.86
KOG2340698 consensus Uncharacterized conserved protein [Funct 99.86
PRK05298652 excinuclease ABC subunit B; Provisional 99.85
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.85
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.85
KOG0387923 consensus Transcription-coupled repair protein CSB 99.85
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.85
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.83
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.82
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.81
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.81
COG4096875 HsdR Type I site-specific restriction-modification 99.79
smart00487201 DEXDc DEAD-like helicases superfamily. 99.79
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.79
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 99.79
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.79
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.78
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.77
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.76
KOG1123776 consensus RNA polymerase II transcription initiati 99.75
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.74
CHL00122870 secA preprotein translocase subunit SecA; Validate 99.73
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.72
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.7
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.69
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.69
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.69
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.68
COG4889 1518 Predicted helicase [General function prediction on 99.65
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.65
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 99.62
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.62
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.59
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.59
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.55
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.53
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.53
KOG4439901 consensus RNA polymerase II transcription terminat 99.53
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.52
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.5
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.5
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 99.5
PRK14873665 primosome assembly protein PriA; Provisional 99.49
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.48
smart0049082 HELICc helicase superfamily c-terminal domain. 99.43
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.41
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.4
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.3
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.29
COG0610962 Type I site-specific restriction-modification syst 99.17
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.16
KOG1960 531 consensus Predicted RNA-binding protein, contains 99.13
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 99.04
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.01
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.95
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.95
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.87
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 98.81
PRK15483 986 type III restriction-modification system StyLTI en 98.5
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.29
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.22
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.17
KOG1001674 consensus Helicase-like transcription factor HLTF/ 98.17
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.09
KOG1131755 consensus RNA polymerase II transcription initiati 98.08
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.03
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.0
TIGR00376637 DNA helicase, putative. The gene product may repre 97.91
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.88
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.88
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.85
PRK10536262 hypothetical protein; Provisional 97.85
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.83
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.62
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.54
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.51
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.49
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 97.42
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.41
KOG1803649 consensus DNA helicase [Replication, recombination 97.41
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 97.34
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.27
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.25
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.2
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.18
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.12
KOG18051100 consensus DNA replication helicase [Replication, r 97.12
KOG0383696 consensus Predicted helicase [General function pre 97.07
PRK14974336 cell division protein FtsY; Provisional 97.05
PRK13889988 conjugal transfer relaxase TraA; Provisional 97.03
PF1324576 AAA_19: Part of AAA domain 97.03
PRK06526254 transposase; Provisional 97.0
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.98
PRK04296190 thymidine kinase; Provisional 96.92
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.92
PRK08181269 transposase; Validated 96.88
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.86
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.81
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.74
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 96.6
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.6
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.58
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.48
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.45
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.44
PF13871278 Helicase_C_4: Helicase_C-like 96.44
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.42
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.36
PRK06835329 DNA replication protein DnaC; Validated 96.31
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.26
KOG0119 554 consensus Splicing factor 1/branch point binding p 96.23
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.2
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 96.16
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.15
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 96.12
PRK07952244 DNA replication protein DnaC; Validated 96.11
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.1
PRK00771437 signal recognition particle protein Srp54; Provisi 96.1
KOG0298 1394 consensus DEAD box-containing helicase-like transc 96.09
PRK06921266 hypothetical protein; Provisional 96.07
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.98
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 95.97
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 95.89
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 95.89
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.88
smart00382148 AAA ATPases associated with a variety of cellular 95.88
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.87
PRK08116268 hypothetical protein; Validated 95.82
PRK09183259 transposase/IS protein; Provisional 95.72
PHA02533534 17 large terminase protein; Provisional 95.68
TIGR00064272 ftsY signal recognition particle-docking protein F 95.64
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.5
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.43
PRK12377248 putative replication protein; Provisional 95.39
PRK10867433 signal recognition particle protein; Provisional 95.36
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.26
PRK06893229 DNA replication initiation factor; Validated 95.24
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 95.15
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.14
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 95.11
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 95.11
PRK05642234 DNA replication initiation factor; Validated 95.09
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.03
PRK08727233 hypothetical protein; Validated 95.02
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 94.94
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 94.86
TIGR00959428 ffh signal recognition particle protein. This mode 94.76
PHA03333752 putative ATPase subunit of terminase; Provisional 94.68
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 94.67
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 94.64
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.62
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.57
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 94.52
PRK05580679 primosome assembly protein PriA; Validated 94.5
PRK11054684 helD DNA helicase IV; Provisional 94.49
PRK08084235 DNA replication initiation factor; Provisional 94.46
PRK05707328 DNA polymerase III subunit delta'; Validated 94.42
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 94.4
PRK11773721 uvrD DNA-dependent helicase II; Provisional 94.35
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 94.34
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 94.34
PTZ00293211 thymidine kinase; Provisional 94.32
PRK00149450 dnaA chromosomal replication initiation protein; R 94.3
PHA02544316 44 clamp loader, small subunit; Provisional 94.28
cd03115173 SRP The signal recognition particle (SRP) mediates 94.22
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.19
PRK12422445 chromosomal replication initiation protein; Provis 94.19
COG0552340 FtsY Signal recognition particle GTPase [Intracell 94.15
PRK14087450 dnaA chromosomal replication initiation protein; P 94.1
TIGR00643630 recG ATP-dependent DNA helicase RecG. 94.09
PRK10416318 signal recognition particle-docking protein FtsY; 94.03
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.96
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 93.93
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.89
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.86
PTZ001121164 origin recognition complex 1 protein; Provisional 93.85
TIGR00595505 priA primosomal protein N'. All proteins in this f 93.85
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.85
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 93.76
COG3973747 Superfamily I DNA and RNA helicases [General funct 93.73
PF13173128 AAA_14: AAA domain 93.7
PRK08939306 primosomal protein DnaI; Reviewed 93.64
PRK14086617 dnaA chromosomal replication initiation protein; P 93.61
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 93.57
PRK12402337 replication factor C small subunit 2; Reviewed 93.53
PRK13833323 conjugal transfer protein TrbB; Provisional 93.53
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 93.52
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 93.41
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 93.38
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.27
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 93.21
PRK14873665 primosome assembly protein PriA; Provisional 93.17
PRK11331459 5-methylcytosine-specific restriction enzyme subun 93.17
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 93.14
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 93.09
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 93.06
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.04
PRK08769319 DNA polymerase III subunit delta'; Validated 93.03
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 92.91
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 92.89
PF00004132 AAA: ATPase family associated with various cellula 92.85
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 92.84
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 92.76
PRK13342413 recombination factor protein RarA; Reviewed 92.75
COG4626546 Phage terminase-like protein, large subunit [Gener 92.73
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.72
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 92.68
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 92.67
PRK13341 725 recombination factor protein RarA/unknown domain f 92.61
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 92.59
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 92.58
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 92.43
PRK00411394 cdc6 cell division control protein 6; Reviewed 92.43
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.39
PRK04195482 replication factor C large subunit; Provisional 92.37
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 92.18
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.15
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 92.12
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 92.1
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 91.9
PRK09112351 DNA polymerase III subunit delta'; Validated 91.9
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 91.87
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 91.85
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 91.73
PHA03368738 DNA packaging terminase subunit 1; Provisional 91.71
PRK14088440 dnaA chromosomal replication initiation protein; P 91.7
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 91.65
PLN03025319 replication factor C subunit; Provisional 91.51
PRK07471365 DNA polymerase III subunit delta'; Validated 91.49
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 91.41
PRK06067234 flagellar accessory protein FlaH; Validated 91.4
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 91.4
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 91.39
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 91.39
PRK11823446 DNA repair protein RadA; Provisional 91.32
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 91.31
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 91.31
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 91.3
PRK106891147 transcription-repair coupling factor; Provisional 91.27
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 91.26
PF05872502 DUF853: Bacterial protein of unknown function (DUF 91.22
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 91.22
cd03239178 ABC_SMC_head The structural maintenance of chromos 91.11
PRK07940394 DNA polymerase III subunit delta'; Validated 91.1
COG0470325 HolB ATPase involved in DNA replication [DNA repli 91.09
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 91.08
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 91.07
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 90.88
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 90.87
CHL00181287 cbbX CbbX; Provisional 90.85
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 90.81
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 90.68
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 90.66
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 90.64
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.64
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 90.41
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 90.4
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 90.38
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 90.27
COG2255332 RuvB Holliday junction resolvasome, helicase subun 90.25
KOG2543438 consensus Origin recognition complex, subunit 5 [R 90.23
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 90.21
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 90.17
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 90.17
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 90.17
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 90.11
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 90.02
PRK06964342 DNA polymerase III subunit delta'; Validated 90.01
COG1200677 RecG RecG-like helicase [DNA replication, recombin 90.0
KOG2028554 consensus ATPase related to the helicase subunit o 89.97
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 89.94
COG1198730 PriA Primosomal protein N' (replication factor Y) 89.92
PF05729166 NACHT: NACHT domain 89.9
PRK04328249 hypothetical protein; Provisional 89.84
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 89.84
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 89.77
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 89.67
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 89.63
TIGR00767415 rho transcription termination factor Rho. Members 89.5
KOG15131300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 89.5
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 89.37
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 89.34
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 89.34
COG3972660 Superfamily I DNA and RNA helicases [General funct 89.3
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 89.2
PRK13851344 type IV secretion system protein VirB11; Provision 89.17
PHA00729226 NTP-binding motif containing protein 89.16
PRK08699325 DNA polymerase III subunit delta'; Validated 89.13
PHA00350399 putative assembly protein 89.05
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 89.03
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 88.97
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 88.94
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 88.94
PRK06871325 DNA polymerase III subunit delta'; Validated 88.85
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 88.76
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 88.68
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 88.65
PRK04841 903 transcriptional regulator MalT; Provisional 88.57
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 88.44
cd01128249 rho_factor Transcription termination factor rho is 88.39
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 88.38
KOG2036 1011 consensus Predicted P-loop ATPase fused to an acet 88.36
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 88.2
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 88.08
PF12846304 AAA_10: AAA-like domain 87.97
PRK13764602 ATPase; Provisional 87.92
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 87.84
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 87.69
TIGR00665434 DnaB replicative DNA helicase. This model describe 87.53
TIGR02237209 recomb_radB DNA repair and recombination protein R 87.44
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 87.44
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 87.39
PRK03992389 proteasome-activating nucleotidase; Provisional 87.34
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 87.3
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 87.21
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 87.21
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 87.18
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 87.17
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 87.04
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 87.01
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 86.95
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 86.68
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 86.66
PRK07993334 DNA polymerase III subunit delta'; Validated 86.64
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 86.57
KOG0780483 consensus Signal recognition particle, subunit Srp 86.57
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 86.44
KOG0745564 consensus Putative ATP-dependent Clp-type protease 86.33
PRK10865857 protein disaggregation chaperone; Provisional 86.28
PRK06090319 DNA polymerase III subunit delta'; Validated 86.24
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 86.21
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 86.2
TIGR02012321 tigrfam_recA protein RecA. This model describes or 86.18
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 86.15
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 86.12
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 85.95
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 85.87
CHL00095821 clpC Clp protease ATP binding subunit 85.85
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 85.84
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 85.81
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 85.69
KOG1132945 consensus Helicase of the DEAD superfamily [Replic 85.67
PRK00440319 rfc replication factor C small subunit; Reviewed 85.61
PHA00012361 I assembly protein 85.44
PRK07413382 hypothetical protein; Validated 85.4
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 85.35
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 85.33
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 85.32
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 85.25
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 85.18
PRK05973237 replicative DNA helicase; Provisional 85.14
KOG02981394 consensus DEAD box-containing helicase-like transc 84.96
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 84.96
PRK09354349 recA recombinase A; Provisional 84.84
PRK14701 1638 reverse gyrase; Provisional 84.82
COG11971139 Mfd Transcription-repair coupling factor (superfam 84.77
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 84.76
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 84.75
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 84.74
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 84.74
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 84.64
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 84.6
cd00983325 recA RecA is a bacterial enzyme which has roles in 84.53
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 84.49
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 84.45
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 84.45
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 84.44
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 84.44
PF02606326 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr 84.35
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 84.21
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 84.1
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 83.96
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 83.81
PRK09435332 membrane ATPase/protein kinase; Provisional 83.76
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 83.74
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 83.68
KOG0347731 consensus RNA helicase [RNA processing and modific 83.6
PRK10436462 hypothetical protein; Provisional 83.52
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 83.48
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 83.35
COG1660286 Predicted P-loop-containing kinase [General functi 83.32
PRK07413382 hypothetical protein; Validated 83.21
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 82.94
COG1485367 Predicted ATPase [General function prediction only 82.84
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 82.8
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=8.3e-122  Score=1088.75  Aligned_cols=846  Identities=54%  Similarity=0.819  Sum_probs=687.6

