Citrus Sinensis ID: 001276

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------111
MGEPLGSALAGVDSPVKEDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQELTDGVTSMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCSPHESGDARLEDSSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRKSVKALNSSCA
cccccccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEEEEccccccccccccEEEEEEEccccEEEccccccccccEEEEEEcccccEEEEEEEEccccccEEEEEEcccccccEEcccccccccccccccEEEEEcccccccccEEEEEEEcccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHccccccccccccccccEEEEEEEEEccHHHHHHccccHHHHHHHHHccccccccEEEEEEEccccccccccccccEEEEEccEEccccccHHHHHccccccEEEEEEEEccEEEEEEEEEccccccccccccccccEEEccccHHHHHHccccccEEEEEccccHHHHcccccccEEEccccEEcccHHHHHHHHHHcccccEEEEEEEEEccccEEEEEEEEEEcccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccEEEEEEEccccccccccccccEEEEEEEEEccccccEEEEcccEEcccccEEEEEEEcccEEEcEEEEEEcccccEEEEEEccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEccEEEEcccccccccccccccccEEEEccccccccEEEEcccccEEEEEcccccccEEEccccccEEEEEEEcHHHHHHHHHHHHHcccccccEEcccccccccEEEEEEEEEEccHHHHHHccccHHHHHHHHHccccccEEEEEEEEccccHHHcccccccEEEEEccEEccccccHHHHHHccccccccccEEEEEEEEccEEEEEEEEEEEccccccccEEEccccccccccHHHHHccccccccccEEEEEEccccHHHHcccccccEEEEEccEEcccHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEcccccccccEEEEEccccccEEEEEEcccccccc
ccccccHHccccccccccHccccccccccccccccHHHHHHHHHHHHcEEEEEEEccccccccccccccccEEEEEccccEEEEEccEcccccEEEEEEEcccEEEEEEEEEEcccccEEEEEEcHHHccccccccccccccccccccEEEEEEcccccEEEEEEEEEEEcccccccccccccccccEEEEEEEccccccccccEEEccccEEEEEEEcccccccccccccHHHHHHHHHHHHccccHHHHHcccccccccEEEEEEEEccHHHHHHccccHHHHHHHHHHcccccccEEEEEEEccccccHcccccccEEEEEccEEEEEEccHHHHHccccccEEEEEEEEccEEEEEEEEEEcccccccccEEEEEEEEEccccHHHHHHHcccccEEEEEccccHHHHcccccccEEEEEcccccccHHHHHHHHHHcccccEEEEEEEEEccccccEEEEEEEcccccccccEEEEEcccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccEEEEEEEEccccccccccccccEcEEEEEEEEcccccEEEEEccEcccccccEEEEEEcccEEEEEEEEEEcccccEEEEEEcHHHccccccccccccccccccccccccEEEEEEcccccEEEEEEEEEccccHEccccccccccccccccEEEEEEcccccccccEEEccccEEEEEEEEEccccccccccccccEEEEccccHHHHHHHHHHHccccccccccccccccccEEEEEEEEEEEccHHHHHHccccHHHHHHHHHHccccccEEEEEEEccccccccccccccEEEEEcccEEEEEccHHHHHHHHccccccccEEEEEEEEccEEEEEEEEcccccccccccEEEEEcEEEccccHHHHHHHccccccccEEEEEcccccHHHHcccccccEEEEEcccccccHHHHHHHHHHcccccEEEEEEEEEccccEEEEEEEccccccEEEEEEccccccEEEEEEcccccccc
mgeplgsalagvdspvkedmcmevdpplrenvaTADDWRKALNKVVPAVVVLRTTACRafdteaagasyatgfvvdkrrgiiltnrhvvkpgpvVAEAMFvnreeipvypiyrdpvhdfgffrydpsaiqflnydeiplapeaaCVGLEIRVVGNDSGEKVSILAGTLArldrdaphykkdgyndfnTFYMQaasgtkggssgspvidwQGRAVAlnagsksssasafflPLERVVRALRFLQERrdcnihnweavsiprgtlqVTFVHKGFDETRRLGLQSATEQMvrhasppgetgllvvdsvvpggpahlrlepgdVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDlhsitpdyflevsgavihplsyqqarnfrfpcglvyvaepgymlfragvpRHAIIKKFAGEEISRLEDLISVLSKLsrgarvpieyssytdrhrRKSVLVTIdrhewyappqiytrndssglwsanpailsevlmpssginggvqgvASQTVSICGELVHMEHMHQRNNQELTDGVTSMETACEHAsaesisrgesdngrkkrrveenisadgvvadcsphesgdarledsstmenagsrdyfgapaattnasfaesvieptLVMFevhvppscmidgvhsqhffgTGVIIYHSQSMGLVVVDKNTVAISASDVMlsfaafpieipgevvflhpvhnfaliaydpsslgvaGASVVRaaellpepalrrgdsVYLVGLSRslqatsrksivtnpcaalnissadcpryrAMNMEVIEldtdfgstfsgvltdehgrVQAIWGSFStqvkfgcsssedhqfvrgipIYTISRVLDKIisgasgpsllingvkrpmplVRILEVELYPTLLSKARSFGLSDDWVQALVkkdpvrrqvlrvkgclagskaenmLEQGDMMLAinkqpvtcFHDIENACQALdkdgedngkldITIFRQGREIElqvgtdvrdgngttrvinwcgcivqdphpavralgflpeeghgvyvarwchgspvhryGLYALQWIVEingkrtpdlEAFVNVTKEIEHGEFVRVRTvhlngkprvltlkqdlhywptwelifdpdtaLWRRKSVKALNSSCA
mgeplgsalagvdspvkeDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTACRafdteaagasyatgfvvdkrrgiiltnrhvvkpgpvvAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGtlarldrdaphyKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKsssasafflpLERVVRALRFLQERRDCNihnweavsiprgtlQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLkletllddgVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVlsklsrgarvpieyssytdrhrrkSVLVtidrhewyappqIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQELTDGVTSMETACEHasaesisrgesdngrkkRRVEenisadgvvadcsphesGDARLEDSSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAEllpepalrrgdsVYLVGLSRslqatsrksivtnpcaalnissadcpRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGasgpsllingvkrPMPLVRILEVELYPTLLSKARSFGLSDDWVQAlvkkdpvrrqvlrvkgclagskaenMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFrqgreielqvgtdvrdgngTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTkeiehgefvrvrtvhlngkpRVLTLKQDLHYWPTWELIFDPDTALWRRKSVKALNSSCA
MGEPLGSALAGVDSPVKEDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAAsgtkggssgsPVIDWQGRAVALNagsksssasaFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQELTDGVTSMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCSPHESGDARLEDSSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRKSVKALNSSCA
******************************NVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQA************VIDWQGRAVAL*********SAFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLG*****************TGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHM**************************************************************************************ATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRR***********
************************************DWRKALNKVVPAVVVLRT******************FVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVV************LEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQD*************GAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVL********************CGELVHMEHMHQRNNQELTDG***************************RRVEENISADGVVADCSPHESG********************************SVIEPTLVMFEVHVPPS*************TGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVK**C**SEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVK**********MLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTD************WCGCIVQD************EEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRKS*********
********LAGVDSPVKEDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAA*********SPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQELTDGVTSME**********************RRVEENISADGVVADCS****************NAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRKSV********
********************CMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSS****************CGELVHMEHMH***NQELTDGVTSME***********************************************************RDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRKSVKAL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEPLGSALAGVDSPVKEDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQELTDGVTSMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCSPHESGDARLEDSSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPVRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRKSVKALNSSCA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1109 2.2.26 [Sep-21-2011]
Q8RY221097 Protease Do-like 7 OS=Ara yes no 0.985 0.996 0.769 0.0
A7TGI3990 Pro-apoptotic serine prot N/A no 0.412 0.462 0.444 1e-106
Q9P7S1996 PDZ domain-containing pro yes no 0.402 0.447 0.430 1e-105
Q0UY701017 Pro-apoptotic serine prot N/A no 0.409 0.446 0.456 1e-105
O74325997 PDZ domain-containing pro no no 0.394 0.438 0.488 1e-103
A4RJH41029 Pro-apoptotic serine prot N/A no 0.396 0.427 0.460 1e-103
A6RG851028 Pro-apoptotic serine prot N/A no 0.396 0.428 0.453 1e-102
Q4WLG11028 Pro-apoptotic serine prot yes no 0.405 0.437 0.465 1e-102
Q7S9D21026 Pro-apoptotic serine prot N/A no 0.404 0.437 0.469 1e-102
Q0CSC01038 Pro-apoptotic serine prot N/A no 0.405 0.433 0.459 1e-102
>sp|Q8RY22|DEGP7_ARATH Protease Do-like 7 OS=Arabidopsis thaliana GN=DEGP7 PE=2 SV=1 Back     alignment and function desciption
 Score = 1710 bits (4428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 853/1109 (76%), Positives = 956/1109 (86%), Gaps = 16/1109 (1%)

Query: 1    MGEPL----GSALAGVDSPVKEDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTA 56
            MG+PL      A    +S +KED+C+E+DPPL E+VATA+DWR+AL KVVPAVVVLRTTA
Sbjct: 1    MGDPLERLGSQASMATESVMKEDLCLEIDPPLTESVATAEDWRRALGKVVPAVVVLRTTA 60

Query: 57   CRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPV 116
            CRAFDTE+AGASYATGF+VDKRRGIILTNRHVVKPGPVVAEAMFVNREEIP+YP+YRDPV
Sbjct: 61   CRAFDTESAGASYATGFIVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPIYPVYRDPV 120

Query: 117  HDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAP 176
            HDFGFF YDPSA+QFL Y EIPLAPEAA VGLEIRVVGNDSGEKVSILAGTLARLDRDAP
Sbjct: 121  HDFGFFCYDPSAVQFLTYQEIPLAPEAASVGLEIRVVGNDSGEKVSILAGTLARLDRDAP 180

Query: 177  HYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVV 236
            HYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPL+RVV
Sbjct: 181  HYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLQRVV 240

Query: 237  RALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGE 296
            RAL FLQ+  D      +AV IPRGTLQ+TF+HKGFDE RRLGL+S TEQ+VRHASP GE
Sbjct: 241  RALSFLQKSIDSRTDKPKAVHIPRGTLQMTFLHKGFDEIRRLGLRSETEQVVRHASPTGE 300

Query: 297  TGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGI 356
            TG+LVVDSVVP GPA   LEPGDVLVRVNG V+TQFL LE LLDDGV + +EL IERGG 
Sbjct: 301  TGMLVVDSVVPSGPADKHLEPGDVLVRVNGTVLTQFLNLENLLDDGVGQILELEIERGGQ 360

Query: 357  SMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVP 416
             ++V++ VQDLHSITPD+FLEVSGAVIHPLSYQQARNFRFPCGL YVA+PGYMLFRAGVP
Sbjct: 361  PLSVSVSVQDLHSITPDHFLEVSGAVIHPLSYQQARNFRFPCGLAYVADPGYMLFRAGVP 420