Q ss_pred             HHHhhhhHHHHHHHHHHHHHHHHHHhHHHHHhhhcCCCCccCCcCCCCcccCcCCCCCccCCcCC-CCCCCCCCCCCCCC
Q 001262          203 DEQRKLDEEMEKRRRRVQEWQELKRKKEESERENRGDANVEEPKAGRNWTLDREDSDDEEVPQTG-KSETDMDADEEPKP  281 (1112)
Q Consensus       203 ~~~r~~~eE~~~r~~~~~e~~~~~~~~~e~~~~~~~~~~~~~~~~~r~~~~~~e~~ed~~~~~~~-~~e~~~~~~~~~~~  281 (1112)
                      ..+..+.++.++++++.+.|.+..++++.......-............|++.+++++++.+|... .++...      ..
T Consensus       141 ~~~~~l~e~l~~rr~~~e~~~e~k~k~e~~~~~t~~~~~~~~~~s~k~~~l~~~~d~~~~~~~~~~~s~q~~------~~  214 (997)
T KOG0334|consen  141 SIQARLAEELRKRRERVEKWKELKRKEEKEKVVTLMLNVSDEKNSKKLWELEDEDDDDSANPAELGWSEQDV------PE  214 (997)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHHhhhcchHHhhhhhhcccccccccccceEecCCCCccccCccccchhhccc------hh
Confidence            45667889999999999999998887776666554444455667778899999988777664321 111110      00


Q ss_pred             CCCcccccccccCCCCCCCcccccCCCCCCCCCchHHHHhccChhhHHhhhccCCCCCCCCCccccccccccCCCCCCCC
Q 001262          282 SENQVGDAMLVDSDGGSAAPALQIGAAEDEDIDPLDAFMNSMVLPEVEKLKNTVEPSFTDGNNVESKKMDRKGDRRSNGE  361 (1112)
Q Consensus       282 ~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~e~d~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~k~~~~~~~~~~~~~  361 (1112)
                      .|.+    |         +.     ...++++||+|+||..+..+-+...    .+...+         +  ......+.
T Consensus       215 ~~~~----p---------~~-----~~~dd~~d~ld~~m~~~~~~~~~~~----~~~~~~---------~--~~~~~~s~  261 (997)
T KOG0334|consen  215 LMKA----P---------NL-----MLVDDEEDPLDAFMEQMVGKVLAKF----SNSSHS---------K--AQVVEVSK  261 (997)
T ss_pred             hccC----c---------cc-----cccccccchHHHHHHHHHHHHHHHh----cCCCcc---------c--ccccccch
Confidence            1100    0         00     2345679999999999743322221    111111         0  00011122


Q ss_pred             CCCccccc-ccCCCCCCCCCCCccCCCcCCCCCCCCcchHHHHHHHHHhhhccCCcCCCcccccccccccccccchHhhh
Q 001262          362 QPKKSSNK-SLGRIIPGEDSDSDYGDLENDEKPLEDEDDDEFMKRVKKTKAEKLSIVDHSKIDYQPFRKNFYIEVKEIAR  440 (1112)
Q Consensus       362 ~~~~~~~~-~~~~~~~~~d~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~f~k~f~~~~~~~~~  440 (1112)
                      +..++... ..+.+++..+...|..+.+.+++    ++...+.+..+....+.+..++|+.+.|.||+++||++..++..
T Consensus       262 ~~~~~~~~~~~g~v~e~~~~~~D~~e~~~~~~----~d~~~~~~~~~~~~~~~~~~~~~S~~~~epFRknfy~e~~di~~  337 (997)
T KOG0334|consen  262 DARKGLNPKLSGFVIEPGLVNGDNEEVELNGS----FDNRNAAKNMNLKAKKNLIQVDHSKISYEPFRKNFYIEVRDIKR  337 (997)
T ss_pred             hhhccCCccccceeccCCcCCcchhhhhhccc----cchHHHHHHhccccccceeecccccccchhhhhcccccchhHHH
Confidence            22333322 45666766655555444443333    44555666666566668899999999999999999999999999