Query: 417  RHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAP 476
            RHAIIKK A E+IS L DL+SVLSKLSRGARVP+EY S+TDRHR+KSVLVTID HEWYAP
Sbjct: 421  RHAIIKKVANEDISSLGDLVSVLSKLSRGARVPLEYMSHTDRHRKKSVLVTIDHHEWYAP 480

Query: 477  PQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQ 536
            PQ+YTRNDSSGLW A PAI    + PS G NG      SQ +S+C      E MH+ N +
Sbjct: 481  PQLYTRNDSSGLWDAKPAIEPASVSPSIGNNGFP---ISQDISLCHH--DTEPMHEVNVR 535

Query: 537  ELTDGVTSMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCSPHESGDARLED 596
             +TD    MET     S+   S+ +  +  KK+RV+E+ S+DG+ A+ S + S + + +D
Sbjct: 536  GVTDIAAIMET-----SSGDGSQNDFGSEAKKQRVDED-SSDGIAANGSLYGS-EFKSDD 588

Query: 597  SSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVI 656
            +   +    RD+ GA A + NAS AE  IEP LVMFEVHVPPSC +DGVHSQHFFGTG+I
Sbjct: 589  AMETDTTVLRDFEGATALSANASLAERAIEPALVMFEVHVPPSCSLDGVHSQHFFGTGII 648

Query: 657  IYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGV 716
            IYHS +MGL VVDKNTVAISASDVMLSFAAFP+EIPGEVVFLHPVHN+ALIAY+PS++  
Sbjct: 649  IYHSSNMGLAVVDKNTVAISASDVMLSFAAFPVEIPGEVVFLHPVHNYALIAYNPSAMDP 708

Query: 717  AGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRA 776
            A ASV+RAAELLPEPAL+RGDSVYLVGLSR+LQATSRKSIVTNPCAALNI SAD PRYRA
Sbjct: 709  ASASVIRAAELLPEPALQRGDSVYLVGLSRNLQATSRKSIVTNPCAALNIGSADSPRYRA 768

Query: 777  MNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTIS 836
             NMEVIELDTDFGS+FSG LTDE GR++AIWGSFSTQVK+  +SSEDHQFVRGIP+Y IS
Sbjct: 769  TNMEVIELDTDFGSSFSGALTDEQGRIRAIWGSFSTQVKYSSTSSEDHQFVRGIPVYAIS 828

Query: 837  RVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDP 896
            +VL+KII+G +GP+LLINGVKRPMPLVRILEVELYPTLLSKARSFGLSD+W+Q LVKKDP
Sbjct: 829  QVLEKIITGGNGPALLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDEWIQVLVKKDP 888

Query: 897  VRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDI 956
            VRRQVLRVKGCLAGSKAEN+LEQGDM+LA+NK PVTCF+DIE ACQ LDK    +  L++
Sbjct: 889  VRRQVLRVKGCLAGSKAENLLEQGDMVLAVNKMPVTCFNDIEAACQTLDKGSYSDENLNL 948

Query: 957  TIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWC 1016
            TI RQG+E+EL VGTD RDGNGTTRVINWCGC+VQDPHPAVRALGFLPEEGHGVYV RWC
Sbjct: 949  TILRQGQELELVVGTDKRDGNGTTRVINWCGCVVQDPHPAVRALGFLPEEGHGVYVTRWC 1008

Query: 1017 HGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLK 1076
            HGSP HRYGLYALQWIVE+NGK+TPDL AF + TKE+EHG+FVR+RTVHLNGKPRVLTLK
Sbjct: 1009 HGSPAHRYGLYALQWIVEVNGKKTPDLNAFADATKELEHGQFVRIRTVHLNGKPRVLTLK 1068

Query: 1077 QDLHYWPTWELIFDPDTALWRRKSVKALN 1105
            QDLHYWPTWEL FDP+TALWRR  +KAL 
Sbjct: 1069 QDLHYWPTWELRFDPETALWRRNILKALQ 1097
Probable serine protease.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|A7TGI3|NM111_VANPO Pro-apoptotic serine protease NMA111 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NMA111 PE=3 SV=1 Back     alignment and function description
>sp|Q9P7S1|YIFC_SCHPO PDZ domain-containing protein C23G3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23G3.12c PE=2 SV=1 Back     alignment and function description
>sp|Q0UY70|NM111_PHANO Pro-apoptotic serine protease NMA111 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NMA111 PE=3 SV=2 Back     alignment and function description
>sp|O74325|YH05_SCHPO PDZ domain-containing protein C1685.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1685.05 PE=4 SV=1 Back     alignment and function description
>sp|A4RJH4|NM111_MAGO7 Pro-apoptotic serine protease NMA111 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NMA111 PE=3 SV=1 Back     alignment and function description
>sp|A6RG85|NM111_AJECN Pro-apoptotic serine protease NMA111 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=NMA111 PE=3 SV=2 Back     alignment and function description
>sp|Q4WLG1|NM111_ASPFU Pro-apoptotic serine protease nma111 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nma111 PE=3 SV=1 Back     alignment and function description
>sp|Q7S9D2|NM111_NEUCR Pro-apoptotic serine protease nma-111 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nma-111 PE=3 SV=1 Back     alignment and function description
>sp|Q0CSC0|NM111_ASPTN Pro-apoptotic serine protease nma111 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nma111 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1109
2555844711112 protein binding protein, putative [Ricin 0.997 0.994 0.837 0.0
3594881971115 PREDICTED: protease Do-like 7-like [Viti 1.0 0.994 0.840 0.0
4494641561120 PREDICTED: protease Do-like 7-like [Cucu 0.992 0.983 0.827 0.0
2240693181128 predicted protein [Populus trichocarpa] 0.997 0.980 0.817 0.0
3565695311113 PREDICTED: protease Do-like 7-like [Glyc 0.997 0.993 0.815 0.0
3565398421113 PREDICTED: protease Do-like 7-like [Glyc 0.997 0.993 0.816 0.0
2960871691052 unnamed protein product [Vitis vinifera] 0.944 0.996 0.805 0.0
306788341097 protease Do-like 7 [Arabidopsis thaliana 0.985 0.996 0.769 0.0
2978288181097 hypothetical protein ARALYDRAFT_477585 [ 0.981 0.992 0.765 0.0
3571432901091 PREDICTED: protease Do-like 7-like [Brac 0.982 0.999 0.731 0.0
>gi|255584471|ref|XP_002532965.1| protein binding protein, putative [Ricinus communis] gi|223527258|gb|EEF29416.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1885 bits (4882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 930/1111 (83%), Positives = 1015/1111 (91%), Gaps = 5/1111 (0%)

Query: 1    MGEPL---GSALAGVDSPVKEDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTAC 57
            MG+PL   GS  A ++S +KED+CME+DPP +EN ATA+DWRKALNKVVPAVVVLRTTAC
Sbjct: 1    MGDPLERLGSETA-IESSMKEDLCMEIDPPFKENAATAEDWRKALNKVVPAVVVLRTTAC 59

Query: 58   RAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVH 117
            RAFDTE+AGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMF+NREEIP+YPIYRDPVH
Sbjct: 60   RAFDTESAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFLNREEIPIYPIYRDPVH 119

Query: 118  DFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPH 177
            DFGFF YDPSAIQFLNY+EIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPH
Sbjct: 120  DFGFFCYDPSAIQFLNYEEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPH 179

Query: 178  YKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVR 237
            YKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVR
Sbjct: 180  YKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVR 239

Query: 238  ALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGET 297
            ALRFLQ+ RD   + WEAV IPRGTLQVTF+HKGFDETRRLGLQS TEQ+VR ASPP ET
Sbjct: 240  ALRFLQKGRDSYTNKWEAVRIPRGTLQVTFLHKGFDETRRLGLQSDTEQLVRLASPPTET 299

Query: 298  GLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGIS 357
            G+LVVDSVVPGGPAH +LEPGDVLVRVNGEV TQFLKLE+LLDD VD+ IEL IERGG S
Sbjct: 300  GMLVVDSVVPGGPAHTKLEPGDVLVRVNGEVTTQFLKLESLLDDSVDQKIELQIERGGTS 359

Query: 358  MTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPR 417
            +TVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRF CGLVYV+EPGYMLFRAGVPR
Sbjct: 360  LTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFQCGLVYVSEPGYMLFRAGVPR 419

Query: 418  HAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPP 477
            HAIIKKFAGEEISR+++LISV+SKLSRGARVP+EY SY DRHRRKSVLVT+DRHEWYAPP
Sbjct: 420  HAIIKKFAGEEISRVDELISVISKLSRGARVPLEYLSYMDRHRRKSVLVTVDRHEWYAPP 479

Query: 478  QIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQE 537
            QIYTR+DSSGLW+A PAI  E L+ S+ IN   QG+ SQTVS+ GE  H EH++Q +  E
Sbjct: 480  QIYTRDDSSGLWTAKPAIQPEFLLQSTQINEIGQGLTSQTVSLSGEATHTEHVNQGDQPE 539

Query: 538  LTDGVTSMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCS-PHESGDARLED 596
            LTDGV SMET+ E +S E   + ESD G KKRRV +  S D  V+D S  HESG  +LED
Sbjct: 540  LTDGVISMETSYEQSSGEPNFQDESDVGTKKRRVSDLASNDIAVSDRSLLHESGGVKLED 599

Query: 597  SSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVI 656
             S++EN   RDY GA AAT NASFAESVIEPTLVMFEVHVPP+ M+DGVHSQHFFGTGVI
Sbjct: 600  RSSVENDVFRDYQGATAATANASFAESVIEPTLVMFEVHVPPTIMLDGVHSQHFFGTGVI 659

Query: 657  IYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGV 716
            +YHSQ MGLV VD+NTVAISASDVMLSFAAFPIEIPGEV+FLHPVHN+AL+AY+P +LG 
Sbjct: 660  VYHSQDMGLVAVDRNTVAISASDVMLSFAAFPIEIPGEVIFLHPVHNYALVAYNPLALGA 719

Query: 717  AGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRA 776
             GAS+VRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNI SADCPRYRA
Sbjct: 720  VGASMVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNIGSADCPRYRA 779

Query: 777  MNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTIS 836
             NMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQ+K+GC++SEDHQFVRGIPIY+IS
Sbjct: 780  TNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQLKYGCNTSEDHQFVRGIPIYSIS 839

Query: 837  RVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDP 896
            ++L+KII GA+GP LLINGV++PMPLVR LEVELYPTLLSKARSFGLSD WVQALVKKDP
Sbjct: 840  QILEKIIHGANGPPLLINGVRKPMPLVRTLEVELYPTLLSKARSFGLSDHWVQALVKKDP 899

Query: 897  VRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDI 956
            VRRQVLRVK CLAGSKAEN+LEQGDM+LA+NK+PVTCFHDIE ACQALDK GE++GKL++
Sbjct: 900  VRRQVLRVKVCLAGSKAENLLEQGDMVLAVNKEPVTCFHDIECACQALDKSGENDGKLNM 959

Query: 957  TIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWC 1016
            TIFRQGREI+L VGTDVR+GNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWC
Sbjct: 960  TIFRQGREIDLLVGTDVREGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWC 1019