Q ss_pred             cCHHHHHHHHhhcC-ceeccCCCCCcccccccCCCCHHHHHHHHHCCCCCChHHHHHHHHHHHcCCCEEEEcCCCChHHH
Q 001262          441 MTPEEVSAYRKQLE-LKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTL  519 (1112)
Q Consensus       441 ~~~~~~~~~r~~~~-~~v~~~~~p~pi~~~~~~~l~~~l~~~l~~~~~~~pt~iQ~~ai~~il~g~dvii~a~TGsGKT~  519 (1112)
                      |+..++..|+..+. |.+.|..||.||++|.++|++..|+..|+++||.+|||||.+|||+||+|+|||++|.||||||+
T Consensus       338 ms~~eV~~yr~~l~~i~v~g~~~pkpv~sW~q~gl~~~il~tlkkl~y~k~~~IQ~qAiP~ImsGrdvIgvakTgSGKT~  417 (997)
T KOG0334|consen  338 MSAAEVDEYRCELDGIKVKGKECPKPVTSWTQCGLSSKILETLKKLGYEKPTPIQAQAIPAIMSGRDVIGVAKTGSGKTL  417 (997)
T ss_pred             HHHHHHHHhhcCccceeeccCCCCcccchHhhCCchHHHHHHHHHhcCCCCcchhhhhcchhccCcceEEeeccCCccch
Confidence            99999999999998 99999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcCCCCCCCCCCcEEEEccchhHHHHHHHHHHHHhhhcCceEEEEeCCCChHHHHHHHhcCCeEEEeCch
Q 001262          520 AFVLPMLRHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPG  599 (1112)
Q Consensus       520 ~~llp~l~~l~~~~~~~~~~~~~~LIl~PtreLa~Q~~~~~~~~~~~~~i~~~~~~gg~~~~~~~~~l~~g~~IiV~Tp~  599 (1112)
                      +|+|||+.|++.|++...+.||.+|||+|||+||.||++++.+|++.++++++|+|||..+..|+..+++|+.|+|||||
T Consensus       418 af~LPmirhi~dQr~~~~gdGPi~li~aPtrela~QI~r~~~kf~k~l~ir~v~vygg~~~~~qiaelkRg~eIvV~tpG  497 (997)
T KOG0334|consen  418 AFLLPMIRHIKDQRPLEEGDGPIALILAPTRELAMQIHREVRKFLKLLGIRVVCVYGGSGISQQIAELKRGAEIVVCTPG  497 (997)
T ss_pred             hhhcchhhhhhcCCChhhCCCceEEEEcCCHHHHHHHHHHHHHHHhhcCceEEEecCCccHHHHHHHHhcCCceEEeccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCccccCCceEEEeccchhhhcCCCchhHHHHHHhcCCCCcEEEEeccccHHHHHHHHHhcCCCeEEEec
Q 001262          600 RMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVG  679 (1112)
Q Consensus       600 ~L~~~l~~~~~~~~~l~~i~~vViDEah~~~~~~f~~~i~~il~~~~~~~q~il~SAT~~~~~~~l~~~~l~~p~~i~~~  679 (1112)
                      +++++++.+.+++++|.++.|||+||||+|++|+|.+++..|+.++++++|+++||||||..++.++...++.|+.++++
T Consensus       498 RmiD~l~~n~grvtnlrR~t~lv~deaDrmfdmgfePq~~~Ii~nlrpdrQtvlfSatfpr~m~~la~~vl~~Pveiiv~  577 (997)
T KOG0334|consen  498 RMIDILCANSGRVTNLRRVTYLVLDEADRMFDMGFEPQITRILQNLRPDRQTVLFSATFPRSMEALARKVLKKPVEIIVG  577 (997)
T ss_pred             hhhhhHhhcCCccccccccceeeechhhhhheeccCcccchHHhhcchhhhhhhhhhhhhHHHHHHHHHhhcCCeeEEEc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccccCceEEEEecc-cchhHHHHHHHHhhhhcCCeEEEEeCCHHHHHHHHHHHHhcCCCeeeecCCCCHHHHHHHHH
Q 001262          680 GRSVVNKDITQLVEVRP-ESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTIS  758 (1112)
Q Consensus       680 ~~~~~~~~i~q~~~~~~-~~~k~~~ll~~l~~~~~~~~vLIF~~s~~~~~~l~~~L~~~~~~~~~ihg~~~~~~R~~~~~  758 (1112)
                      +.++++..+.|.+.++. ...||..|+++|..+...+++||||..++.|+.|...|.+.||+|..|||+.++.+|..+++
T Consensus       578 ~~svV~k~V~q~v~V~~~e~eKf~kL~eLl~e~~e~~~tiiFv~~qe~~d~l~~~L~~ag~~~~slHGgv~q~dR~sti~  657 (997)
T KOG0334|consen  578 GRSVVCKEVTQVVRVCAIENEKFLKLLELLGERYEDGKTIIFVDKQEKADALLRDLQKAGYNCDSLHGGVDQHDRSSTIE  657 (997)
T ss_pred             cceeEeccceEEEEEecCchHHHHHHHHHHHHHhhcCCEEEEEcCchHHHHHHHHHHhcCcchhhhcCCCchHHHHhHHH
Confidence            99999999999999988 88999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhcCCccEEEecCcccccCCCCCCcEEEEeCCCCCHHHHHHHHccccCCCCccEEEEEecCCccCchHHHHHHHhhccC
Q 001262          759 DFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQ  838 (1112)
Q Consensus       759 ~F~~g~~~VLVaT~v~~~GlDi~~v~~VI~~~~p~s~~~y~QriGR~gR~G~~g~~~~~~~~~d~~~~~~i~~~l~~~~~  838 (1112)
                      +|++|.+.+||||+++++|||++.+.+||||++|+++++|+||+|||||+|++|.||+|+++.+..++.+|+++|..+++
T Consensus       658 dfK~~~~~LLvaTsvvarGLdv~~l~Lvvnyd~pnh~edyvhR~gRTgragrkg~AvtFi~p~q~~~a~dl~~al~~~~~  737 (997)
T KOG0334|consen  658 DFKNGVVNLLVATSVVARGLDVKELILVVNYDFPNHYEDYVHRVGRTGRAGRKGAAVTFITPDQLKYAGDLCKALELSKQ  737 (997)
T ss_pred             HHhccCceEEEehhhhhcccccccceEEEEcccchhHHHHHHHhcccccCCccceeEEEeChHHhhhHHHHHHHHHhccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhHHHHHHHHHHHHhhhhhhccCCC-CCCCCcCCChhHHHHHHHHHHHHHHHcCCCCCCCCCCchhhhhhccCC-Cc
Q 001262          839 VVPDDLKALADSFMAKVNQGLEQAHGTG-YGGSGFKFNEEEDEKRKAAKKAQAKEYGFEEDKSDSDDEDEGIRKAGG-DI  916 (1112)
Q Consensus       839 ~vp~~l~~~~~~~~~~~~~~~~~~~~~~-~~g~g~~~~~~~~~~r~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~-~~  916 (1112)
                      .+|..|+.|+..|+.+++.+....+++| |+|+||.|.+...+.++..+.++.+.+|+.+...+++.+.+....++. ..
T Consensus       738 ~~P~~l~~l~~~f~~~~~~~~s~~~~~Gg~~G~g~~~~~~~~~~~~~~ke~q~~~~g~~~~d~e~d~~~~~~~~~~~~~~  817 (997)
T KOG0334|consen  738 PVPKLLQALSERFKAKQKAGGSQVHGGGGFGGKGLKFDEVEEELRQERKEAQRKDLGLKEGDNESDIEVDNSDKASQPRE  817 (997)
T ss_pred             CCchHHHHHHHHHHhhhhcccccccccCcccCCcccccHHHHHHHHHHhhccccCcCCCCCCcccccccccchhhccccc
Confidence            9999999999999999999877767766 999999999998899999999999999998765554444332222211 11


Q ss_pred             hhhhHHHHHHHHHHhhhhccCCCCCchhhhcCCCCCCCCCCCCccCcCCCCCCCCcccCCCCCCCCcHHHHHHHHHHHHH
Q 001262          917 SQQDALAKISAIAAASKASASMPTPISAAQLLPNAGLPISLPGVLGLSIPGAAPTVSATGLPVVPNDGAARAAALAAAIN  996 (1112)
Q Consensus       917 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~a~~~  996 (1112)
                      +.+....       .   ... +.+..+.+.+...+...+++.+.+...++.       ..+ ....+...|-..|..+|
T Consensus       818 s~~~~~~-------~---~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~-~~~~~r~~a~~~A~~~~  878 (997)
T KOG0334|consen  818 SIQNPTF-------L---QVE-AESKTQEKTLLLGGELNAARPMVPYPVPGT-------AEF-QVIAARDDAEIKALLLN  878 (997)
T ss_pred             cccCccc-------c---ccc-ccccchhhhhhccccccccccccccccccc-------ccc-cccchhhhHHHHHhhcc
Confidence            1111100       0   000 001112222221111111121111111111       000 00112222333334444


Q ss_pred             HhhhHHHhhhccCCcC-----eEEEEEecCCCccchhhcccchhhhhHHhhhCCeEeccceeeCCCCCCCCCCCceEEEE
Q 001262          997 LQHNLAKIQADAMPEH-----YEAELEINDFPQNARWKVTHKETLGPISEWTGAAITTRGQYFPPSRIAGPGERKLYLFI 1071 (1112)
Q Consensus       997 ~~~~~~~~~~~~~~~~-----~~~~~~INd~pq~~R~~~t~~~~~~~i~~~tg~~i~~kG~y~~~~~~~~~~~~~Lyl~i 1071 (1112)
                      ++++..  .....++.     |.++++||||||.+||++|+++++..|.+.||++|||||+|||+|+.|++||++|||+|
T Consensus       879 ~~l~~~--~~~~s~d~~~~~~y~~~~~inD~Pq~~r~~vt~~~~L~~i~e~~~~~it~rg~f~~~gk~p~~gErklyl~v  956 (997)
T KOG0334|consen  879 AQLNYQ--LIDTSSDLILQFIYEAELEINDFPQNARWRVTYKEALLRISEPTAAGITTRGKFNPPGKEPKPGERKLYLLV  956 (997)
T ss_pred             ccceee--cccCCccccccceeeeeccccccchhcceeeechhhhhhccCccccceeeccccCCCCCCCCCcchhhhhhh
Confidence            444322  22333444     99999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCceeeC
Q 001262         1072 EGPTEQSVKRAKAELKRVLEDFTNQALSLPGGAQPGRYSVV 1112 (1112)
Q Consensus      1072 e~~~~~~v~~a~~~i~~~~~e~~~~~~~~~~~~~~~~~~~~ 1112 (1112)
                      ||+++..|++|+.+|+++|++++.+++.+.+...+|||.||
T Consensus       957 e~~~e~~vqra~~e~~r~l~e~~~~~~~~~~~~~~~~y~~~  997 (997)
T KOG0334|consen  957 EGPDELSVQRAIEELERLLEEEVVNLFSSLQPSCKGRYLVV  997 (997)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHHHHhccCCCccceeecC
Confidence            99999999999999999999999999887665559999997



>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1960 consensus Predicted RNA-binding protein, contains KH domains [RNA processing and modification] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05872 DUF853: Bacterial protein of unknown function (DUF853); InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1112
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 8e-82
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 5e-75
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 2e-67
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 1e-62
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 6e-56
2hyi_C413 Structure Of The Human Exon Junction Complex With A 7e-56
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 8e-56
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-55
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 4e-55
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 4e-54
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 4e-54
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 1e-50
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 2e-48
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 5e-47
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 2e-46
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-46
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 2e-46
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 7e-46
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-45
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 3e-45
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 1e-40
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 2e-39
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-39
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 2e-38
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 6e-38
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 1e-37
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 3e-37
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 3e-37
1fuu_A394 Yeast Initiation Factor 4a Length = 394 8e-37
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 1e-36
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 3e-36
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 4e-36
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 7e-36
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 8e-36
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 8e-36
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 2e-30
2jgn_A185 Ddx3 Helicase Domain Length = 185 5e-29
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 3e-27
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-25
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 3e-25
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 1e-24
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 4e-23
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 7e-22
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 2e-21
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 5e-21
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 1e-20
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 1e-20
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 1e-20
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 7e-20
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 8e-20
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 4e-19
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 1e-18
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 2e-18
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 5e-18
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 2e-17
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 3e-16
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 7e-16
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 2e-15
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 2e-14
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 4e-13
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 4e-13
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 4e-13
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 6e-12
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 9e-12
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 3e-11
4f91_B 1724 Brr2 Helicase Region Length = 1724 8e-10
4f92_B 1724 Brr2 Helicase Region S1087l Length = 1724 8e-10
2v1x_A591 Crystal Structure Of Human Recq-Like Dna Helicase L 5e-09
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 3e-08
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 1e-05
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 4e-04
3tmi_A695 Structural Basis For Rna Recognition And Activation 4e-04
2ykg_A696 Structural Insights Into Rna Recognition By Rig-I L 4e-04
4ay2_A687 Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I 5e-04
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure

Iteration: 1

Score = 302 bits (773), Expect = 8e-82, Method: Compositional matrix adjust. Identities = 169/407 (41%), Positives = 244/407 (59%), Gaps = 20/407 (4%) Query: 459 GKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKT 518 G + P I+++ + IM I Y +P P+Q A+P+I RD + A+TGSGKT Sbjct: 7 GNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKT 66 Query: 519 LAFVLPMLRHIKDQPPVAA-------------GDGPVGLIMAPTRELVQQIHSDIRKFAK 565 AF+LP+L I P A P+ L++APTREL QI+ + RKF+ Sbjct: 67 AAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSY 126 Query: 566 VMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDE 625 VR VYGG+ + QQI +L+RG ++V TPGR++D++ GKI L YLV+DE Sbjct: 127 RSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMM--ERGKI-GLDFCKYLVLDE 183 Query: 626 ADRMFDMGFEPQITRIV-QNIRPD---RQTVLFSATFPRQVEILARKVLNKPVEIQVGGR 681 ADRM DMGFEPQI RIV Q+ P R T++FSATFP+++++LAR L++ + + VG Sbjct: 184 ADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRV 243 Query: 682 SVVNKDITQLVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPC 741 +++ITQ V ESD+ LL+LL + L+FV +++ D+L L GY C Sbjct: 244 GSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYAC 303 Query: 742 LSLHGAKDQTDRESTISDFKSNVCNLLIATSVAARGLDVKELELVINFDAPNHYEDYVHR 801 S+HG + Q DRE + F+S +L+AT+VAARGLD+ ++ VINFD P+ E+YVHR Sbjct: 304 TSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHR 363 Query: 802 VGRTGRAGRKGCAITFISEEDAKYSPDLVKALELSEQVVPDDLKALA 848 +GRTGR G G A +F +E + + DL+ L ++Q VP L+ +A Sbjct: 364 IGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMA 410
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|4F91|B Chain B, Brr2 Helicase Region Length = 1724 Back     alignment and structure
>pdb|4F92|B Chain B, Brr2 Helicase Region S1087l Length = 1724 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|3TMI|A Chain A, Structural Basis For Rna Recognition And Activation Of Rig-I Length = 695 Back     alignment and structure
>pdb|2YKG|A Chain A, Structural Insights Into Rna Recognition By Rig-I Length = 696 Back     alignment and structure
>pdb|4AY2|A Chain A, Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I Length = 687 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1112
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 0.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 0.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-148
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-130
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-121
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-120
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-120
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-119
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-119
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-115
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-115
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-115
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 1e-115
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-112
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-110
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-109
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-108
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-108
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-108
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 5e-99
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 7e-81
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-76
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 7e-74
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-73
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 2e-73
3bor_A237 Human initiation factor 4A-II; translation initiat 4e-69
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 4e-69
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 4e-68
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 4e-67
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 5e-67
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 4e-65
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-62
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-61
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 2e-42
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 9e-42
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-41
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 3e-41
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 6e-40
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 5e-36
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 2e-33
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 6e-22
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 7e-18
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 6e-21
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-19
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-18
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-18
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-18
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-18
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-16
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-15
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-14
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 5e-13
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-11
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 9e-10
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-07
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 7e-17
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 2e-16
3b6e_A216 Interferon-induced helicase C domain-containing P; 3e-14
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-14
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-13
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-04
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-13
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 1e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-13
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-12
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-12
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
1yks_A440 Genome polyprotein [contains: flavivirin protease 6e-13
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 6e-13
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 1e-09
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 8e-13
2zuo_A861 MVP, major vault protein; repeat domains, protein- 9e-13
2zuo_A861 MVP, major vault protein; repeat domains, protein- 1e-09
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-08
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-12
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-10
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 8e-09
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 3e-12
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 6e-09
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 4e-12
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-09
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 5e-11
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 6e-11
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 9e-09
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 2e-09
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 4e-09
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 9e-09
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 5e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 7e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-04
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 6e-08
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 1e-07
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-07
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 7e-07
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 3e-06
2a6h_D 1524 DNA-directed RNA polymerase beta' chain; RNA polym 7e-06
2a6h_D 1524 DNA-directed RNA polymerase beta' chain; RNA polym 4e-05
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 2e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 2e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 7e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 9e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 6e-04
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 5e-05
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 1e-04
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 2e-04
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 2e-04
4f61_I240 Stathmin-like domain R4; alpha-tubulin, beta-tubul 5e-04
2xs1_A704 Programmed cell death 6-interacting protein; prote 7e-04
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
 Score =  647 bits (1672), Expect = 0.0
 Identities = 159/431 (36%), Positives = 241/431 (55%), Gaps = 16/431 (3%)