Query: 1017 HGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLK 1076
            HGSPVHRYGLYALQWIVEINGK  PDL+AF+NVTKE+ HGEFVRVRTVHLNGKPRVLTLK
Sbjct: 1020 HGSPVHRYGLYALQWIVEINGKPVPDLDAFINVTKELGHGEFVRVRTVHLNGKPRVLTLK 1079

Query: 1077 QDLHYWPTWELIFDPDTALWRRKSVKALNSS 1107
            QDLHYWPTWEL FDP TA+W R+++KAL+ +
Sbjct: 1080 QDLHYWPTWELRFDPGTAMWSRETIKALDCN 1110

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359488197|ref|XP_002271823.2| PREDICTED: protease Do-like 7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449464156|ref|XP_004149795.1| PREDICTED: protease Do-like 7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224069318|ref|XP_002302954.1| predicted protein [Populus trichocarpa] gi|222844680|gb|EEE82227.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356569531|ref|XP_003552953.1| PREDICTED: protease Do-like 7-like [Glycine max] Back     alignment and taxonomy information
>gi|356539842|ref|XP_003538402.1| PREDICTED: protease Do-like 7-like [Glycine max] Back     alignment and taxonomy information
>gi|296087169|emb|CBI33543.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|30678834|ref|NP_566204.2| protease Do-like 7 [Arabidopsis thaliana] gi|75330785|sp|Q8RY22.1|DEGP7_ARATH RecName: Full=Protease Do-like 7 gi|19310429|gb|AAL84951.1| AT3g03380/T21P5_20 [Arabidopsis thaliana] gi|27363448|gb|AAO11643.1| At3g03380/T21P5_20 [Arabidopsis thaliana] gi|332640417|gb|AEE73938.1| protease Do-like 7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297828818|ref|XP_002882291.1| hypothetical protein ARALYDRAFT_477585 [Arabidopsis lyrata subsp. lyrata] gi|297328131|gb|EFH58550.1| hypothetical protein ARALYDRAFT_477585 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357143290|ref|XP_003572870.1| PREDICTED: protease Do-like 7-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1109
TAIR|locus:20996191097 DEG7 "degradation of periplasm 0.984 0.995 0.753 0.0
UNIPROTKB|A4RJH41029 NMA111 "Pro-apoptotic serine p 0.405 0.437 0.435 3.4e-147
POMBASE|SPAC23G3.12c996 SPAC23G3.12c "serine protease 0.401 0.446 0.413 1e-139
SGD|S000005067997 NMA111 "Serine protease and ge 0.424 0.472 0.411 6.4e-138
ASPGD|ASPL00000263441026 AN10673 [Emericella nidulans ( 0.400 0.432 0.438 2.2e-129
POMBASE|SPBC1685.05997 SPBC1685.05 "serine protease ( 0.394 0.438 0.461 6.8e-117
TIGR_CMR|ECH_1052471 ECH_1052 "serine protease, DO/ 0.073 0.174 0.333 7.2e-07
FB|FBgn0038233422 HtrA2 "HtrA2" [Drosophila mela 0.269 0.708 0.233 6.7e-06
UNIPROTKB|P18584497 htrA "Probable periplasmic ser 0.150 0.336 0.286 1.9e-05
UNIPROTKB|Q9PL97497 htrA "Probable periplasmic ser 0.145 0.323 0.284 3.1e-05
TAIR|locus:2099619 DEG7 "degradation of periplasmic proteins 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4331 (1529.6 bits), Expect = 0., P = 0.
 Identities = 835/1108 (75%), Positives = 939/1108 (84%)

Query:     1 MGEPL---GS-ALAGVDSPVKEDMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTA 56
             MG+PL   GS A    +S +KED+C+E+DPPL E+VATA+DWR+AL KVVPAVVVLRTTA
Sbjct:     1 MGDPLERLGSQASMATESVMKEDLCLEIDPPLTESVATAEDWRRALGKVVPAVVVLRTTA 60

Query:    57 CRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPV 116
             CRAFDTE+AGASYATGF+VDKRRGIILTNRHVVKPGPVVAEAMFVNREEIP+YP+YRDPV
Sbjct:    61 CRAFDTESAGASYATGFIVDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPIYPVYRDPV 120

Query:   117 HDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAP 176
             HDFGFF YDPSA+QFL Y EIPLAPEAA VGLEIRVVGNDSGEKVSILAGTLARLDRDAP
Sbjct:   121 HDFGFFCYDPSAVQFLTYQEIPLAPEAASVGLEIRVVGNDSGEKVSILAGTLARLDRDAP 180

Query:   177 HYKKDGYNDFNTFYMQAAXXXXXXXXXXPVIDWQGRAVALNXXXXXXXXXXFFLPLERVV 236
             HYKKDGYNDFNTFYMQAA          PVIDWQGRAVALN          FFLPL+RVV
Sbjct:   181 HYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLQRVV 240

Query:   237 RALRFLQERRDCNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGE 296
             RAL FLQ+  D      +AV IPRGTLQ+TF+HKGFDE RRLGL+S TEQ+VRHASP GE
Sbjct:   241 RALSFLQKSIDSRTDKPKAVHIPRGTLQMTFLHKGFDEIRRLGLRSETEQVVRHASPTGE 300

Query:   297 TGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGI 356
             TG+LVVDSVVP GPA   LEPGDVLVRVNG V+TQFL LE LLDDGV + +EL IERGG 
Sbjct:   301 TGMLVVDSVVPSGPADKHLEPGDVLVRVNGTVLTQFLNLENLLDDGVGQILELEIERGGQ 360

Query:   357 SMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVP 416
              ++V++ VQDLHSITPD+FLEVSGAVIHPLSYQQARNFRFPCGL YVA+PGYMLFRAGVP
Sbjct:   361 PLSVSVSVQDLHSITPDHFLEVSGAVIHPLSYQQARNFRFPCGLAYVADPGYMLFRAGVP 420

Query:   417 RHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAP 476
             RHAIIKK A E+IS L DL+SVLSKLSRGARVP+EY S+TDRHR+KSVLVTID HEWYAP
Sbjct:   421 RHAIIKKVANEDISSLGDLVSVLSKLSRGARVPLEYMSHTDRHRKKSVLVTIDHHEWYAP 480

Query:   477 PQIYTRNDSSGLWSANPAILSEVLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQ 536
             PQ+YTRNDSSGLW A PAI    + PS G NG      SQ +S+C      E MH+ N +
Sbjct:   481 PQLYTRNDSSGLWDAKPAIEPASVSPSIGNNGFP---ISQDISLCHH--DTEPMHEVNVR 535

Query:   537 ELTDGVTSMETACEHASAESISRGESDNGRKKRRVEENISADGVVADCSPHESGDARLED 596
              +TD    MET+    S +  S+ +  +  KK+RV+E+ S+DG+ A+ S + S + + +D
Sbjct:   536 GVTDIAAIMETS----SGDG-SQNDFGSEAKKQRVDED-SSDGIAANGSLYGS-EFKSDD 588

Query:   597 SSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVI 656
             +   +    RD+ GA A + NAS AE  IEP LVMFEVHVPPSC +DGVHSQHFFGTG+I
Sbjct:   589 AMETDTTVLRDFEGATALSANASLAERAIEPALVMFEVHVPPSCSLDGVHSQHFFGTGII 648

Query:   657 IYHSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGV 716
             IYHS +MGL VVDKNTVAISASDVMLSFAAFP+EIPGEVVFLHPVHN+ALIAY+PS++  
Sbjct:   649 IYHSSNMGLAVVDKNTVAISASDVMLSFAAFPVEIPGEVVFLHPVHNYALIAYNPSAMDP 708

Query:   717 AGASVVRAAELLPEPALRRGDSVYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRA 776
             A ASV+RAAELLPEPAL+RGDSVYLVGLSR+LQATSRKSIVTNPCAALNI SAD PRYRA
Sbjct:   709 ASASVIRAAELLPEPALQRGDSVYLVGLSRNLQATSRKSIVTNPCAALNIGSADSPRYRA 768

Query:   777 MNMEVIELDTDFGSTFSGVLTDEHGRVQAIWGSFSTQVKFGCSSSEDHQFVRGIPIYTIS 836
              NMEVIELDTDFGS+FSG LTDE GR++AIWGSFSTQVK+  +SSEDHQFVRGIP+Y IS
Sbjct:   769 TNMEVIELDTDFGSSFSGALTDEQGRIRAIWGSFSTQVKYSSTSSEDHQFVRGIPVYAIS 828

Query:   837 RVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDP 896
             +VL+KII+G +GP+LLINGVKRPMPLVRILEVELYPTLLSKARSFGLSD+W+Q LVKKDP
Sbjct:   829 QVLEKIITGGNGPALLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDEWIQVLVKKDP 888

Query:   897 VRRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDI 956
             VRRQVLRVKGCLAGSKAEN+LEQGDM+LA+NK PVTCF+DIE ACQ LDK    +  L++
Sbjct:   889 VRRQVLRVKGCLAGSKAENLLEQGDMVLAVNKMPVTCFNDIEAACQTLDKGSYSDENLNL 948

Query:   957 TIFRQGREIELQVGTDVRDGNGTTRVINWCGCIVQDPHPAVRALGFLPEEGHGVYVARWC 1016
             TI RQG+E+EL VGTD RDGNGTTRVINWCGC+VQDPHPAVRALGFLPEEGHGVYV RWC
Sbjct:   949 TILRQGQELELVVGTDKRDGNGTTRVINWCGCVVQDPHPAVRALGFLPEEGHGVYVTRWC 1008

Query:  1017 HGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHGEFVRVRTVHLNGKPRVLTLK 1076
             HGSP HRYGLYALQWIVE+NGK+TPDL AF + TKE+EHG+FVR+RTVHLNGKPRVLTLK
Sbjct:  1009 HGSPAHRYGLYALQWIVEVNGKKTPDLNAFADATKELEHGQFVRIRTVHLNGKPRVLTLK 1068

Query:  1077 QDLHYWPTWELIFDPDTALWRRKSVKAL 1104
             QDLHYWPTWEL FDP+TALWRR  +KAL
Sbjct:  1069 QDLHYWPTWELRFDPETALWRRNILKAL 1096
GO:0003824 "catalytic activity" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008236 "serine-type peptidase activity" evidence=ISS
GO:0008233 "peptidase activity" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0010205 "photoinhibition" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
UNIPROTKB|A4RJH4 NMA111 "Pro-apoptotic serine protease NMA111" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPAC23G3.12c SPAC23G3.12c "serine protease (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000005067 NMA111 "Serine protease and general molecular chaperone" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000026344 AN10673 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPBC1685.05 SPBC1685.05 "serine protease (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_1052 ECH_1052 "serine protease, DO/DeqQ family" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
FB|FBgn0038233 HtrA2 "HtrA2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P18584 htrA "Probable periplasmic serine endoprotease DegP-like" [Chlamydia trachomatis D/UW-3/CX (taxid:272561)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PL97 htrA "Probable periplasmic serine endoprotease DegP-like" [Chlamydia muridarum Nigg (taxid:243161)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RY22DEGP7_ARATH3, ., 4, ., 2, 1, ., -0.76910.98550.9963yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1109
pfam1281278 pfam12812, PDZ_1, PDZ-like domain 3e-26
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 3e-21
pfam13365138 pfam13365, Trypsin_2, Trypsin-like peptidase domai 8e-16
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 9e-13
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 5e-10
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 7e-10
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 8e-09
pfam1281278 pfam12812, PDZ_1, PDZ-like domain 1e-07
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 5e-05
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-04
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 4e-04
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 5e-04
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 7e-04
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 7e-04
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 0.001
pfam1318081 pfam13180, PDZ_2, PDZ domain 0.001
PRK10779449 PRK10779, PRK10779, zinc metallopeptidase RseP; Pr 0.002
TIGR02038351 TIGR02038, protease_degS, periplasmic serine pepet 0.003
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 0.004
>gnl|CDD|193288 pfam12812, PDZ_1, PDZ-like domain Back     alignment and domain information 
 Score =  102 bits (257), Expect = 3e-26
 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 369 SITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAG-VPRHAIIKKFAGE 427
           +ITPD F+EV+GA  H LSYQQAR++  P G VYVAE G     AG VP+  II     +
Sbjct: 1   AITPDRFVEVAGASFHDLSYQQARSYAIPVGGVYVAEAGGSFSLAGGVPKGWIITSVNNK 60