Query: 426 PFRKNFYIEVKEIARMTPEEVSAYRK--------QLELKIHGKDVPKPIKTWHQTGLTSK 477
            F   FYI  +          S             + +K+ G DVP+PI+ +    L   
Sbjct: 7   EFPGEFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDI 66

Query: 478 IMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAA 537
           I++ + K  Y+ P PIQ  ++PVI SGRD +  A+TGSGKT AF+LP+L  + + P    
Sbjct: 67  IIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELE 126

Query: 538 GDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCT 597
              P  +I++PTREL  QI ++ RKFA    ++   VYGG+    Q   + RG  +V+ T
Sbjct: 127 LGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIAT 186

Query: 598 PGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNI--RPDRQTVLFS 655
           PGR++D +              ++V+DEADRM DMGF   + RI+ ++  RP+ QT++FS
Sbjct: 187 PGRLLDFV---DRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFS 243

Query: 656 ATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQLVEVRPESDRFLRLLELLGEWYEKG 715
           ATFP +++ +A + L   V + +G       D+ Q +    +  +  +L+E+L E  +  
Sbjct: 244 ATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSE--QAD 301

Query: 716 KILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLLIATSVAA 775
             ++FV ++   D L   L +  +P  S+HG + Q+ RE  + DFK+    +LIATSVA+
Sbjct: 302 GTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVAS 361

Query: 776 RGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFIS-EEDAKYSPDLVKALE 834
           RGLD+K ++ VIN+D P+  +DYVHR+GRTGR G  G A +F   E+D   + DLVK LE
Sbjct: 362 RGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILE 421

Query: 835 LSEQVVPDDLK 845
            S Q VPD L+
Sbjct: 422 GSGQTVPDFLR 432


>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2a6h_D DNA-directed RNA polymerase beta' chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: e.29.1.2 PDB: 1smy_D* 1zyr_D* 1iw7_D* 2a69_D* 2a6e_D 2a68_D* 2be5_D* 2cw0_D 2o5i_D 2o5j_D* 2ppb_D* 3aoh_D* 3aoi_D* 3dxj_D* 3eql_D* 1ynj_D* 1l9z_D 1l9u_D* 1ynn_D* 2auj_D Length = 1524 Back     alignment and structure
>2a6h_D DNA-directed RNA polymerase beta' chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: e.29.1.2 PDB: 1smy_D* 1zyr_D* 1iw7_D* 2a69_D* 2a6e_D 2a68_D* 2be5_D* 2cw0_D 2o5i_D 2o5j_D* 2ppb_D* 3aoh_D* 3aoi_D* 3dxj_D* 3eql_D* 1ynj_D* 1l9z_D 1l9u_D* 1ynn_D* 2auj_D Length = 1524 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 Back     alignment and structure
>4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1112
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
3jux_A822 Protein translocase subunit SECA; protein transloc 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.98
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.97
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.97
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.97
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 99.96
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.96
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.95
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.95
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.94
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.92
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.92
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.92
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.92
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.91
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.9
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.79
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.87
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.86
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.85
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.85
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.82
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.77
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.73
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.71
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.75
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 98.11
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.05
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.03
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.97
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.95
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.87
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.83
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 97.7
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 97.62
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.61
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.16
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 97.03
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 96.49
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.43
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.4
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.33
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.31
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.02
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.86
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.85
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.43
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.26
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.23
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.13
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.11
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 95.09
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.98
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 94.93
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.86
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.83
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 94.82
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.75
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.73
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.69
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 94.58
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.56
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 94.54
2qgz_A308 Helicase loader, putative primosome component; str 94.32
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 94.07
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.82
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.81
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 93.66
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 93.58
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 93.53
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 93.44
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.37
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 93.29
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 93.21
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.13
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.97
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 92.87
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 92.79
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.75
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 92.32
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 92.21
2v1u_A387 Cell division control protein 6 homolog; DNA repli 92.21
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 92.2
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 92.04
3bos_A242 Putative DNA replication factor; P-loop containing 92.03
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 91.98
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 91.97
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 91.95
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.94
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 91.86
1x4n_A92 FAR upstream element binding protein 1; KH domain, 91.78
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 91.69
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 91.23
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 91.22
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 91.13
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 91.04
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 90.83
1x4m_A94 FAR upstream element binding protein 1; KH domain, 90.44
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 90.4
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 90.27
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 90.17
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 90.07
1we8_A104 Tudor and KH domain containing protein; structural 90.06
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 89.94
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 89.87
3pvs_A447 Replication-associated recombination protein A; ma 89.71
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 89.66
1vma_A306 Cell division protein FTSY; TM0570, structural gen 89.66
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 89.46
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 89.45
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 89.38
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 89.33
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 89.26
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 89.12
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 88.92
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 88.76
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 88.49
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 88.44
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 88.33
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 88.3
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 88.23
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 88.17
2r6a_A454 DNAB helicase, replicative helicase; replication, 88.07
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 87.6
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 87.35
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 87.34
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 87.13
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 86.97
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.91
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 86.71
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 86.66
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 86.59
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 86.58
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 86.53
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 86.44
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 86.29
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 86.29
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 86.28
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 85.89
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 85.83
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 85.61
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 85.59
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 85.51
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 85.11
2gno_A305 DNA polymerase III, gamma subunit-related protein; 85.03
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 85.01
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 84.84
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 84.71
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 84.54
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 84.51
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 84.3
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 84.25
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 84.08
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 84.01
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 83.99
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 83.86
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 83.73
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 83.73
2xxa_A433 Signal recognition particle protein; protein trans 83.65
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 83.28
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 83.11
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 82.79
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 82.55
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 82.31
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 82.15
3bor_A237 Human initiation factor 4A-II; translation initiat 82.11
2dgr_A83 Ring finger and KH domain-containing protein 1; st 82.01
2fna_A357 Conserved hypothetical protein; structural genomic 81.7
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 81.64
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 81.57
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 81.51
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 81.43
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 81.2
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 80.55
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=1.7e-64  Score=599.96  Aligned_cols=389  Identities=39%  Similarity=0.658  Sum_probs=361.5

Q ss_pred             cCceeccCCCCCcccccccCCCCHHHHHHHHHCCCCCChHHHHHHHHHHHcCCCEEEEcCCCChHHHHHHHHHHHHHhcC
Q 001262          453 LELKIHGKDVPKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQ  532 (1112)
Q Consensus       453 ~~~~v~~~~~p~pi~~~~~~~l~~~l~~~l~~~~~~~pt~iQ~~ai~~il~g~dvii~a~TGsGKT~~~llp~l~~l~~~  532 (1112)
                      ..+.+.|.++|.|+.+|.+++|++.+++.|..+||..|||+|.++||.+++|+|+|++++||||||++|++|++.++...
T Consensus        42 ~~~~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~  121 (434)
T 2db3_A           42 IPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLED  121 (434)
T ss_dssp             SCEEEESSSCCCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHS
T ss_pred             ceeEecCCCCCCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhc
Confidence            34678899999999999999999999999999999999999999999999999999999999999999999999999876


Q ss_pred             CCCCCCCCCcEEEEccchhHHHHHHHHHHHHhhhcCceEEEEeCCCChHHHHHHHhcCCeEEEeCchHHHHHHHhcCCCc
Q 001262          533 PPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKI  612 (1112)
Q Consensus       533 ~~~~~~~~~~~LIl~PtreLa~Q~~~~~~~~~~~~~i~~~~~~gg~~~~~~~~~l~~g~~IiV~Tp~~L~~~l~~~~~~~  612 (1112)
                      +......++++|||+||++||.|++..+.+++...++++++++||.....+...+..+++|+|+||++|++++....   
T Consensus       122 ~~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~---  198 (434)
T 2db3_A          122 PHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTF---  198 (434)
T ss_dssp             CCCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTS---
T ss_pred             ccccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCC---
Confidence            54334458899999999999999999999999888999999999999999988899999999999999999987643   


Q ss_pred             cccCCceEEEeccchhhhcCCCchhHHHHHHhc--CCCCcEEEEeccccHHHHHHHHHhcCCCeEEEecCccccccCceE
Q 001262          613 TNLRRVTYLVMDEADRMFDMGFEPQITRIVQNI--RPDRQTVLFSATFPRQVEILARKVLNKPVEIQVGGRSVVNKDITQ  690 (1112)
Q Consensus       613 ~~l~~i~~vViDEah~~~~~~f~~~i~~il~~~--~~~~q~il~SAT~~~~~~~l~~~~l~~p~~i~~~~~~~~~~~i~q  690 (1112)
                      ..+.++++|||||||+|++++|...+..|+..+  ++.+|+|+||||+|..+..++..++.+++.+.++........+.+
T Consensus       199 ~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~  278 (434)
T 2db3_A          199 ITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQ  278 (434)
T ss_dssp             CCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEE
T ss_pred             cccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccce
Confidence            568899999999999999999999999999885  678999999999999999999999999999998877777788899


Q ss_pred             EEEecccchhHHHHHHHHhhhhcCCeEEEEeCCHHHHHHHHHHHHhcCCCeeeecCCCCHHHHHHHHHHhhcCCccEEEe
Q 001262          691 LVEVRPESDRFLRLLELLGEWYEKGKILIFVHSQEKCDALFRDLLKHGYPCLSLHGAKDQTDRESTISDFKSNVCNLLIA  770 (1112)
Q Consensus       691 ~~~~~~~~~k~~~ll~~l~~~~~~~~vLIF~~s~~~~~~l~~~L~~~~~~~~~ihg~~~~~~R~~~~~~F~~g~~~VLVa  770 (1112)
                      .+.......+...|+.+|....  .++||||+++..|+.++..|...|+.+..+||++++.+|..+++.|++|..+||||
T Consensus       279 ~~~~~~~~~k~~~l~~~l~~~~--~~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLva  356 (434)
T 2db3_A          279 TIYEVNKYAKRSKLIEILSEQA--DGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIA  356 (434)
T ss_dssp             EEEECCGGGHHHHHHHHHHHCC--TTEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEE
T ss_pred             EEEEeCcHHHHHHHHHHHHhCC--CCEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEE
Confidence            8888888889999999887743  45999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccccCCCCCCcEEEEeCCCCCHHHHHHHHccccCCCCccEEEEEecC-CccCchHHHHHHHhhccCCCChhHHH
Q 001262          771 TSVAARGLDVKELELVINFDAPNHYEDYVHRVGRTGRAGRKGCAITFISE-EDAKYSPDLVKALELSEQVVPDDLKA  846 (1112)
Q Consensus       771 T~v~~~GlDi~~v~~VI~~~~p~s~~~y~QriGR~gR~G~~g~~~~~~~~-~d~~~~~~i~~~l~~~~~~vp~~l~~  846 (1112)
                      |+++++|||||++++|||||+|.++..|+||+||+||.|+.|.|++|+++ .+...+..|++.|....+.||++|..
T Consensus       357 T~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~~~~~~~~~l~~~l~~~~~~vp~~l~~  433 (434)
T 2db3_A          357 TSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRT  433 (434)
T ss_dssp             CGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEECTTTCGGGHHHHHHHHHHTTCCCCGGGC-
T ss_pred             chhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCCCCCEEEEEEeccccHHHHHHHHHHHHHcCCCCCHHHHh
Confidence            99999999999999999999999999999999999999999999999995 57788999999999999999998864