Query: 428 EISRLEDLISVLSKL 442
               L+  I V+ K+
Sbjct: 61  PTPNLDTFIEVMKKI 75

PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates. this is a family of PDZ-like domains from bacteria, plants and fungi. Length = 78
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|193288 pfam12812, PDZ_1, PDZ-like domain Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|182723 PRK10779, PRK10779, zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1109
KOG1421955 consensus Predicted signaling-associated protein ( 100.0
PRK10139455 serine endoprotease; Provisional 100.0
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 100.0
PRK10942473 serine endoprotease; Provisional 100.0
PRK10139455 serine endoprotease; Provisional 100.0
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 100.0
KOG1421 955 consensus Predicted signaling-associated protein ( 100.0
PRK10942473 serine endoprotease; Provisional 100.0
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 100.0
PRK10898353 serine endoprotease; Provisional 100.0
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 100.0
PRK10898353 serine endoprotease; Provisional 100.0
COG0265347 DegQ Trypsin-like serine proteases, typically peri 100.0
COG0265347 DegQ Trypsin-like serine proteases, typically peri 99.97
KOG1320473 consensus Serine protease [Posttranslational modif 99.9
KOG1320473 consensus Serine protease [Posttranslational modif 99.8
KOG3209984 consensus WW domain-containing protein [General fu 99.73
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.7
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.55
PRK10779449 zinc metallopeptidase RseP; Provisional 99.54
PF1281278 PDZ_1: PDZ-like domain 99.51
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 99.49
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 99.39
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.22
PF1281278 PDZ_1: PDZ-like domain 99.15
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.1
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 99.03
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.95
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.93
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.84
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.82
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.82
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.72
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.7
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.67
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 98.65
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.65
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.59
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.57
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.51
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.49
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.49
KOG3580 1027 consensus Tight junction proteins [Signal transduc 98.49
KOG3209984 consensus WW domain-containing protein [General fu 98.39
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 98.34
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.28
KOG35801027 consensus Tight junction proteins [Signal transduc 98.25
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.24
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 98.19
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 98.04
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 98.03
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.98
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 97.95
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 97.94
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 97.92
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 97.9
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 97.89
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 97.87
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.87
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.87
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 97.87
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.87
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.8
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.79
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.76
PLN00049389 carboxyl-terminal processing protease; Provisional 97.73
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 97.7
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.65
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 97.52
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.52
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 97.42
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.3
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.22
KOG3834462 consensus Golgi reassembly stacking protein GRASP6 97.21
KOG3605829 consensus Beta amyloid precursor-binding protein [ 97.18
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 97.16
KOG3605829 consensus Beta amyloid precursor-binding protein [ 97.15
COG3480342 SdrC Predicted secreted protein containing a PDZ d 97.14
KOG3129231 consensus 26S proteasome regulatory complex, subun 97.13
PRK09681276 putative type II secretion protein GspC; Provision 97.12
PRK09681276 putative type II secretion protein GspC; Provision 97.05
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 97.0
PRK11186 667 carboxy-terminal protease; Provisional 96.97
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 96.95
COG3975558 Predicted protease with the C-terminal PDZ domain 96.91
PRK11186667 carboxy-terminal protease; Provisional 96.89
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 96.81
KOG3129231 consensus 26S proteasome regulatory complex, subun 96.7
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 96.68
COG3031275 PulC Type II secretory pathway, component PulC [In 96.39
COG3031275 PulC Type II secretory pathway, component PulC [In 96.24
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 95.93
PF10459698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 95.76
PF05579297 Peptidase_S32: Equine arteritis virus serine endop 95.7
COG3975558 Predicted protease with the C-terminal PDZ domain 95.7
PF05580218 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR 95.34
PF02122203 Peptidase_S39: Peptidase S39; InterPro: IPR000382 94.63
PF10459698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 94.57
KOG35321051 consensus Predicted protein kinase [General functi 94.33
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 94.07
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 94.0
KOG3532 1051 consensus Predicted protein kinase [General functi 93.65
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 93.54
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 92.97
PF00949132 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine 92.97
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 92.71
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 92.36
KOG18921629 consensus Actin filament-binding protein Afadin [C 92.1
KOG3571626 consensus Dishevelled 3 and related proteins [Gene 91.21
KOG35421283 consensus cAMP-regulated guanine nucleotide exchan 91.13
PF08192695 Peptidase_S64: Peptidase family S64; InterPro: IPR 90.62
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 90.13
KOG3571 626 consensus Dishevelled 3 and related proteins [Gene 89.92
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 89.51
KOG3651429 consensus Protein kinase C, alpha binding protein 87.78
KOG0606 1205 consensus Microtubule-associated serine/threonine 86.89
COG0750375 Predicted membrane-associated Zn-dependent proteas 86.63
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 86.53
PF11874183 DUF3394: Domain of unknown function (DUF3394); Int 86.39
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 86.37
KOG3627256 consensus Trypsin [Amino acid transport and metabo 86.05
COG0750 375 Predicted membrane-associated Zn-dependent proteas 84.56
KOG2921 484 consensus Intramembrane metalloprotease (sterol-re 84.46
PF00944158 Peptidase_S3: Alphavirus core protein ; InterPro: 83.7
KOG0609 542 consensus Calcium/calmodulin-dependent serine prot 83.2
KOG3551506 consensus Syntrophins (type beta) [Extracellular s 82.7
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 82.55
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 81.41
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=8.3e-155  Score=1297.17  Aligned_cols=917  Identities=45%  Similarity=0.715  Sum_probs=855.0

Q ss_pred             cccccCCCCCcCCcCCcchHHHHHHHhCCceEEEEEEeeeccCCCCCCccEEEEEEEeCCCcEEEeCccccCCCCeEEEE
Q 001276           19 DMCMEVDPPLRENVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEA   98 (1109)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sVV~I~~~~~~~~d~~~~~~~~GSGfvV~~~~G~IlTn~HVv~~~~~~~~v   98 (1109)
                      +.+.+..|+.....+...+|+..+..+.+|||+|++++.+.||++.++.+.||||+|++..|||||||||++.++....+
T Consensus        35 el~~e~~p~~~~s~~~~e~w~~~ia~VvksvVsI~~S~v~~fdtesag~~~atgfvvd~~~gyiLtnrhvv~pgP~va~a  114 (955)
T KOG1421|consen   35 ELVIEPDPPLNESLATSEDWRNTIANVVKSVVSIRFSAVRAFDTESAGESEATGFVVDKKLGYILTNRHVVAPGPFVASA  114 (955)
T ss_pred             ccccccCCCCCcccchhhhhhhhhhhhcccEEEEEehheeecccccccccceeEEEEecccceEEEeccccCCCCceeEE
Confidence            34555555555556667799999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCeEEEEEEEEEcCCCcEEEEEEcCCCcccccccCCCCCCccCCCCCEEEEEecCCCCCCeEEEEEEEEecCCCCCC
Q 001276           99 MFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHY  178 (1109)
Q Consensus        99 ~~~~~~~~~a~vv~~d~~~DlAlLk~~~~~~~~~~l~~l~l~~~~~~~G~~V~~iG~p~g~~~si~~G~vs~~~~~~~~~  178 (1109)
                      .|.|.++++..++|+||.|||+++|++|+.+.+..+..++++++.+++|.+++++||++++++++..|++++++|++|.|
T Consensus       115 vf~n~ee~ei~pvyrDpVhdfGf~r~dps~ir~s~vt~i~lap~~akvgseirvvgNDagEklsIlagflSrldr~apdy  194 (955)
T KOG1421|consen  115 VFDNHEEIEIYPVYRDPVHDFGFFRYDPSTIRFSIVTEICLAPELAKVGSEIRVVGNDAGEKLSILAGFLSRLDRNAPDY  194 (955)
T ss_pred             EecccccCCcccccCCchhhcceeecChhhcceeeeeccccCccccccCCceEEecCCccceEEeehhhhhhccCCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCccccceeeEEEeeccCCCCCCCceecCCCcEEEEeccccCCCCCccccchHHHHHHHHHHHhcCCccccccccccc
Q 001276          179 KKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSI  258 (1109)
Q Consensus       179 ~~~~~~~~~~~~iq~~a~~~~G~SGgPv~n~~G~vVGi~~~~~~~~~~~falP~~~i~~~l~~l~~~~~~~~~~~~~~~v  258 (1109)
                      +...|+|||++|+|..+..++|+||+||+|.+|++|+++++++..++.+|+||+++++|+|.++++++          ++
T Consensus       195 g~~~yndfnTfy~QaasstsggssgspVv~i~gyAVAl~agg~~ssas~ffLpLdrV~RaL~clq~n~----------PI  264 (955)
T KOG1421|consen  195 GEDTYNDFNTFYIQAASSTSGGSSGSPVVDIPGYAVALNAGGSISSASDFFLPLDRVVRALRCLQNNT----------PI  264 (955)
T ss_pred             cccccccccceeeeehhcCCCCCCCCceecccceEEeeecCCcccccccceeeccchhhhhhhhhcCC----------Cc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999          89


Q ss_pred             CCCccceEEEEcChhHHHHcCCChhHHHhhhcCCCCCCCceEEEEEecCCCccccCCCCCCEEEEECCEEeCChhHHHHH
Q 001276          259 PRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHLRLEPGDVLVRVNGEVITQFLKLETL  338 (1109)
Q Consensus       259 ~rg~lg~~~~~~~~~~~r~lGl~~~~~~~~~~~~~~~~~G~lVv~~V~~~spA~~gL~~GD~Il~VnG~~v~~~~~l~~~  338 (1109)
                      +||+|+++|.+++|||||||||+.|||+.+|.++| ..+|||||+.|+++|||++.|++||++++||+..+.+|..+..+
T Consensus       265 tRGtLqvefl~k~~de~rrlGL~sE~eqv~r~k~P-~~tgmLvV~~vL~~gpa~k~Le~GDillavN~t~l~df~~l~~i  343 (955)
T KOG1421|consen  265 TRGTLQVEFLHKLFDECRRLGLSSEWEQVVRTKFP-ERTGMLVVETVLPEGPAEKKLEPGDILLAVNSTCLNDFEALEQI  343 (955)
T ss_pred             ccceEEEEEehhhhHHHHhcCCcHHHHHHHHhcCc-ccceeEEEEEeccCCchhhccCCCcEEEEEcceehHHHHHHHHH
Confidence            99999999999999999999999999999999999 89999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCeEEEEEEECCEEEEEEEEeecCCCCCCCccccccceEEecCCHHHhhccCCCCCeEEEEcCCChhHHcCCCCC
Q 001276          339 LDDGVDKNIELLIERGGISMTVNLVVQDLHSITPDYFLEVSGAVIHPLSYQQARNFRFPCGLVYVAEPGYMLFRAGVPRH  418 (1109)
Q Consensus       339 l~~~~g~~v~l~v~R~g~~~~~~v~l~~~~~~~~~~~~~~~G~~~~~l~~~~~~~~~~~~~gv~v~~pg~~a~~aGl~~G  418 (1109)
                      |++.+|+.+.|+|+|+|++.+++++++++|.++|+||+++||++||+++||++|.|.+|++|+||+++++.++..+-.-|
T Consensus       344 LDegvgk~l~LtI~Rggqelel~vtvqdlh~itp~R~levcGav~hdlsyq~ar~y~lP~~GvyVa~~~gsf~~~~~~y~  423 (955)
T KOG1421|consen  344 LDEGVGKNLELTIQRGGQELELTVTVQDLHGITPDRFLEVCGAVFHDLSYQLARLYALPVEGVYVASPGGSFRHRGPRYG  423 (955)
T ss_pred             HhhccCceEEEEEEeCCEEEEEEEEeccccCCCCceEEEEcceEecCCCHHHHhhcccccCcEEEccCCCCccccCCcce
Confidence            99999999999999999999999999999999999999999999999999999999999999999998655544443339


Q ss_pred             CEEEEcCCeecCCHHHHHHHHHhcCCCCeEeEEEEeecccccceEEEEEEecCCCCCCCeeeeecCCCCCceecccCCCC
Q 001276          419 AIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYTDRHRRKSVLVTIDRHEWYAPPQIYTRNDSSGLWSANPAILSE  498 (1109)
Q Consensus       419 D~I~~Vng~~v~~l~~~~~~i~~~~~g~~v~l~~~~~~~~~~~~~~~l~i~R~~~~~~~~~~~r~d~~g~W~~~~~~~~~  498 (1109)
                      ++|.+||++++++|++|+++++++++|+||+++|+|++|+|+.++..++||| ||||++++++|||++|+||+.++.+|.
T Consensus       424 ~ii~~vanK~tPdLdaFidvlk~L~dg~rV~vry~hl~dkh~p~v~~v~iDr-Hwy~p~~~~trndetglWdrk~L~~pq  502 (955)
T KOG1421|consen  424 QIIDSVANKPTPDLDAFIDVLKELPDGARVPVRYHHLTDKHSPRVTTVTIDR-HWYWPFREYTRNDETGLWDRKNLKDPQ  502 (955)
T ss_pred             EEEEeecCCcCCCHHHHHHHHHhccCCCeeeEEEEEecCCCCceEEEEEEec-cccccceeeeeCCCcccccccccCCCC
Confidence            9999999999999999999999999999999999999999999999999999 999999999999999999999999998


Q ss_pred             CCCCCCCCCCCccCcccccccccccccccccccccCccccccCccccccccccccccccccCCCcccccccceeeccccC
Q 001276          499 VLMPSSGINGGVQGVASQTVSICGELVHMEHMHQRNNQELTDGVTSMETACEHASAESISRGESDNGRKKRRVEENISAD  578 (1109)
Q Consensus       499 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  578 (1109)
                      |              +.+.+|.+.+..+                                                    
T Consensus       503 P--------------a~~~kP~s~~ip~----------------------------------------------------  516 (955)
T KOG1421|consen  503 P--------------AISIKPASVSIPS----------------------------------------------------  516 (955)
T ss_pred             c--------------ccccCCccccCCC----------------------------------------------------
Confidence            7              3456665544220                                                    


Q ss_pred             CccccCCCCCCCCccccccccccccCCCCCCCCCcccCccccccccccccEEEEEEEcCcccccCCcccceeeEEEEEEE
Q 001276          579 GVVADCSPHESGDARLEDSSTMENAGSRDYFGAPAATTNASFAESVIEPTLVMFEVHVPPSCMIDGVHSQHFFGTGVIIY  658 (1109)
Q Consensus       579 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SvV~V~~~~~~~~~~dg~~~~~~~GsG~VId  658 (1109)
                                     ++                     ..++..+++..++|.|.+.+|  ..+||..+....|||+|++
T Consensus       517 ---------------i~---------------------~~~~~~~~i~~~~~~v~~~~~--~~l~g~s~~i~kgt~~i~d  558 (955)
T KOG1421|consen  517 ---------------IG---------------------VNNFPSADISNCLVDVEPMMP--VNLDGVSSDIYKGTALIMD  558 (955)
T ss_pred             ---------------cC---------------------cCCcchhHHhhhhhhheecee--eccccchhhhhcCceEEEE
Confidence                           11                     112234668899999999999  5999999988999999999


Q ss_pred             eeCCceEEEEeCceecCCCCcEEEEeecCCeEEeEEEEEeeCCCcEEEEEECCCCCCcccccceeceecCCCccCCCCCe
Q 001276          659 HSQSMGLVVVDKNTVAISASDVMLSFAAFPIEIPGEVVFLHPVHNFALIAYDPSSLGVAGASVVRAAELLPEPALRRGDS  738 (1109)
Q Consensus       659 ~~~~~G~IlTn~~~V~~~~~di~V~~~d~~~~~~a~vv~~dp~~dlAilk~d~~~l~~~~~~~v~~~~l~~~~~l~~G~~  738 (1109)
                        ..+|+++++|.+|+.+++|++|+++| +..++|.+.|+||.+|+|++||||+..-.        ++|.+.. +++||+
T Consensus       559 --~~~g~~vvsr~~vp~d~~d~~vt~~d-S~~i~a~~~fL~~t~n~a~~kydp~~~~~--------~kl~~~~-v~~gD~  626 (955)
T KOG1421|consen  559 --TSKGLGVVSRSVVPSDAKDQRVTEAD-SDGIPANVSFLHPTENVASFKYDPALEVQ--------LKLTDTT-VLRGDE  626 (955)
T ss_pred             --ccCCceeEecccCCchhhceEEeecc-cccccceeeEecCccceeEeccChhHhhh--------hccceee-EecCCc
Confidence              47999999999999999999999998 99999999999999999999999986643        7887765 999999


Q ss_pred             EEEEeeCCCCcceeeeeeEeccccccccCCCCCCcccccceeEEEEecccCCCC-CceEEcCCeeEEEEEeecccccccc
Q 001276          739 VYLVGLSRSLQATSRKSIVTNPCAALNISSADCPRYRAMNMEVIELDTDFGSTF-SGVLTDEHGRVQAIWGSFSTQVKFG  817 (1109)
Q Consensus       739 V~~iG~p~~~~~~~~~~~vt~i~~~~~i~~~~~~~y~~~~~~~I~~d~~ig~~s-GGpL~d~~G~VvGi~~~~~~~~~~g  817 (1109)
                      +.+.|+..+++.++++++|++++ ..++++...||||++|+++|.++++++..| .|.|.|.||+|+|+|+.+.++.   
T Consensus       627 ~~f~g~~~~~r~ltaktsv~dvs-~~~~ps~~~pr~r~~n~e~Is~~~nlsT~c~sg~ltdddg~vvalwl~~~ge~---  702 (955)
T KOG1421|consen  627 CTFEGFTEDLRALTAKTSVTDVS-VVIIPSSVMPRFRATNLEVISFMDNLSTSCLSGRLTDDDGEVVALWLSVVGED---  702 (955)
T ss_pred             eeEecccccchhhcccceeeeeE-EEEecCCCCcceeecceEEEEEeccccccccceEEECCCCeEEEEEeeeeccc---
Confidence            99999999999999999999987 778999999999999999999999998767 9999999999999999988873   


Q ss_pred             CCCCCCceeEecccHHHHHHHHHHHHcCCCCCcccccccccCCCceeeeeeEEEEcChHhHHHcCCCHHHHHHHHhcCCC
Q 001276          818 CSSSEDHQFVRGIPIYTISRVLDKIISGASGPSLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSDDWVQALVKKDPV  897 (1109)
Q Consensus       818 ~~~~~~~~~~~aipi~~i~~~l~~l~~~~~~~~~~~~~v~r~~p~~~~Lgv~~~~i~~~~a~~~Gl~~~wi~~~~~~~~~  897 (1109)
                       .++.+..|.+|+.+.+++++|++|+.+.+             +..+++|+||..|++.+||.+|+|.|||-++++....
T Consensus       703 -~~~kd~~y~~gl~~~~~l~vl~rlk~g~~-------------~rp~i~~vef~~i~laqar~lglp~e~imk~e~es~~  768 (955)
T KOG1421|consen  703 -VGGKDYTYKYGLSMSYILPVLERLKLGPS-------------ARPTIAGVEFSHITLAQARTLGLPSEFIMKSEEESTI  768 (955)
T ss_pred             -cCCceeEEEeccchHHHHHHHHHHhcCCC-------------CCceeeccceeeEEeehhhccCCCHHHHhhhhhcCCC
Confidence             45688889999999999999999999953             3456999999999999999999999999999999999


Q ss_pred             ccceEEEEeecCCCHHhhhccCCCEEEEECCEEcCChhHHHHHHHhccCCCCCCCeEEEEEEeCCEEEEEEEeeeecCCC
Q 001276          898 RRQVLRVKGCLAGSKAENMLEQGDMMLAINKQPVTCFHDIENACQALDKDGEDNGKLDITIFRQGREIELQVGTDVRDGN  977 (1109)
Q Consensus       898 ~~~~~~V~~V~~~spA~~aL~~GDiIlsVnG~~V~~~~dl~~~l~~~~~g~~~~~~v~l~V~R~g~~~~l~v~l~~~~~~  977 (1109)
                      ++|+++|++|.+..+-  .|..||+|+++|||.|+.++||.. +          ..++++|+|+|.++++++++.+..  
T Consensus       769 ~~ql~~ishv~~~~~k--il~~gdiilsvngk~itr~~dl~d-~----------~eid~~ilrdg~~~~ikipt~p~~--  833 (955)
T KOG1421|consen  769 PRQLYVISHVRPLLHK--ILGVGDIILSVNGKMITRLSDLHD-F----------EEIDAVILRDGIEMEIKIPTYPEY--  833 (955)
T ss_pred             cceEEEEEeeccCccc--ccccccEEEEecCeEEeeehhhhh-h----------hhhheeeeecCcEEEEEecccccc--
Confidence            9999999999886652  399999999999999999999986 3          358899999999999999987665  


Q ss_pred             CcceEEeecCccccCCchhhhh-ccCCCCCCCcEEEEEecCCChhhhcCCCCCCeEEEECCeeCCCHHHHHHHHHhCCCC
Q 001276          978 GTTRVINWCGCIVQDPHPAVRA-LGFLPEEGHGVYVARWCHGSPVHRYGLYALQWIVEINGKRTPDLEAFVNVTKEIEHG 1056 (1109)
Q Consensus       978 ~t~~~~~~~G~~~~~p~~~~r~-~~~lp~~~~gV~V~~v~~gSPA~~~GL~~gD~I~~VNg~~v~~l~~f~~~l~~~~~~ 1056 (1109)
                      +++|.+.|.|+++|+||+++++ ...+|.   ||||+.+..||||.+ +|.+..||++|||..++++|+|..+++++|+|
T Consensus       834 et~r~vi~~gailq~ph~av~~q~edlp~---gvyvt~rg~gspalq-~l~aa~fitavng~~t~~lddf~~~~~~ipdn  909 (955)
T KOG1421|consen  834 ETSRAVIWMGAILQPPHSAVFEQVEDLPE---GVYVTSRGYGSPALQ-MLRAAHFITAVNGHDTNTLDDFYHMLLEIPDN  909 (955)
T ss_pred             ccceEEEEEeccccCchHHHHHHHhccCC---ceEEeecccCChhHh-hcchheeEEEecccccCcHHHHHHHHhhCCCC
Confidence            8999999999999999999998 488998   999999999999999 99999999999999999999999999999999


Q ss_pred             ceEEEEEEEeCCeEEEEEEeeCCccCcceEEEEcCCCCCeEEEEe
Q 001276         1057 EFVRVRTVHLNGKPRVLTLKQDLHYWPTWELIFDPDTALWRRKSV 1101 (1109)
Q Consensus      1057 ~~v~l~~v~rdg~~~~i~lk~~~~y~pt~e~~~~~~~~~w~~~~~ 1101 (1109)
                      .||+++.++|||.+..+++|+|+|||||.+|.+|..+. |+.++.
T Consensus       910 syv~v~~mtfd~vp~~~s~k~n~hyfpt~~l~rd~~~~-wi~kev  953 (955)
T KOG1421|consen  910 SYVQVKQMTFDGVPSIVSVKPNPHYFPTCILERDSNGR-WITKEV  953 (955)
T ss_pred             ceEEEEEeccCCCceEEEeccCCccCceeEEEecccCc-eeeeec
Confidence            99999999999999999999999999999999998655 977663

>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02122 Peptidase_S39: Peptidase S39; InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>PF11874 DUF3394: Domain of unknown function (DUF3394); InterPro: IPR021814 This domain is functionally uncharacterised Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG3627 consensus Trypsin [Amino acid transport and metabolism] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3551 consensus Syntrophins (type beta) [Extracellular structures] Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1109
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 1e-13
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 3e-06
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 3e-13
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 2e-07
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 6e-07
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 3e-12
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 1e-07
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 9e-06
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 4e-12
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 4e-07
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 6e-12
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 1e-11
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 1e-04
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 3e-10
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 5e-10
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 3e-04
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 1e-09
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 2e-09
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 8e-09
2hga_A125 Conserved protein MTH1368; GFT structural genomics 1e-08
2hga_A125 Conserved protein MTH1368; GFT structural genomics 9e-04
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 1e-08
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 6e-06
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 5e-08
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 1e-07
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 2e-04
2kl1_A94 YLBL protein; structure genomics, structural genom 1e-07
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 1e-07
3k6y_A237 Serine protease, possible membrane-associated seri 3e-07
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 4e-07
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 5e-07
2o8l_A274 V8 protease, taphylococcal serine; serine protease 6e-07
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 6e-07
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 2e-04
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 9e-07
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 1e-06
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 2e-06
1hpg_A187 Glutamic acid specific protease; serine protease, 3e-06
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 6e-06
4fgm_A597 Aminopeptidase N family protein; structural genomi 7e-06
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 2e-05
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 4e-05
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 5e-05
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 6e-05
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 6e-05
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 9e-05
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 9e-05
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 1e-04
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-04
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 2e-04
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 2e-04
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-04
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-04
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 7e-04
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 7e-04
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 8e-04
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 9e-04
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 9e-04
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
 Score = 72.3 bits (178), Expect = 1e-13
 Identities = 71/349 (20%), Positives = 134/349 (38%), Gaps = 36/349 (10%)

Query: 26  PPLRENVATADDWRKALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTN 85
           PP     +  +     + K  PAVV +       F       S  +GFVV    G+I+TN
Sbjct: 5   PPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAAD-GLIVTN 63

Query: 86  RHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAP---- 141
            HVV     V     ++ +         DPV D    R           + +P  P    
Sbjct: 64  AHVVADRRRV-RVRLLSGDTYEAVVTAVDPVADIATLRIQTK-------EPLPTLPLGRS 115

Query: 142 EAACVGLEIRVVGNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQ--AASGTKG 199
                G  +  +G+    + +I +G ++   R A      G    N  Y+Q  AA     
Sbjct: 116 ADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPAR---DLGLPQTNVEYIQTDAA--IDF 170

Query: 200 GSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLERVVRALRFLQERRDCNIHNWEAVSIP 259
           G++G P+++  G  + +N   K ++  +F +P +R+   L   +++      +       
Sbjct: 171 GNAGGPLVNLDGEVIGVNT-MKVTAGISFAIPSDRLREFLHRGEKKN----SSSGISGSQ 225

Query: 260 RGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHL-RLEPG 318
           R  + V  +      +  +    A  Q+   + P  + G+L+   V+ G PAH   L PG
Sbjct: 226 RRYIGVMML----TLSPSI---LAELQLREPSFPDVQHGVLIH-KVILGSPAHRAGLRPG 277

Query: 319 DVLVRVNGEVITQFLKLETLLDDGVDKNIELLIERGGISMTVNLVVQDL 367
           DV++ +  +++     +   +       + + I RG  ++T+ +  +  
Sbjct: 278 DVILAIGEQMVQNAEDVYEAV--RTQSQLAVQIRRGRETLTLYVTPEVT 324
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Length = 198 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Length = 191 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Length = 181 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1109
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 100.0
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 100.0
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 100.0
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 100.0
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 100.0
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 100.0
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 100.0
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 100.0
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 100.0
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 100.0
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 100.0
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 100.0
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 100.0
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 100.0
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 100.0
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 100.0
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 100.0
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 100.0
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 100.0
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 100.0
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.97
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.96
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.96
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.95
3k6y_A237 Serine protease, possible membrane-associated seri 99.92
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.91
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.91
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.9
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.87
3k6y_A237 Serine protease, possible membrane-associated seri 99.81
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.81
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.76
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.73
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.72
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.68
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.66
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 99.66
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.63
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.63
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.61
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.6
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.59
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.59
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.58
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 99.57
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.56
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.55
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.55
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.54
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.54
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.53
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.52
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.49
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.49
1hpg_A187 Glutamic acid specific protease; serine protease, 99.47
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.47
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.45
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 99.44
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.41
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.41
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.37
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.35
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.24
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.24
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 99.23
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.22
2xkx_A721 Disks large homolog 4; structural protein, scaffol 99.21
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.2
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 99.19
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.16
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 99.15
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.14
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.12
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 99.12
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.09
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.08
1hpg_A187 Glutamic acid specific protease; serine protease, 99.06
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 99.05
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.05
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.02
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 99.0
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 98.95
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 98.95
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.94
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.94
2kl1_A94 YLBL protein; structure genomics, structural genom 98.93
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.93
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 98.92
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.9
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.89
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.88
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 98.87
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.86
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.85
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.82
2kl1_A94 YLBL protein; structure genomics, structural genom 98.81
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.78
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 98.78
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.77
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.75
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.71
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.7
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.69
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.68
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.68
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.68
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.66
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.65
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.64
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.62
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.61
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 98.6
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 98.6
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.59
2v90_A96 PDZ domain-containing protein 3; membrane, protein 98.59
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.58
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.58
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 98.58
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.58
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.57
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.56
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 98.55
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.55
2v90_A96 PDZ domain-containing protein 3; membrane, protein 98.54
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.54
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.53
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.53
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.51
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.5
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 98.5
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.49
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.49
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.49
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.49
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.49
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.48
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.48
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.48
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.47
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.47
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.47
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.47
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.46
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.46
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.46
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.45
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.45
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.45
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.45
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.45
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.44
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.44
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.44
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.43
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.43
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.43
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.42
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.42
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.42
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.42
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.42
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.41
2awx_A105 Synapse associated protein 97; membrane protein, s 98.41
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 98.41
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.41
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.4
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.4
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.4
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 98.4
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.4
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.39
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.39
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 98.39
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.39
1a7s_A225 Heparin binding protein; serine protease homolog, 98.38
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.38
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.38
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 98.38
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.38
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.38
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.37
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.37
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.37
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.37
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 98.37
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.37
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.37
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.36
2awx_A105 Synapse associated protein 97; membrane protein, s 98.36
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.36
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.36
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.36
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.36
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.36
2d90_A102 PDZ domain containing protein 1; structural genomi 98.36
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.36
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.35
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.35
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 98.35
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.35
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.35
2xw9_A228 Complement factor D; immune system, hydrolase, ser 98.35
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 98.35
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.35
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.35
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.35
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.35
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.35
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.34
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.34
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.34
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.34
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.34
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.34
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 98.34
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.33
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.33
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.32
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.32
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.32
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.32
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.32
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.32
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.32
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 98.32
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.32
2ego_A96 General receptor for phosphoinositides 1- associat 98.31
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.31
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.31
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.31
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.31
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.31
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.31
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.31
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.3
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.3
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 98.3
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 98.3
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.3
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.3
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.29
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.29
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.29
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.29
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.29
2aiq_A231 Protein C activator; snake venom serine proteinase 98.29
2ego_A96 General receptor for phosphoinositides 1- associat 98.29
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.29
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.29
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 98.28
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 98.28
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.28
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.28
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.28
2d90_A102 PDZ domain containing protein 1; structural genomi 98.28
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.28
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.28
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 98.28
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.28
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.27
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.27
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.27
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.27
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.27
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.27
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.27
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.26
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 98.26
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.26
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.26
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.26
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 98.26
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.25
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.25
2z7f_E218 Leukocyte elastase; serine protease, serine protea 98.25
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.25
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.25
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 98.25
1ao5_A237 Glandular kallikrein-13; serine protease, protein 98.25
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.25
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 98.25
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.24
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.24
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.24
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.23
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.23
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.23
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.23
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 98.23
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.23
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 98.23
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.23
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.23
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.22
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.22
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.22
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 98.22
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.22
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.22
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 98.22
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.22
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.21
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.21
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.21
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 98.21
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.21
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.21
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.2
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.2
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.2
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.2
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.19
1azz_A226 Collagenase; complex (serine protease/inhibitor), 98.19
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.19
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 98.19
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.19
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.18
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.18
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 98.18
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 98.18
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 98.18
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.18
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 98.18
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.17
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.17
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.17
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.17
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.17
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.16
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.16
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.16
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.16
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.15
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.15
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 98.15
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.15
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.15
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.15
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.15
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.15
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.15
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.15
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.15
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 98.14
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.14
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.14
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.14
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.14
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.14
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.13
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.13
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 98.13
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.13
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.13
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 98.13
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.13
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.12
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 98.12
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.12
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.12
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 98.12
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.12
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.12
1lvm_A229 Catalytic domain of the nuclear inclusion protein 98.12
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.12
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.11
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.11
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.11
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.11
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.11
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.1
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.1
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.1
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.1
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.1
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.1
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.1
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.1
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 98.1
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.1
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.09
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.09
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.09
1euf_A227 Duodenase; serine protease, dual specificity, hydr 98.09
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 98.08
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 98.08
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.08
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.08
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.08
1aut_C250 Activated protein C; serine proteinase, plasma cal 98.08
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.08
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.08
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.07
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.07
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.07
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.07
2jde_A276 Urokinase-type plasminogen activator; plasminogen 98.07
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.07
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.07
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 98.06
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.06
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 98.06
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 98.06
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.06
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 98.06
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.05
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.05
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.05
2asu_B234 Hepatocyte growth factor-like protein; serine prot 98.05
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.05
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.04
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 98.04
2r0l_A248 Hepatocyte growth factor activator; serine proteas 98.04
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.04
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.04
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.03
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.03
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.03
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.03
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 98.02
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 98.01
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 98.01
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.0
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.0
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.0
3bg8_A238 Coagulation factor XIA light chain; protease inhib 98.0
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.0
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 97.99
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 97.99
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 97.99
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.99
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 97.98
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 97.98
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 97.98
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 97.98
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 97.97
3k1r_A192 Harmonin; protein-protein complex, alternative spl 97.97
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 97.97
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 97.97
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 97.97
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 97.96
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 97.96
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 97.95
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 97.95
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 97.95
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.95
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 97.94
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 97.94
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.94
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 97.94
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 97.94
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 97.93
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 97.93
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 97.93
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 97.92
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 97.92
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 97.91
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 97.91
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 97.91
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 97.89
2eei_A106 PDZ domain-containing protein 1; regulatory factor 97.89
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 97.89
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 97.88
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 97.88
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 97.87
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 97.87
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 97.87
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 97.86
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 97.86
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 97.85
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 97.85
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 97.85
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 97.84
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 97.84
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 97.84
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 97.81
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.8
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 97.8
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 97.8
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.79
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 97.79
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 97.79
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 97.79
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 97.78
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 97.76
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 97.74
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 97.73
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 97.72
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 97.72
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 97.72
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 97.71
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 97.71
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 97.68
2qy0_B242 Complement C1R subcomponent; serine protease, beta 97.68
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 97.68
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 97.67
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 97.66
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 97.65
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 96.76
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 97.58
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
Probab=100.00  E-value=1.2e-52  Score=495.84  Aligned_cols=383  Identities=19%  Similarity=0.310  Sum_probs=318.8

Q ss_pred             CcCCcchHHHHHHHhCCceEEEEEEeee------------ccCC------CCCCccEEEEEEEeCCCcEEEeCccccCCC
Q 001276           31 NVATADDWRKALNKVVPAVVVLRTTACR------------AFDT------EAAGASYATGFVVDKRRGIILTNRHVVKPG   92 (1109)
Q Consensus        31 ~~~~~~~~~~~~~~~~~sVV~I~~~~~~------------~~d~------~~~~~~~GSGfvV~~~~G~IlTn~HVv~~~   92 (1109)
                      .++..++|.++++++.+|||.|.+....            .|+.      .....+.||||+|++++||||||+|||. +
T Consensus         8 ~~~~~~~~~~~~~~~~paVV~I~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSGfii~~~~G~IlTn~Hvv~-~   86 (436)
T 4a8c_A            8 DQAPLPSLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTNNHVIN-Q   86 (436)
T ss_pred             cccCCCCHHHHHHhhCCcEEEEEEEEeecccccCcchhhhhcccccccccCCcCceEEEEEEEECCCCEEEECHHHhC-C
Confidence            4456679999999999999999987532            1221      2234689999999984499999999999 5


Q ss_pred             CeEEEEEecCCeEEEEEEEEEcCCCcEEEEEEc-CCCcccccccCCCCCCccCCCCCEEEEEecCCCCCCeEEEEEEEEe
Q 001276           93 PVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYD-PSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGEKVSILAGTLARL  171 (1109)
Q Consensus        93 ~~~~~v~~~~~~~~~a~vv~~d~~~DlAlLk~~-~~~~~~~~l~~l~l~~~~~~~G~~V~~iG~p~g~~~si~~G~vs~~  171 (1109)
                      +..+.|++.|++.++|++++.|+.+||||||++ +..++++.+..    +..+++|++|+++|||++...+++.|+|+++
T Consensus        87 a~~i~V~~~dg~~~~a~vv~~d~~~DlAllkv~~~~~l~~~~l~~----s~~~~~G~~v~aiG~P~g~~~~vt~G~vs~~  162 (436)
T 4a8c_A           87 AQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIAD----SDKLRVGDFAVAVGNPFGLGQTATSGIVSAL  162 (436)
T ss_pred             CCEEEEEeCCCCEEEEEEEEEcCCCCEEEEEecCCCCCceEeccC----cccCCCCCEEEEEEcCCCCCccEEEEEEeee
Confidence            678999999999999999999999999999995 44555555554    6789999999999999999999999999999


Q ss_pred             cCCCCCCCCCCccccceeeEEEeeccCCCCCCCceecCCCcEEEEeccccCC----CCCccccchHHHHHHHHHHHhcCC
Q 001276          172 DRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSS----SASAFFLPLERVVRALRFLQERRD  247 (1109)
Q Consensus       172 ~~~~~~~~~~~~~~~~~~~iq~~a~~~~G~SGgPv~n~~G~vVGi~~~~~~~----~~~~falP~~~i~~~l~~l~~~~~  247 (1109)
                      .+..  +....+.    .+||+++++++|+|||||||.+|+||||+++....    .+++|+||++.+++++++|.+++ 
T Consensus       163 ~r~~--~~~~~~~----~~iq~da~i~~GnSGGPl~n~~G~vvGI~~~~~~~~~~~~g~gfaIP~~~~~~~~~~l~~~g-  235 (436)
T 4a8c_A          163 GRSG--LNLEGLE----NFIQTDASINRGNAGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFG-  235 (436)
T ss_pred             cccc--cCCCCcc----CEEEEcCccCCCCCcCcccCCCCEEEEEEeeeccCCCCceeEEEEEehHHHHHHHHHHHhcc-
Confidence            8862  2222333    36999999999999999999999999999876543    46899999999999999999988 


Q ss_pred             cccccccccccCCCccceEEEEcChhHHHHcCCChhHHHhhhcCCCCCCCceEEEEEecCCCcccc-CCCCCCEEEEECC
Q 001276          248 CNIHNWEAVSIPRGTLQVTFVHKGFDETRRLGLQSATEQMVRHASPPGETGLLVVDSVVPGGPAHL-RLEPGDVLVRVNG  326 (1109)
Q Consensus       248 ~~~~~~~~~~v~rg~lg~~~~~~~~~~~r~lGl~~~~~~~~~~~~~~~~~G~lVv~~V~~~spA~~-gL~~GD~Il~VnG  326 (1109)
                               .+.|||||+.++.++.+.++.|||+             ...|++| ..|.++|||++ ||++||+|++|||
T Consensus       236 ---------~v~r~~lGv~~~~~~~~~a~~~gl~-------------~~~G~~V-~~V~~~spA~~aGL~~GD~I~~vnG  292 (436)
T 4a8c_A          236 ---------EIKRGLLGIKGTEMSADIAKAFNLD-------------VQRGAFV-SEVLPGSGSAKAGVKAGDIITSLNG  292 (436)
T ss_pred             ---------ccccccCceEecccCHHHHHHhCCC-------------CCcceEE-EEECCCChHHHCCCCCCCEEEEECC
Confidence                     7899999999999999999999997             5688887 69999999999 9999999999999


Q ss_pred             EEeCChhHHHHHHh-cCCCCeEEEEEEECCEEEEEEEEeecCCCCCCC---ccccccceEEecCCHHHhhccCCCCCeEE
Q 001276          327 EVITQFLKLETLLD-DGVDKNIELLIERGGISMTVNLVVQDLHSITPD---YFLEVSGAVIHPLSYQQARNFRFPCGLVY  402 (1109)
Q Consensus       327 ~~v~~~~~l~~~l~-~~~g~~v~l~v~R~g~~~~~~v~l~~~~~~~~~---~~~~~~G~~~~~l~~~~~~~~~~~~~gv~  402 (1109)
                      ++|.+|.++...+. ..+|+.++|+|.|+|+.+++++++..++.....   ..+.+.|..+.+...   .   -...|++
T Consensus       293 ~~v~~~~~l~~~l~~~~~g~~v~l~v~R~g~~~~~~v~l~~~~~~~~~~~~~~~gl~~~~~~~~~~---~---~~~~gv~  366 (436)
T 4a8c_A          293 KPLNSFAELRSRIATTEPGTKVKLGLLRNGKPLEVEVTLDTSTSSSASAEMITPALEGATLSDGQL---K---DGGKGIK  366 (436)
T ss_pred             EECCCHHHHHHHHHhcCCCCEEEEEEEECCEEEEEEEEECCCCcccccccccccCceeeecccccc---c---CCCCCEE
Confidence            99999999998885 468999999999999999999999887643221   112233333332211   0   0125888


Q ss_pred             EEc--CCChhHHcCCCCCCEEEEcCCeecCCHHHHHHHHHhcCCCCeEeEEEEeec
Q 001276          403 VAE--PGYMLFRAGVPRHAIIKKFAGEEISRLEDLISVLSKLSRGARVPIEYSSYT  456 (1109)
Q Consensus       403 v~~--pg~~a~~aGl~~GD~I~~Vng~~v~~l~~~~~~i~~~~~g~~v~l~~~~~~  456 (1109)
                      |.+  ++|+|+++||++||+|++|||+++.+|++|.++++..  ++.+.|++.|-+
T Consensus       367 V~~V~~~spA~~aGL~~GD~I~~vng~~v~~~~~~~~~l~~~--~~~v~l~v~R~g  420 (436)
T 4a8c_A          367 IDEVVKGSPAAQAGLQKDDVIIGVNRDRVNSIAEMRKVLAAK--PAIIALQIVRGN  420 (436)
T ss_pred             EEEeCCCCHHHHcCCCCCCEEEEECCEECCCHHHHHHHHHhC--CCeEEEEEEECC
Confidence            884  8999999999999999999999999999999999983  348889888865
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1109
d1lcya2205 b.47.1.1 (A:6-210) Mitochondrial serine protease H 2e-13
d2z9ia2221 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu 2e-12
d2qaaa1185 b.47.1.1 (A:16-242) Protease B {Streptomyces grise 1e-08
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 1e-08
d2sgaa_181 b.47.1.1 (A:) Protease A {Streptomyces griseus, st 4e-08
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 9e-08
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 4e-04
d2h5ca1198 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobac 2e-07
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 6e-07
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 3e-06
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 2e-05
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 6e-05
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 4e-06
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 7e-05
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 5e-06
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 0.003
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 6e-06
d1l1ja_228 b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic 9e-05
d1lvmb_219 b.47.1.3 (B:) TEV protease (nucleat inclusion prot 9e-05
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 1e-04
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 0.001
d2qf3a1210 b.47.1.1 (A:43-252) Stress sensor protease DegS, c 2e-04
d2bhga1199 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3e-04
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 3e-04
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 9e-04
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 0.001
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 0.002
d1ky9a2249 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata 0.002
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 0.003
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 0.004
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 0.004
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 0.004
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Mitochondrial serine protease HtrA2, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 68.4 bits (166), Expect = 2e-13
 Identities = 41/200 (20%), Positives = 71/200 (35%), Gaps = 9/200 (4%)

Query: 40  KALNKVVPAVVVLRTTACRAFDTEAAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEAM 99
             + K  PAVV +       F       S  +GFVV    G+I+TN HVV     V   +
Sbjct: 14  DVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAA-DGLIVTNAHVVADRRRVRVRL 72

Query: 100 FVNREEIPVYPIYRDPVHDFGFFRYDPSAIQFLNYDEIPLAPEAACVGLEIRVVGNDSGE 159
                   V                    +  L              G  +  +G+    
Sbjct: 73  LSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSA----DVRQGEFVVAMGSPFAL 128

Query: 160 KVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAG 219
           + +I +G ++   R A      G    N  Y+Q  +    G++G P+++  G  + +N  
Sbjct: 129 QNTITSGIVSSAQRPARDL---GLPQTNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNT- 184

Query: 220 SKSSSASAFFLPLERVVRAL 239
            K ++  +F +P +R+   L
Sbjct: 185 MKVTAGISFAIPSDRLREFL 204
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Length = 198 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Length = 219 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1109
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 99.97
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 99.95
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 99.95
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 99.95
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.95
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 99.93
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 99.9
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 99.89
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.89
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 99.86
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.82
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.66
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.65
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.63
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 99.55
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.52
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.45
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.45
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.45
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.45
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.41
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.36
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.35
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 99.33
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.32
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.3
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.29
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.23
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 99.16
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.13
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.12
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.08
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.08
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.05
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.94
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.92
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.92
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.91
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.89
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.88
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.82
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 98.76
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.74
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.71
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 98.69
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 98.6
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.59
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.43
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.38
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.38
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.37
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.37
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.33
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.31
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.3
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.3
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.29
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.26
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.22
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.2
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.19
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.17
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.15
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 98.15
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.14
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.13
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.12
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.12
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.11
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 98.11
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.09
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 98.09
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.09
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.08
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.07
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 98.07
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1y7na179 Amyloid beta A4 precursor protein-binding family A 98.06
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.06
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.06
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.05
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.05
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.05
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 98.04
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.04
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 98.04
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.03
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.03
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 98.03
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 98.02
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.01
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.01
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.0
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 98.0
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 97.99
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.99
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1rzxa_98 GTPase-binding domain of the cell polarity protein 97.96
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 97.96
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 97.95
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 97.95
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 97.94
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 97.94
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 97.94
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 97.93
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 97.93
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 97.93
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 97.93
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 97.92
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 97.92
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 97.92
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 97.91
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 97.91
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 97.91
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 97.91
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 97.9
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 97.9
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 97.9
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 97.9
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 97.89
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 97.88
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 97.88
d1rzxa_98 GTPase-binding domain of the cell polarity protein 97.87
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.87
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 97.86
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 97.85
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 97.85
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.84
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 97.84
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 97.84
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 97.82
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 97.82
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 97.82
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 97.82
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 97.81
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 97.81
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.81
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 97.81
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.8
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 97.8
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 97.79
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 97.77
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 97.76
d1y7na179 Amyloid beta A4 precursor protein-binding family A 97.76
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 97.76
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 97.75
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 97.74
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.74
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.73
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 97.73
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 97.72
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 97.72
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 97.7
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 97.7
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 97.69
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 97.69
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 97.68
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 97.68
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.68
d1x45a185 Amyloid beta A4 precursor protein-binding family A 97.67
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 97.67
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 97.67
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 97.67
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 97.66
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.65
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 97.64
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 97.64
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 97.64
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 97.64
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 97.64
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 97.63
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.62
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 97.62
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 97.62
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 97.62
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 97.61
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 97.61
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 97.61
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 97.61
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 97.6
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.6
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 97.59
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 97.59
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 97.58
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 97.57
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 97.54
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.54
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 97.5
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 97.49
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 97.47
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 97.47
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 97.46
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.44
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 97.44
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 97.37
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 97.32
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 97.31
d1elva1259 Complement C1S protease, catalytic domain {Human ( 97.31
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 97.31
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 97.3
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 97.26
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 97.26
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 97.25
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 97.22
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 97.2
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 97.16
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 97.15
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 97.13
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 97.1
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1l1na_180 3C cysteine protease (picornain 3C) {Human poliovi 97.03
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 96.97
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 96.97
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 96.92
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 96.8
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 96.75
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 96.11
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 96.1
d1mbma_198 NSP4 proteinase {Equine arteritis virus, EAV [TaxI 95.72
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 95.39
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 95.3
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 95.25
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 95.18
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 95.08
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 95.07
d2h6ma1212 3C cysteine protease (picornain 3C) {Human hepatit 94.98
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 94.97
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 94.84
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 94.73
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 94.69
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 94.67
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 94.66
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 94.62
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 94.46
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 94.42
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 94.26
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 94.24
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 93.9
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 93.8
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 93.77
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 93.76
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 93.6
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 93.11
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 92.68
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 92.62
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 92.57
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 92.53
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 92.34
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 92.34
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 92.33
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 92.27
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 92.25
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 92.13
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 92.01
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 91.95
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 91.84
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 91.83
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 91.63
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 91.61
d2fomb1150 NS3 protease {Dengue virus type 2 [TaxId: 11060]} 91.51
d2fp7b1152 NS3 protease {West nile virus [TaxId: 11082]} 91.36
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 91.16
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 90.93
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 90.47
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 89.94
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 89.61
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 89.41
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 88.65
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 88.57
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 88.34
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 88.03
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 87.94
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 87.87
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 87.5
d1l1na_180 3C cysteine protease (picornain 3C) {Human poliovi 87.06
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 85.53
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 84.69
d1elva1259 Complement C1S protease, catalytic domain {Human ( 84.62
d1wyka_152 Viral capsid protein {Sindbis virus [TaxId: 11034] 82.54
d1ep5a_156 Viral capsid protein {Venezuelan equine encephalit 81.92
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=1.5e-30  Score=281.41  Aligned_cols=200  Identities=18%  Similarity=0.325  Sum_probs=164.8

Q ss_pred             chHHHHHHHhCCceEEEEEEeeecc---------C---C-----------------------------CCCCccEEEEEE
Q 001276           36 DDWRKALNKVVPAVVVLRTTACRAF---------D---T-----------------------------EAAGASYATGFV   74 (1109)
Q Consensus        36 ~~~~~~~~~~~~sVV~I~~~~~~~~---------d---~-----------------------------~~~~~~~GSGfv   74 (1109)
                      ++|.++++++.||||.|.+......         .   +                             .....+.||||+
T Consensus         3 Ps~a~~ve~v~PaVV~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~GSG~i   82 (249)
T d1ky9a2           3 PSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVI   82 (249)
T ss_dssp             CCSHHHHHHHGGGEEEEEEEEEEEECCCCSSCCTTCCCC---------------------------CEEEEEEEEEEEEE
T ss_pred             CChHHHHHHhCCceEEEEEEEEEeecCCcCcchhhhccccCCcccccccccccccccccccccccccccccccccccEEE
Confidence            4788999999999999987643210         0   0                             011236799999


Q ss_pred             EeCCCcEEEeCccccCCCCeEEEEEecCCeEEEEEEEEEcCCCcEEEEEEcC-CCcccccccCCCCCCccCCCCCEEEEE
Q 001276           75 VDKRRGIILTNRHVVKPGPVVAEAMFVNREEIPVYPIYRDPVHDFGFFRYDP-SAIQFLNYDEIPLAPEAACVGLEIRVV  153 (1109)
Q Consensus        75 V~~~~G~IlTn~HVv~~~~~~~~v~~~~~~~~~a~vv~~d~~~DlAlLk~~~-~~~~~~~l~~l~l~~~~~~~G~~V~~i  153 (1109)
                      |++++||||||+|||. +...+.+++.+++.++|+++..|+.+|+|+|+++. ..++++++..    ++.+++||+|+++
T Consensus        83 I~~~~g~IlTn~HVv~-~~~~~~v~~~~~~~~~a~~~~~d~~~dlavl~i~~~~~~~~~~l~~----~~~~~~G~~v~ai  157 (249)
T d1ky9a2          83 IDADKGYVVTNNHVVD-NATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMAD----SDALRVGDYTVAI  157 (249)
T ss_dssp             EETTTTEEEEEHHHHT-TEEEEEEEETTSCEEEEEEEEEETTTTEEEEEESSCCSCCCCCBCC----GGGCCTTCEEEEE
T ss_pred             EeccCceEEeeccccc-cceeeeeeecccccccceeeEeccchhhceeeecccccceEEEcCC----cCcCCcCCEEEEE
Confidence            9986699999999999 67889999999999999999999999999999985 4566666554    6789999999999


Q ss_pred             ecCCCCCCeEEEEEEEEecCCCCCCCCCCccccceeeEEEeeccCCCCCCCceecCCCcEEEEeccccCC----CCCccc
Q 001276          154 GNDSGEKVSILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSS----SASAFF  229 (1109)
Q Consensus       154 G~p~g~~~si~~G~vs~~~~~~~~~~~~~~~~~~~~~iq~~a~~~~G~SGgPv~n~~G~vVGi~~~~~~~----~~~~fa  229 (1109)
                      |||++...+++.|.++...+.....      .....+||+|+++++|||||||||.+|+||||+++....    .+++||
T Consensus       158 G~P~g~~~tvt~~~~~~~~~~~~~~------~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi~fa  231 (249)
T d1ky9a2         158 GNPFGLGETVTSGIVSALGRSGLNA------ENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFA  231 (249)
T ss_dssp             ECTTSSSCEEEEEEEEEESSCC-----------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSSEEE
T ss_pred             ecccccCCceeecceeecccccccC------ccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccEEEE
Confidence            9999999999999999998764211      112346999999999999999999999999999876543    468999


Q ss_pred             cchHHHHHHHHHHHhcC
Q 001276          230 LPLERVVRALRFLQERR  246 (1109)
Q Consensus       230 lP~~~i~~~l~~l~~~~  246 (1109)
                      ||++.+++++++|.+.+
T Consensus       232 IP~~~~~~~~~~l~~~G  248 (249)
T d1ky9a2         232 IPSNMVKNLTSQMVEYG  248 (249)
T ss_dssp             EEHHHHHHHHHHHHHHS
T ss_pred             EEHHHHHHHHHHHHHhC
Confidence            99999999999998754
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} Back     information, alignment and structure
>d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} Back     information, alignment and structure