>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1112
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 5e-52
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 5e-51
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 5e-51
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 7e-51
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-50
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 4e-45
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 1e-43
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 1e-42
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-41
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 5e-37
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 4e-35
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 5e-31
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 1e-29
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 4e-28
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-27
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 7e-22
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 1e-21
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 1e-19
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 6e-18
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 9e-18
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 2e-17
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 4e-16
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 1e-15
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 3e-15
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 8e-15
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 5e-14
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 6e-13
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 1e-08
d1tf5a4175 c.37.1.19 (A:396-570) Translocation ATPase SecA, n 1e-07
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 3e-07
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 6e-07
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 3e-06
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 1e-05
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 1e-05
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 7e-05
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.001
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 3e-07
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-06
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 2e-06
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 3e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 2e-04
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 5e-04
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-06
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 9e-05
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 2e-04
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 3e-04
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 0.002
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 0.002
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 4e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 7e-04
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 0.001
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  179 bits (455), Expect = 5e-52
 Identities = 68/212 (32%), Positives = 114/212 (53%), Gaps = 11/212 (5%)

Query: 468 TWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGR-DCIGVAKTGSGKTLAFVLPML 526
            +++  L+  I+  IR   +EKP  IQ + +P+ ++   + +  A+TGSGKT +F +P++
Sbjct: 5   NFNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLI 64

Query: 527 RHIKDQPPVAAGDGPVGLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISE 586
             + +        G   +I+ PTREL  Q+  +I        ++   +YGG  +  QI  
Sbjct: 65  ELVNENN------GIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKA 118

Query: 587 LKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLVMDEADRMFDMGFEPQITRIVQNIR 646
           LK    IVV TPGR++D +        NL+ V Y ++DEAD M +MGF   + +I+    
Sbjct: 119 LK-NANIVVGTPGRILDHINR---GTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACN 174

Query: 647 PDRQTVLFSATFPRQVEILARKVLNKPVEIQV 678
            D++ +LFSAT PR++  LA+K +     I+ 
Sbjct: 175 KDKRILLFSATMPREILNLAKKYMGDYSFIKA 206


>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1112
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.98
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.95
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.95
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.93
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.93
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.92
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.91
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.9
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.9
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.89
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.89
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.85
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.85
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.84
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.83
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.78
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.77
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.77
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.69
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.67
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.67
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.65
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.65
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.64
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.58
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.51
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.44
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.39
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.37
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.31
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.15
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.06
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.77
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.59
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.51
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 98.08
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.82
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.95
d2qy9a2211 GTPase domain of the signal recognition particle r 96.72
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.69
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.68
d1okkd2207 GTPase domain of the signal recognition particle r 96.58
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 96.53
d1vmaa2213 GTPase domain of the signal recognition particle r 96.51
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.2
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.16
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.14
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.56
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 95.08
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 94.99
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 94.9
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 94.69
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 94.68
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.53
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 94.45
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 94.37
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 94.33
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 94.24
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 94.17
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.08
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.82
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.59
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 93.56
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.39
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 93.06
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 92.77
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 92.55
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 92.34
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 92.33
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 92.25
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 92.24
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 92.22
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 91.63
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 91.33
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.1
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 90.71
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.42
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.21
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 90.1
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.87
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.49
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.41
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 88.74
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 88.65
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.47
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 88.44
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 87.01
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 86.99
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 86.98
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 86.48
d2cpqa178 Fragile X mental retardation syndrome related prot 86.42
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 85.97
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 85.71
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 85.61
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 84.36
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 84.32
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 83.92
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 83.14
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 82.58
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 81.81
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 81.6
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 81.49
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 81.28
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.2e-40  Score=348.69  Aligned_cols=209  Identities=34%  Similarity=0.588  Sum_probs=195.7

Q ss_pred             CCcccccccCCCCHHHHHHHHHCCCCCChHHHHHHHHHHHcCCCEEEEcCCCChHHHHHHHHHHHHHhcCCCCCCCCCCc
Q 001262          463 PKPIKTWHQTGLTSKIMETIRKLNYEKPMPIQAQALPVIMSGRDCIGVAKTGSGKTLAFVLPMLRHIKDQPPVAAGDGPV  542 (1112)
Q Consensus       463 p~pi~~~~~~~l~~~l~~~l~~~~~~~pt~iQ~~ai~~il~g~dvii~a~TGsGKT~~~llp~l~~l~~~~~~~~~~~~~  542 (1112)
                      .....+|.+++|++.++++|..+||..|||+|.++||.++.|+|+|++|+||||||++|++|+++++...     ...++
T Consensus        13 ~~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~-----~~~~~   87 (222)
T d2j0sa1          13 VDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQ-----VRETQ   87 (222)
T ss_dssp             CCCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTT-----SCSCC
T ss_pred             CCCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccc-----ccCce
Confidence            3455689999999999999999999999999999999999999999999999999999999999987653     35789


Q ss_pred             EEEEccchhHHHHHHHHHHHHhhhcCceEEEEeCCCChHHHHHHHhcCCeEEEeCchHHHHHHHhcCCCccccCCceEEE
Q 001262          543 GLIMAPTRELVQQIHSDIRKFAKVMGVRCVPVYGGSGVAQQISELKRGTEIVVCTPGRMIDILCTSGGKITNLRRVTYLV  622 (1112)
Q Consensus       543 ~LIl~PtreLa~Q~~~~~~~~~~~~~i~~~~~~gg~~~~~~~~~l~~g~~IiV~Tp~~L~~~l~~~~~~~~~l~~i~~vV  622 (1112)
                      +||++||++||.|++..+..++...++++.+++||.....+...+..+++|||+|||+|.+++....   ..++++.+||
T Consensus        88 ~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~---~~~~~l~~lV  164 (222)
T d2j0sa1          88 ALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRS---LRTRAIKMLV  164 (222)
T ss_dssp             EEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTS---SCCTTCCEEE
T ss_pred             eEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccc---cccccceeee
Confidence            9999999999999999999999999999999999999999999999999999999999999886643   5788999999


Q ss_pred             eccchhhhcCCCchhHHHHHHhcCCCCcEEEEeccccHHHHHHHHHhcCCCeEEEec
Q 001262          623 MDEADRMFDMGFEPQITRIVQNIRPDRQTVLFSATFPRQVEILARKVLNKPVEIQVG  679 (1112)
Q Consensus       623 iDEah~~~~~~f~~~i~~il~~~~~~~q~il~SAT~~~~~~~l~~~~l~~p~~i~~~  679 (1112)
                      |||||+|+++||...+..|+..++..+|+++||||+|..+..+++.++++|+.|.++
T Consensus       165 lDEaD~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V~  221 (222)
T d2j0sa1         165 LDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVK  221 (222)
T ss_dssp             EETHHHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCEEECCC
T ss_pred             ecchhHhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCEEEEEe
Confidence            999999999999999999999999999999999999999999999999999988764



>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure