Citrus Sinensis ID: 001306


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100----
MEGFRAKLRVATTVILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEGASSSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQYRESQDAREREGAATSGSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPHQSPPLALQPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSRTGQPFLDTRQRLAMFSRMLRSGTPQSFNWMMQSHLFHQSTPASIKDAKDAAGSQAPSSSSCTVQWSAEGLDKDLYIQTATVTVLAMDGKRRWLDIQKLGANGKDHFIFVTNLAPCTGVRIHLWPEKGKSTTDLPGSKRILEVTSKMVHIPSRAAPRQLEPGSQTEQAPPSAVFQLGPEDMRGFRFLTISVAPTPTISGRPPPAVSMAVGQFFNPQEGEREFSSQSMLLSAYSPKDLFLKEDHPLVFNLTFAISLGLLPITLSLRTASCGIQNSGFANEEAGDIEHSRLCKMRCFPPVALAWDPTSGLYVFPNLFSETIIIDSSPALWSYSQGSEKTIVVLLVDPHCSYKTSVSVSVTAAASRFLLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMPFPFLLLAILPILVSLFHSFLMSQPFPPIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQLLVAALAAITLVCFVHPALGLIVILLSHAFCCHTSLSSHAWRKELYDYNTNNNGRSKLRYTRERRFSPNLPLDDCSSSSPDSSKTFSDTQLEIFHHRHGLLILHLLASLMFVPSLMAWFQRISMGHSFPWFLDSVLCIGVILHGTVISKPEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKIIKEKYGKGEPRFGGRKHSHRH
ccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccEEEcccccccccccccEEEEEEEccccccHHHHccccccEEEEEEccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccEEEEEEcccHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccEEEEEEEcHHHHHHHHHHHccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEccccccccccccccccccccccccccEEEEcccccccccccccEEEEHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccHHccccccccccccccccccccccccccccccEEEEEcccccccccEEEEcccEEEccccccccEEEEEcccccccEEEEEEccccccccEEEEcccccccccccccccEEEEccccccccccccccccccccccccccccEEEEEEcccccccccEEEEEEccccccccccccccccEEEEEcccccccEEEccccHHHHcccccEEEEcccccEEEEEEEEEccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHEEEcccccccccccEEEccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
cccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccEEEEcccccccccccEEEEEEEccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHccccccccEEHHHcccHHccccccccccccccccccccccEEEEEccHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEccccccEcccccccccccccccccEEEEEccccccEccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHcccccccccccEEccccccccccccccccccccccccccccccccccccEEEEEccccccEEEEEEccccccccEEEEEEcccccccEEEEEcccccccccccccccHEEEHHHHcEEccccccccccccccccccccccEEEEEcHHHccccEEEEEEEccccccccccccHHHHHHHEccccccccccccHHHHHHHHccccEEEccccccEEEEEEEEEEcccccEEEEEEEcccccccccccccccccHHHcccccccccccEEEEEccccccEEEEccccEEEEEEccccccccccccccEEEEEEEccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccccccccccccccccccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccccc
MEGFRAKLRVATTVILALWIGIAALYSLLkpisngcvmtymyptyipisstegassSARYALYLYHEGWKKIDFEEHLkqlngvpvlfipgnagsyKQVRSLAAEsdrayqggplehsfYQEASLTleeggvnidasifhssnqytrRLDWFAVDlegehsamdgQILEEHAEYVVYAIHRILDQYRESQDAReregaatsgslpkSVILVGHSVGGFVARAAIIHPLLRKSAVETVLtlssphqspplalqpslgnyFARVNDEWrkgyeahttptghhvsnsrLSHVVVVSISAGYHDYQVRSKiesldgivppthgfmisSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLidsrtgqpfldTRQRLAMFSRMlrsgtpqsfnwmmqshlfhqstpasikdakdaagsqapssssctvqwsaegldkdlyIQTATVTVLAMDGKRRWLDIQklgangkdhFIFVTnlapctgvrihlwpekgksttdlpgskrILEVTSKmvhipsraaprqlepgsqteqappsavfqlgpedmrgfrfltisvaptptisgrpppavsmavgqffnpqegerefssqsmllsayspkdlflkedhplvfNLTFAISLGLLPITLSLRtascgiqnsgfaneeagdiehsrlckmrcfppvalawdptsglyvfpnlfsetiiidsspalwsysqgseKTIVVLLVdphcsyktsvSVSVTAAASRFLLLYGSQIAGLSVAVVFFALMRQAYAWdyylpmpsmlTVVEYNLQMPFPFLLLAILPILVSLFHsflmsqpfppimSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQLLVAALAAITLVCFVHPALGLIVILLSHAFcchtslsshaWRKELYdyntnnngrsklrytrerrfspnlplddcsssspdssktfsdtqLEIFHHRHGLLILHLLASLMFVPSLMAWFQRismghsfpwfLDSVLCIGVILhgtviskpeynylvsfpgilgqelRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKIIKekygkgeprfggrkhshrh
MEGFRAKLRVATTVILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEGASSSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQYRESQDAREREgaatsgslpksvILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPhqspplalqpsLGNYFARVNDEWRKGYEAHTtptghhvsnsrLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLidsrtgqpfLDTRQRLAMFSRMLRSGTPQSFNWMMQSHLFHQSTPASIKDAKDAAGSQAPSSSSCTVQWSAEGLDKDLYIQTATVTVLAMDGKRRWLDIQKLGANGKDHFIFVTNLAPCTGVRIHLwpekgksttdlpgsKRILEVTSKMVHIPSRAAPRQLEPGSQTEQAPPSAVFQLGPEDMRGFRFLTISVAPTPTISGRPPPAVSMAVGQFFNPQEGEREFSSQSMLLSAYSPKDLFLKEDHPLVFNLTFAISLGLLPITLSLRTASCGIQNSGFANEEAGDIEHSRLCKMRCFPPVALAWDPTSGLYVFPNLFSETIIIDSSPALWSYSQGSEKTIVVLLVDPHCSYKTSVSVSVTAAASRFLLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMPFPFLLLAILPILVSLFHSFLMSQPFPPIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQLLVAALAAITLVCFVHPALGLIVILLSHAFCCHTSLSSHAWRKElydyntnnngrsklrytrerrfspnlplddcsssspDSSKTFSDTQLEIFHHRHGLLILHLLASLMFVPSLMAWFQRISMGHSFPWFLDSVLCIGVILHGTVISKPEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKIIKekygkgeprfggrkhshrh
MEGFRAKLRVATTVILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEGASSSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQYRESQDAREREGAATSGSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPHQSPPLALQPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSRTGQPFLDTRQRLAMFSRMLRSGTPQSFNWMMQSHLFHQSTPASIKDAKDAAGSQAPSSSSCTVQWSAEGLDKDLYIQTATVTVLAMDGKRRWLDIQKLGANGKDHFIFVTNLAPCTGVRIHLWPEKGKSTTDLPGSKRILEVTSKMVHIPSRAAPRQLEPGSQTEQAPPSAVFQLGPEDMRGFRFLTISVAPTPTISGRPPPAVSMAVGQFFNPQEGEREFSSQSMLLSAYSPKDLFLKEDHPLVFNLTFAISLGLLPITLSLRTASCGIQNSGFANEEAGDIEHSRLCKMRCFPPVALAWDPTSGLYVFPNLFSETIIIDSSPALWSYSQGSEKTIVVLLVDPHCSYKtsvsvsvtaaasRFLLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMpfpflllailpilvslfHSFLMSQPFPPIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQllvaalaaitlvCFVHPALGLIVILLSHAFCCHTSLSSHAWRKELYDYNTNNNGRSKLRYTRERRFspnlplddcsssspdssKTFSDTQLEIFhhrhgllilhllaslMFVPSLMAWFQRISMGHSFPWFLDSVLCIGVILHGTVISKPEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKIIKEKYGKGEPRFGGRKHSHRH
*****AKLRVATTVILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEGASSSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSL*******Y**GPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQY********************SVILVGHSVGGFVARAAIIHPLLRKSAVETVLTL************PSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSRTGQPFLDTRQRLAMFSRML*******FNWMM*****************************CTVQWSAEGLDKDLYIQTATVTVLAMDGKRRWLDIQKLGANGKDHFIFVTNLAPCTGVRIHLWPE******************************************************MRGFRFLTISVA*************************************SAYSPKDLFLKEDHPLVFNLTFAISLGLLPITLSLRTASCGIQNSGFANEEAGDIEHSRLCKMRCFPPVALAWDPTSGLYVFPNLFSETIIIDSSPALWSYSQGSEKTIVVLLVDPHCSYKTSVSVSVTAAASRFLLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMPFPFLLLAILPILVSLFHSFLMSQPFPPIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQLLVAALAAITLVCFVHPALGLIVILLSHAFCCHTSLSSHAWRKELYDYNT***************************************QLEIFHHRHGLLILHLLASLMFVPSLMAWFQRISMGHSFPWFLDSVLCIGVILHGTVISKPEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKIIKEKY****************
*****AK*RVATTVILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEGASSSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQYRE*****************KSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPHQSPPLALQPSLGNYFARVNDEWRKGYEAHT*******SNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLID**************AMFSRMLR*************************DAKDAAGSQAPSSSSCTVQ****G*D**L************DGKRRWLDIQKLGANGKDHFIFVTNLAPCTGVRIHLWPEKGK*****PGSKRILEVTSKMV***********************AVFQLGPEDMRGFRFLTISVAPTPTISGRPPPAVSMAVGQFFNPQEGEREFSSQSMLLSAYSPKDLFLKEDHPLVFNLTFAISLGLLPITLSLRTASCGIQNSGFANEEAGDIEHSRLCKMRCFPPVALAWDPTSGLYVFPNLFSETIIIDSSPALWS****SEKTIVVLLVDPHCSYKTSVSVSVTAAASRFLLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMPFPFLLLAILPILVSLFHSFLMSQPFPPIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQLLVAALAAITLVCFVHPALGLIVILLSHAFCCHTSLSSHAWRKELY******************************************TQLEIFHHRHGLLILHLLASLMFVPSLMAWFQRISMGHSFPWFLDSVLCIGVILHGTVISKPEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKIIK*******************
MEGFRAKLRVATTVILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEGASSSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQYR**************GSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPHQSPPLALQPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSRTGQPFLDTRQRLAMFSRMLRSGTPQSFNWMMQSHLFHQS************************QWSAEGLDKDLYIQTATVTVLAMDGKRRWLDIQKLGANGKDHFIFVTNLAPCTGVRIHLWPEKGKSTTDLPGSKRILEVTSKMVHIPSRAAP*************PSAVFQLGPEDMRGFRFLTISVAPTPTISGRPPPAVSMAVGQFFNP*********QSMLLSAYSPKDLFLKEDHPLVFNLTFAISLGLLPITLSLRTASCGIQNSGFANEEAGDIEHSRLCKMRCFPPVALAWDPTSGLYVFPNLFSETIIIDSSPALWSYSQGSEKTIVVLLVDPHCSYKTSVSVSVTAAASRFLLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMPFPFLLLAILPILVSLFHSFLMSQPFPPIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQLLVAALAAITLVCFVHPALGLIVILLSHAFCCHTSLSSHAWRKELYDYNTNNNGRSKLRYTRERRFSPNLPL**************SDTQLEIFHHRHGLLILHLLASLMFVPSLMAWFQRISMGHSFPWFLDSVLCIGVILHGTVISKPEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKIIKEKYGKGE************
**GFRAKLRVATTVILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEGASSSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQYRES**********TSGSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPHQSPPLALQPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSRTGQPFLDTRQRLAMFSRMLRSGTPQSFNWMMQSHLFHQSTPASIKDAKDAAGSQAPSSSSCTVQWSAEGLDKDLYIQTATVTVLAMDGKRRWLDIQKLGANGKDHFIFVTNLAPCTGVRIHLWPEKGKSTTDLPGSKRILEVTSKMVHIPSRAA**********EQAPPSAVFQLGPEDMRGFRFLTISVAPTPTISGRPPPAVSMAVGQFFNPQEGEREFSSQSMLLSAYSPKDLFLKEDHPLVFNLTFAISLGLLPITLSLRTASCGIQNSGFANEEAGDIEHSRLCKMRCFPPVALAWDPTSGLYVFPNLFSETIIIDSSPALWSYSQGSEKTIVVLLVDPHCSYKTSVSVSVTAAASRFLLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMPFPFLLLAILPILVSLFHSFLMSQPFPPIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQLLVAALAAITLVCFVHPALGLIVILLSHAFCCHTSLSSHAWRKELYDYN*****R*K***************************TFSDTQLEIFHHRHGLLILHLLASLMFVPSLMAWFQRISMGHSFPWFLDSVLCIGVILHGTVISKPEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKIIKEKY****************
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGFRAKLRVATTVILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEGASSSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQYRESQDAREREGAATSGSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPHQSPPLALQPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSRTGQPFLDTRQRLAMFSRMLRSGTPQSFNWMMQSHLFHQSTPASIKDAKDAAGSQAPSSSSCTVQWSAEGLDKDLYIQTATVTVLAMDGKRRWLDIQKLGANGKDHFIFVTNLAPCTGVRIHLWPEKGKSTTDLPGSKRILEVTSKMVHIPSRAAPRQLEPGSQTEQAPPSAVFQLGPEDMRGFRFLTISVAPTPTISGRPPPAVSMAVGQFFNPQEGEREFSSQSMLLSAYSPKDLFLKEDHPLVFNLTFAISLGLLPITLSLRTASCGIQNSGFANEEAGDIEHSRLCKMRCFPPVALAWDPTSGLYVFPNLFSETIIIDSSPALWSYSQGSEKTIVVLLVDPHCSYKTSVSVSVTAAASRFLLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMPFPFLLLAILPILVSLFHSFLMSQPFPPIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQLLVAALAAITLVCFVHPALGLIVILLSHAFCCHTSLSSHAWRKELYDYNTNNNGRSKLRYTRERRFSPNLPLDDCSSSSPDSSKTFSDTQLEIFHHRHGLLILHLLASLMFVPSLMAWFQRISMGHSFPWFLDSVLCIGVILHGTVISKPEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKIIKEKYGKGEPRFGGRKHSHRH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1104 2.2.26 [Sep-21-2011]
Q2H1021147 GPI inositol-deacylase OS N/A no 0.310 0.299 0.330 1e-52
Q7SAM01256 GPI inositol-deacylase OS N/A no 0.311 0.273 0.344 1e-52
Q2USI01102 GPI inositol-deacylase OS yes no 0.294 0.294 0.337 1e-51
Q4WGM41156 GPI inositol-deacylase OS yes no 0.308 0.294 0.328 2e-51
Q5AYC81140 GPI inositol-deacylase OS no no 0.307 0.297 0.339 5e-51
Q0CIV41160 GPI inositol-deacylase OS N/A no 0.286 0.272 0.326 1e-49
Q1DWP91150 GPI inositol-deacylase OS N/A no 0.302 0.290 0.332 3e-48
Q0UQV61049 GPI inositol-deacylase OS N/A no 0.293 0.308 0.344 6e-48
Q6BRG11032 GPI inositol-deacylase OS yes no 0.287 0.307 0.323 4e-47
Q9UT411142 GPI inositol-deacylase OS yes no 0.289 0.280 0.313 6e-43
>sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 Back     alignment and function desciption
 Score =  209 bits (532), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/387 (33%), Positives = 205/387 (52%), Gaps = 44/387 (11%)

Query: 4   FRAKLRVATTVILALWIGIAALYSLL------KPISNGCVMTYMYPTYIPIS--STEGAS 55
           +R+   +  + ++A  +GI  L ++L      +    GC M+YM P+Y  ++   TE   
Sbjct: 122 WRSPWAITFSALVAAIVGIGFLVAVLHSSVTRQLDPKGCRMSYMRPSYAKLNEFDTEHTR 181

Query: 56  SSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPL 115
            +++Y+LYLY E  + ID +  ++   GVPVLFIPGNAGSYKQVR +AAE+   +     
Sbjct: 182 LASKYSLYLYRE--QDIDRDTKVR---GVPVLFIPGNAGSYKQVRPIAAEAANYF----- 231

Query: 116 EHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYV 175
            H+  Q     +  G               TR LD+F VD   + +A  GQ L + AEY+
Sbjct: 232 -HNVLQHDESAMNAG---------------TRNLDFFTVDFNEDITAFHGQTLLDQAEYL 275

Query: 176 VYAIHRILDQYRESQDAREREGAATSGSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVE 235
             A+  IL  Y + + A +R+        P SVI++GHS+GG VAR  +I P  +  ++ 
Sbjct: 276 NEAVRYILSLYLDPRVA-DRDPDLPD---PTSVIVLGHSMGGIVARTMLIMPNFQSHSIN 331

Query: 236 TVLTLSSPHQSPPLALQPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSIS 295
           T++T+S+PH  PP++        +  +ND WR+ Y      +    +++ L HV +VSI+
Sbjct: 332 TIITMSAPHARPPVSFDSQSVQTYKDINDYWRRAY------SQQWANDNPLWHVTLVSIA 385

Query: 296 AGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLS 355
            G  D  V S   S++ +VP THGF + ++ + NVW SM+HQAILWC+Q    V+  +  
Sbjct: 386 GGGLDTVVPSDYASVESLVPDTHGFTVFTSTIPNVWTSMDHQAILWCDQFRKVVAQAIYD 445

Query: 356 LIDSRTGQPFLDTRQRLAMFSRMLRSG 382
           ++D           +R+ +F +   +G
Sbjct: 446 VVDVHRATQTKPRAERMRVFKKWFLTG 472




Involved in inositol deacylation of GPI-anchored proteins which plays important roles in the quality control and ER-associated degradation of GPI-anchored proteins.
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (taxid: 306901)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 Back     alignment and function description
>sp|Q2USI0|BST1_ASPOR GPI inositol-deacylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bst1 PE=3 SV=2 Back     alignment and function description
>sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 Back     alignment and function description
>sp|Q5AYC8|BST1_EMENI GPI inositol-deacylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bst1 PE=3 SV=2 Back     alignment and function description
>sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 Back     alignment and function description
>sp|Q1DWP9|BST1_COCIM GPI inositol-deacylase OS=Coccidioides immitis (strain RS) GN=BST1 PE=3 SV=1 Back     alignment and function description
>sp|Q0UQV6|BST1_PHANO GPI inositol-deacylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=BST1 PE=3 SV=2 Back     alignment and function description
>sp|Q6BRG1|BST1_DEBHA GPI inositol-deacylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BST1 PE=3 SV=2 Back     alignment and function description
>sp|Q9UT41|BST1_SCHPO GPI inositol-deacylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bst1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1104
2555719701110 conserved hypothetical protein [Ricinus 0.996 0.990 0.728 0.0
2960853561124 unnamed protein product [Vitis vinifera] 0.996 0.978 0.706 0.0
4494373901094 PREDICTED: uncharacterized protein LOC10 0.989 0.998 0.670 0.0
3565740221116 PREDICTED: uncharacterized protein LOC10 0.999 0.988 0.669 0.0
1243605761124 Esterase/lipase/thioesterase; Lipase, ac 0.998 0.980 0.650 0.0
3341856541121 hydrolase [Arabidopsis thaliana] gi|3326 0.971 0.956 0.639 0.0
2402554481085 hydrolase [Arabidopsis thaliana] gi|3326 0.971 0.988 0.639 0.0
4495254671187 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.990 0.921 0.604 0.0
119946341069 unnamed protein product [Arabidopsis tha 0.932 0.963 0.600 0.0
2978149801047 hypothetical protein ARALYDRAFT_322858 [ 0.914 0.964 0.596 0.0
>gi|255571970|ref|XP_002526926.1| conserved hypothetical protein [Ricinus communis] gi|223533678|gb|EEF35413.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 1617 bits (4188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 811/1114 (72%), Positives = 927/1114 (83%), Gaps = 14/1114 (1%)

Query: 1    MEGFRAKLRVATTVILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEGASSSARY 60
            M+GFRAK+RV   VI+ +WIG+ ALY LLKPISNGC+MTYMYPTYIPISS+      A+Y
Sbjct: 1    MQGFRAKIRVGVLVIITIWIGLYALYGLLKPISNGCIMTYMYPTYIPISSS---GDGAKY 57

Query: 61   ALYLYHEGWKKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFY 120
             LYLYHEGWKKID+ EHLKQLNGVPVLFIPGN GSYKQ RSLAAESDRAYQGGPLE +FY
Sbjct: 58   GLYLYHEGWKKIDYNEHLKQLNGVPVLFIPGNGGSYKQARSLAAESDRAYQGGPLERTFY 117

Query: 121  QEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIH 180
            QEA L  EE GV +  + F   NQY  RLDWFAVDLEGEHSAMDG+ILEEH EYVVYAIH
Sbjct: 118  QEAYLNPEETGVKMSMTSFQLPNQYATRLDWFAVDLEGEHSAMDGRILEEHTEYVVYAIH 177

Query: 181  RILDQYRESQDAREREGAATSGSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTL 240
            +ILDQY+ES DAREREGAATSG+LPKSVILVGHS+GGFVARAAIIHP LRKSAVET+LTL
Sbjct: 178  KILDQYKESHDAREREGAATSGNLPKSVILVGHSMGGFVARAAIIHPHLRKSAVETILTL 237

Query: 241  SSPHQSPPLALQPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHD 300
            S+PHQSPP+ALQPSLG+YFARVN+EWRK YE  TT TG  +S+   SHVVVVSIS GY+D
Sbjct: 238  STPHQSPPVALQPSLGHYFARVNEEWRKRYEVQTTRTGRFMSDPLFSHVVVVSISGGYND 297

Query: 301  YQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSR 360
            YQVRSK+ESLD IVP THGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSR
Sbjct: 298  YQVRSKLESLDDIVPSTHGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSR 357

Query: 361  TGQPFLDTRQRLAMFSRMLRSGTPQSFNWMMQSHLFHQSTPASIKDAKDAAGSQAPSSSS 420
            TG+PF DT++RLA+FS+MLRSG PQ+FNWM QS   +Q+T A IK  K+A GSQ  + S 
Sbjct: 358  TGEPFPDTQKRLAVFSQMLRSGIPQTFNWMRQSLPSYQATHAPIKHIKNALGSQVSTLSG 417

Query: 421  C--TVQWSAEGLDKDLYIQTATVTVLAMDGKRRWLDIQKLGANGKDHFIFVTNLAPCTGV 478
            C   V W+ + L++DLYIQT T+TVLAMDG+RRWLDIQKLG+NGK HFIFVTNLAPC+GV
Sbjct: 418  CPSNVHWNDDSLERDLYIQTTTMTVLAMDGRRRWLDIQKLGSNGKGHFIFVTNLAPCSGV 477

Query: 479  RIHLWPEKGKSTTDLPGSKRILEVTSKMVHIPSRAAPRQLEPGSQTEQAPPSAVFQLGPE 538
            RIHLWPEKG+S TDL  S++++EVTSK+V IPSR APRQ+EPGSQTEQAPPSAV +L PE
Sbjct: 478  RIHLWPEKGQSPTDLAASRKVVEVTSKLVQIPSRPAPRQIEPGSQTEQAPPSAVLRLTPE 537

Query: 539  DMRGFRFLTISVAPTPTISGRPPPAVSMAVGQFFNPQEGEREFSSQSMLLSAYSPKDLFL 598
            DM GFRFLTISVAP PTISGRPPPA SMAVGQFFNP +GER+ S+Q MLLS YS K++FL
Sbjct: 538  DMHGFRFLTISVAPRPTISGRPPPATSMAVGQFFNPDDGERDISAQLMLLSTYSQKEIFL 597

Query: 599  KEDHPLVFNLTFAISLGLLPITLSLRTASCGIQNSGFANEEAGDIEHSRLCKMRCFPPVA 658
            KEDHPL FNL+F+ISLGLLP+TLSLRT  CGI+ SG   +EAGD+E SRLCK+RCFPPVA
Sbjct: 598  KEDHPLAFNLSFSISLGLLPVTLSLRTMGCGIKRSGLPADEAGDMESSRLCKLRCFPPVA 657

Query: 659  LAWDPTSGLYVFPNLFSETIIIDSSPALWSYSQGSEKTIVVLLVDPHCSYKTSVSVSVTA 718
            LAWDPTSGL++FPNL+SETII+DSSPALWS ++GSE+T V+LLVDPHCSYK SV+VS TA
Sbjct: 658  LAWDPTSGLHIFPNLYSETIIVDSSPALWSATKGSERTTVLLLVDPHCSYKMSVAVSETA 717

Query: 719  AASRFLLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMPFPFLLLAI 778
            AASRFLLLY SQI G S+AV+FFALMRQA+AWD  LP+PS+L+ VE NL++P PFLLL I
Sbjct: 718  AASRFLLLYSSQIVGFSIAVIFFALMRQAHAWDADLPVPSVLSAVESNLRLPLPFLLLGI 777

Query: 779  LPILVSLFHSFLMSQPFPPIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIK 838
            +PIL+SLF SFL+SQP PP  SF +VS+ICY+ ANG + LLI VSQLVFY  A  HVFIK
Sbjct: 778  IPILISLFISFLLSQPLPPFASFIIVSVICYLFANGSMILLIFVSQLVFYAAAIIHVFIK 837

Query: 839  TRWEVWEGNFCFAFLLWFVNLSSSFFSLKVVRVIRANQLLVAALAAITLVCFVHPALGLI 898
            TRW+  EGNF   FL WF+NLSSSFF LKVVRV+R N  LV AL AITL CFVHPALGL 
Sbjct: 838  TRWQGQEGNFRLGFLHWFLNLSSSFFQLKVVRVLRVNPSLVTALTAITLGCFVHPALGLF 897

Query: 899  VILLSHAFCCHTSLS--------SHAWRKELYDYNTNNNGRSKLRYTRERRFSPNLPLDD 950
            ++LLSHA CCH +L         SHA RKEL+D     N RS+   +     + N PL++
Sbjct: 898  ILLLSHALCCHNALCGFLTASFRSHARRKELFDCKDEENKRSQEFASSNGVCNHNSPLEE 957

Query: 951  CSSSSPDSSKTFSDTQLEIFHHRHGLLILHLLASLMFVPSLMAWFQRISMGHSFPWFLDS 1010
             SS+SP+SSK+F DTQLEIFHHRHGLLILH LA+LMFVPSL+AW QRI +GHSFPWFLDS
Sbjct: 958  NSSNSPNSSKSFGDTQLEIFHHRHGLLILHFLAALMFVPSLVAWLQRIGLGHSFPWFLDS 1017

Query: 1011 VLCIGVILHGTVISKPEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYA 1070
             LCIGVILHG + +KPE N   S   I G+ELRL+ +YLLAGYYS+L GL L PYRVFYA
Sbjct: 1018 ALCIGVILHGILNTKPECNSQFSLSVIQGRELRLDFVYLLAGYYSYLYGLGLEPYRVFYA 1077

Query: 1071 MAAIGVISLASKIIKEKYGKGEPRFGGRKHSHRH 1104
            MAA+G ISLA +I+  K  KGE RFG RKHSH+H
Sbjct: 1078 MAAVGFISLALRILWSK-EKGEQRFGRRKHSHKH 1110




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296085356|emb|CBI29088.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449437390|ref|XP_004136475.1| PREDICTED: uncharacterized protein LOC101218278 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356574022|ref|XP_003555152.1| PREDICTED: uncharacterized protein LOC100810572 [Glycine max] Back     alignment and taxonomy information
>gi|124360576|gb|ABN08575.1| Esterase/lipase/thioesterase; Lipase, active site [Medicago truncatula] Back     alignment and taxonomy information
>gi|334185654|ref|NP_001189986.1| hydrolase [Arabidopsis thaliana] gi|332643776|gb|AEE77297.1| hydrolase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240255448|ref|NP_189368.5| hydrolase [Arabidopsis thaliana] gi|332643775|gb|AEE77296.1| hydrolase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449525467|ref|XP_004169739.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101231349 [Cucumis sativus] Back     alignment and taxonomy information
>gi|11994634|dbj|BAA95706.2| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297814980|ref|XP_002875373.1| hypothetical protein ARALYDRAFT_322858 [Arabidopsis lyrata subsp. lyrata] gi|297321211|gb|EFH51632.1| hypothetical protein ARALYDRAFT_322858 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1104
ASPGD|ASPL00000081881140 AN6702 [Emericella nidulans (t 0.345 0.334 0.254 2.5e-43
DICTYBASE|DDB_G0280525 1622 DDB_G0280525 "GPI inositol-dea 0.311 0.212 0.321 1.7e-39
UNIPROTKB|G4MW971267 MGG_01844 "GPI inositol-deacyl 0.203 0.177 0.326 2.8e-37
POMBASE|SPAC824.021142 bst1 "GPI inositol deacylase B 0.203 0.197 0.323 2.2e-36
UNIPROTKB|B4DYY6304 PGAP1 "GPI inositol-deacylase" 0.146 0.532 0.276 1.6e-28
UNIPROTKB|Q66J01927 pgap1 "GPI inositol-deacylase" 0.141 0.168 0.304 1.4e-26
ZFIN|ZDB-GENE-090313-216952 pgap1 "post-GPI attachment to 0.183 0.213 0.293 1.4e-25
UNIPROTKB|Q75T13922 PGAP1 "GPI inositol-deacylase" 0.146 0.175 0.276 1e-24
UNIPROTKB|E2R8V9923 PGAP1 "Uncharacterized protein 0.143 0.171 0.279 1.1e-24
UNIPROTKB|J9NRJ8934 PGAP1 "Uncharacterized protein 0.143 0.169 0.279 1.1e-24
ASPGD|ASPL0000008188 AN6702 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
 Score = 372 (136.0 bits), Expect = 2.5e-43, Sum P(3) = 2.5e-43
 Identities = 104/409 (25%), Positives = 196/409 (47%)

Query:   146 TRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQYRESQDAREREGAATSGSLP 205
             TR LD+F +D   + +A  GQ L + AEYV  A+  IL  Y + +  R R  A      P
Sbjct:   240 TRSLDFFMIDFNEDMAAFHGQTLLDQAEYVNEAVAYILSLYHDPR--RTRRDADLPD--P 295

Query:   206 KSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPHQSPPLALQPSLGNYFARVNDE 265
              SVIL+GHS+GG VAR A+     ++++V T++T+S+PH   P++    + + + ++ND 
Sbjct:   296 SSVILIGHSMGGIVARTALTMANYQENSVNTIITMSAPHAKAPVSFDSDIVHTYKQINDY 355

Query:   266 WRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISST 325
             WR+ Y + T       +N+ L HV ++SI+ G  D  V S   S+  +VP THGF + ++
Sbjct:   356 WREAY-SQTW-----ANNNPLWHVTLISIAGGSRDTVVPSDYASISSLVPETHGFTVFTS 409

Query:   326 GMKNVWLSMEHQAILWCNQLVVQVSHTLLSLIDSRTGQPFLDTRQRLAMFSRMLRSGTPQ 385
              M +VW+ ++H +I WC+Q    +  +L  ++D R         +R+ +F +   +G   
Sbjct:   410 TMPDVWIGVDHLSITWCDQFRKAIIKSLFDVVDVRRASQTKPRAERMRIFKKWYLTGLES 469

Query:   386 SFNWMMQSHLFHQSTPASIKDAKDAAGSQAPSSSSCTVQWSAEGLDKDLYIQTATVTVLA 445
                  +   +  ++ P+++   +D   +         ++        ++++    V    
Sbjct:   470 -----VSERMLTRNEPSTLVTLEDHTNTILAQGQRLVLRELGHRTGPNVHL--LPVPPQG 522

Query:   446 MDGKRRWL--D--IQKLGANGKDHFIFVTNLAPCTGVRIHLWPEKGKSTTDLPGSKRILE 501
             + GK+  L  D  + + G  G    +F +      G    ++      ++D  GS R+  
Sbjct:   523 VSGKKFTLLTDQRLDRTGEQGSLEVLFCSVFPLHNGKASSVFA-LNMDSSDSSGSTRLAC 581

Query:   502 VTSKM--VHIPSRAAPRQLEPGSQTEQAPPSAVFQLGPEDMRGFRFLTI 548
               + +  +H+P  A+ R     +  ++A P +  Q   ED+   +F+ +
Sbjct:   582 KNAAVDEIHLP--ASTRTSR--NAYDRARPFSYLQYDLEDLAEHQFVAV 626


GO:0031227 "intrinsic to endoplasmic reticulum membrane" evidence=IEA
GO:0006505 "GPI anchor metabolic process" evidence=IEA
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
DICTYBASE|DDB_G0280525 DDB_G0280525 "GPI inositol-deacylase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|G4MW97 MGG_01844 "GPI inositol-deacylase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPAC824.02 bst1 "GPI inositol deacylase Bst1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|B4DYY6 PGAP1 "GPI inositol-deacylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q66J01 pgap1 "GPI inositol-deacylase" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090313-216 pgap1 "post-GPI attachment to proteins 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q75T13 PGAP1 "GPI inositol-deacylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8V9 PGAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRJ8 PGAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1104
pfam07819225 pfam07819, PGAP1, PGAP1-like protein 9e-85
>gnl|CDD|203773 pfam07819, PGAP1, PGAP1-like protein Back     alignment and domain information
 Score =  273 bits (700), Expect = 9e-85
 Identities = 103/277 (37%), Positives = 140/277 (50%), Gaps = 52/277 (18%)

Query: 80  QLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIF 139
           +L+G+PVLFIPGNAGSYKQVRS+A+ + R                               
Sbjct: 1   ELSGIPVLFIPGNAGSYKQVRSIASVALRKA----------------------------- 31

Query: 140 HSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHAEYVVYAIHRILDQYRESQDAREREGAA 199
              N     LD+F+VD   E SA  G+ L + AEY+  AI  IL  Y             
Sbjct: 32  -ELNDNGFHLDFFSVDFNEELSAFHGRTLLDQAEYLNDAIRYILSLYNS----------- 79

Query: 200 TSGSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPHQSPPLALQPSLGNYF 259
            +   P SVIL+GHS+GG VARAA+  P     +V T++TLSSPH  PPL     L  ++
Sbjct: 80  -NRPPPTSVILIGHSMGGLVARAALTLPNYIPDSVNTIVTLSSPHAGPPLTFDGDLLRFY 138

Query: 260 ARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHG 319
           A +N+ WR+                 LS+V +VSI+ G  DYQV     SL+ +VP T+G
Sbjct: 139 ALLNEYWRRNQA----------DGDSLSNVGLVSITGGIRDYQVPDDYSSLEALVPSTNG 188

Query: 320 FMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSL 356
             + +T + +VWLS++H AI+WC QL   V+  L   
Sbjct: 189 LSVLTTSIPDVWLSIDHLAIVWCKQLRRVVARALFEY 225


The sequences found in this family are similar to PGAP1. This is an endoplasmic reticulum membrane protein with a catalytic serine containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body. Length = 225

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1104
KOG3724973 consensus Negative regulator of COPII vesicle form 100.0
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 100.0
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 99.06
PLN02824294 hydrolase, alpha/beta fold family protein 99.05
PRK03592295 haloalkane dehalogenase; Provisional 98.97
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.94
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.92
PRK00870302 haloalkane dehalogenase; Provisional 98.9
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.89
PRK10673255 acyl-CoA esterase; Provisional 98.89
PRK10349256 carboxylesterase BioH; Provisional 98.83
PLN02679360 hydrolase, alpha/beta fold family protein 98.82
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 98.79
PLN02965255 Probable pheophorbidase 98.74
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 98.74
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 98.73
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.72
PLN02578354 hydrolase 98.67
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 98.67
PRK10749330 lysophospholipase L2; Provisional 98.65
TIGR03611257 RutD pyrimidine utilization protein D. This protei 98.65
PHA02857276 monoglyceride lipase; Provisional 98.62
PRK03204286 haloalkane dehalogenase; Provisional 98.62
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.61
PLN03084383 alpha/beta hydrolase fold protein; Provisional 98.58
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 98.58
PLN02211273 methyl indole-3-acetate methyltransferase 98.58
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.57
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.55
PRK08775343 homoserine O-acetyltransferase; Provisional 98.54
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.53
PLN02652395 hydrolase; alpha/beta fold family protein 98.53
PLN02385349 hydrolase; alpha/beta fold family protein 98.51
PLN02298330 hydrolase, alpha/beta fold family protein 98.47
PRK07868994 acyl-CoA synthetase; Validated 98.46
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.46
PRK06489360 hypothetical protein; Provisional 98.45
PRK05855582 short chain dehydrogenase; Validated 98.42
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 98.42
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.41
PRK10985324 putative hydrolase; Provisional 98.39
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.38
PLN02894402 hydrolase, alpha/beta fold family protein 98.35
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.32
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 98.3
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.29
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 98.28
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 98.26
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.16
PRK00175379 metX homoserine O-acetyltransferase; Provisional 98.15
PLN02511388 hydrolase 98.1
COG1647243 Esterase/lipase [General function prediction only] 98.06
PLN02872395 triacylglycerol lipase 98.01
PRK11071190 esterase YqiA; Provisional 98.0
COG4814288 Uncharacterized protein with an alpha/beta hydrola 97.99
COG1075336 LipA Predicted acetyltransferases and hydrolases w 97.97
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 97.97
COG2267298 PldB Lysophospholipase [Lipid metabolism] 97.96
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 97.95
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 97.95
PRK10566249 esterase; Provisional 97.95
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 97.94
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 97.93
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 97.92
PRK13604307 luxD acyl transferase; Provisional 97.85
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 97.84
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 97.83
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 97.79
PRK07581339 hypothetical protein; Validated 97.79
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 97.76
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 97.75
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 97.71
PRK05077414 frsA fermentation/respiration switch protein; Revi 97.66
KOG2564343 consensus Predicted acetyltransferases and hydrola 97.63
PLN00021313 chlorophyllase 97.62
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 97.61
PRK11460232 putative hydrolase; Provisional 97.47
KOG1455313 consensus Lysophospholipase [Lipid transport and m 97.45
PLN02606306 palmitoyl-protein thioesterase 97.24
KOG1552258 consensus Predicted alpha/beta hydrolase [General 97.22
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 97.14
PLN02442283 S-formylglutathione hydrolase 97.12
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 97.08
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 97.07
PLN02633314 palmitoyl protein thioesterase family protein 96.94
PRK10162318 acetyl esterase; Provisional 96.89
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 96.88
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 96.82
PRK102521296 entF enterobactin synthase subunit F; Provisional 96.75
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 96.67
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 96.67
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 96.54
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 96.45
COG3319257 Thioesterase domains of type I polyketide synthase 96.39
PRK06765389 homoserine O-acetyltransferase; Provisional 96.17
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 96.01
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 96.0
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 95.85
PLN02517642 phosphatidylcholine-sterol O-acyltransferase 95.62
TIGR00976550 /NonD putative hydrolase, CocE/NonD family. This m 95.6
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 95.54
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 95.54
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 95.47
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 95.42
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 95.38
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 95.35
KOG3724973 consensus Negative regulator of COPII vesicle form 94.96
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 94.95
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 94.87
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 94.77
KOG2029697 consensus Uncharacterized conserved protein [Funct 94.58
PF10503220 Esterase_phd: Esterase PHB depolymerase 94.06
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 93.98
PLN02408365 phospholipase A1 93.57
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 93.48
PLN02310405 triacylglycerol lipase 93.44
PLN00413479 triacylglycerol lipase 93.31
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 93.3
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 93.22
PLN02454414 triacylglycerol lipase 93.17
COG3208244 GrsT Predicted thioesterase involved in non-riboso 93.07
KOG1838409 consensus Alpha/beta hydrolase [General function p 92.94
PLN02753531 triacylglycerol lipase 92.8
PLN02571413 triacylglycerol lipase 92.75
PLN02162475 triacylglycerol lipase 92.62
PLN02802509 triacylglycerol lipase 92.38
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 92.31
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 92.26
PLN03037525 lipase class 3 family protein; Provisional 92.04
COG0400207 Predicted esterase [General function prediction on 92.04
PLN02761527 lipase class 3 family protein 91.88
KOG2369473 consensus Lecithin:cholesterol acyltransferase (LC 91.81
PLN02324415 triacylglycerol lipase 91.24
PLN02719518 triacylglycerol lipase 91.02
PLN02934515 triacylglycerol lipase 90.46
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 90.12
COG0412236 Dienelactone hydrolase and related enzymes [Second 89.43
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 89.32
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 89.1
COG4782377 Uncharacterized protein conserved in bacteria [Fun 89.06
COG0657312 Aes Esterase/lipase [Lipid metabolism] 88.65
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 87.47
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 86.75
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 86.28
KOG2984277 consensus Predicted hydrolase [General function pr 85.55
COG4947227 Uncharacterized protein conserved in bacteria [Fun 85.34
KOG4569336 consensus Predicted lipase [Lipid transport and me 84.76
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 82.41
KOG3975301 consensus Uncharacterized conserved protein [Funct 81.54
KOG4667269 consensus Predicted esterase [Lipid transport and 80.42
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=100.00  E-value=2.4e-149  Score=1295.26  Aligned_cols=925  Identities=35%  Similarity=0.475  Sum_probs=752.4

Q ss_pred             HHHHHHHHHHHHHhhcccCCCCeeeeeeccceeecCCCCC--CCCCCCceEEEEeeCCcccchhHhhcccCCccEEEecC
Q 001306           14 VILALWIGIAALYSLLKPISNGCVMTYMYPTYIPISSTEG--ASSSARYALYLYHEGWKKIDFEEHLKQLNGVPVLFIPG   91 (1104)
Q Consensus        14 ~~~~~~~~l~~l~~~l~~~~n~C~MTYMyPsY~~I~~~~~--~~~a~kY~LYlYrEg~~~~~~~~~~~~l~GvPVLFIPG   91 (1104)
                      .++++++++..+.+++++++|+|.||||||+|.++-..+.  ++.++||+||+||||+.+++  .+..+++|||||||||
T Consensus        20 liia~ll~l~ll~~f~g~~en~CsmtYMypsy~r~i~i~~r~t~~a~kY~LYLY~Egs~~~e--~~~lelsGIPVLFIPG   97 (973)
T KOG3724|consen   20 LIIAVLLGLGLLLHFLGHQENGCSMTYMYPSYYRFIEIPERLTPQADKYSLYLYREGSRWWE--RSTLELSGIPVLFIPG   97 (973)
T ss_pred             HHHHHHHHHHHHHHhcCCCCCCceeEEEeccceeecCCcccccCCCCceEEEEecccccccc--cccccCCCceEEEecC
Confidence            3358888888999999999999999999999776655433  56899999999999987654  5667899999999999


Q ss_pred             CCCcHHHHHHHHHHHHHHhcCCCCcchhhhhhhhccccCCccccccccccccccccceeEEEEeCCCCCCCcchhhHHHH
Q 001306           92 NAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEH  171 (1104)
Q Consensus        92 NAGSYkQvRSLAs~a~r~y~~~~~~~~~~~~~~l~p~~~~~~~e~~~~~~~~~~~~~lD~FaVDFnEE~SAf~G~tL~dQ  171 (1104)
                      ||||||||||+||++++.|++++.++     +             +    ......++|||+||||||++||||++|+||
T Consensus        98 NAGSyKQvRSiAS~a~n~y~~~~~e~-----t-------------~----~~d~~~~~DFFaVDFnEe~tAm~G~~l~dQ  155 (973)
T KOG3724|consen   98 NAGSYKQVRSIASVAQNAYQGGPFEK-----T-------------E----DRDNPFSFDFFAVDFNEEFTAMHGHILLDQ  155 (973)
T ss_pred             CCCchHHHHHHHHHHhhhhcCCchhh-----h-------------h----cccCccccceEEEcccchhhhhccHhHHHH
Confidence            99999999999999999998875432     1             0    122346789999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHcccchhhhhhcccccCCCCCceEEEEEEchhHHHHHHHHhCCCcccccccEEEEecCCCCCCCccc
Q 001306          172 AEYVVYAIHRILDQYRESQDAREREGAATSGSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSSPHQSPPLAL  251 (1104)
Q Consensus       172 AeyVn~aI~~ILslY~~~~~~r~~~~~~~~~~~p~sViLVGHSMGGiVAr~~l~~P~~~~~~V~~IITLsTPH~~pPvaf  251 (1104)
                      |||||+||++|+++|++.        +|...++|++|+||||||||+|||+++++||+.++.|++|||+||||+.||+++
T Consensus       156 tEYV~dAIk~ILslYr~~--------~e~~~p~P~sVILVGHSMGGiVAra~~tlkn~~~~sVntIITlssPH~a~Pl~~  227 (973)
T KOG3724|consen  156 TEYVNDAIKYILSLYRGE--------REYASPLPHSVILVGHSMGGIVARATLTLKNEVQGSVNTIITLSSPHAAPPLPL  227 (973)
T ss_pred             HHHHHHHHHHHHHHhhcc--------cccCCCCCceEEEEeccchhHHHHHHHhhhhhccchhhhhhhhcCcccCCCCCC
Confidence            999999999999999841        122357799999999999999999999999999999999999999999999999


Q ss_pred             CcchHHHHHHHHHHHHhcccCCCCCCCccccCCCCCcceEEEEecCCCCccccCCCccccCCCCCCcceeeeecccCcee
Q 001306          252 QPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVW  331 (1104)
Q Consensus       252 D~~l~~fY~~vn~~W~~~~~~~~s~~~~~~~~~~l~~V~LVSIaGG~rD~~VPsdlTsl~~lvP~t~g~tV~TTsIPgVW  331 (1104)
                      |+.+.+||..+|++|++.+..+        +++.+++|.+|||+||.+|||||++++++++++|.++|++++||+||+||
T Consensus       228 D~~l~~fy~~vnn~W~k~~~~~--------~~~~ls~V~vVSisGG~~Dy~V~se~ssl~~lv~~t~gfsv~sT~iP~vW  299 (973)
T KOG3724|consen  228 DRFLLRFYLLVNNYWNKLQNNN--------SDPLLSHVGVVSISGGIRDYQVPSELSSLRNLVPVTNGFSVFSTNIPVVW  299 (973)
T ss_pred             cHHHHHHHHHHHHHHHHHHhcc--------ccchhcceEEEEEecCccccccCcchhhhccccccccceEEEecCCcccc
Confidence            9999999999999999987654        34668899999999999999999999999999999999999999999999


Q ss_pred             ecCCCchhhhhHHHHHHHHHHHHhhcccCCCCCCCCHHHHHHHHHHHHhccCCCcccccccccccCCCcccccccccccc
Q 001306          332 LSMEHQAILWCNQLVVQVSHTLLSLIDSRTGQPFLDTRQRLAMFSRMLRSGTPQSFNWMMQSHLFHQSTPASIKDAKDAA  411 (1104)
Q Consensus       332 vs~DH~aIVWC~QLv~~IAraLl~lvD~~t~~~t~~~~~Rm~vf~k~l~sgle~~~~~~~~~~~~~~~~~l~~~~~~~~~  411 (1104)
                      +++||+||+|||||+++++|.|++++|.+|.|.|++.++|..++.|.+.+|.++ +.++.+..+++.. .+..++.    
T Consensus       300 ~~iDHlAIlWCnql~~~vsR~l~s~ida~t~q~~~~~nqRl~vl~r~~i~~~ak-~~~~n~~i~~p~~-il~~~~~----  373 (973)
T KOG3724|consen  300 LSIDHLAILWCNQLVRVVSRVLLSYIDALTTQTTRQLNQRLYVLDRDLISGRAK-FRHMNPVISKPIK-ILASEDL----  373 (973)
T ss_pred             cccchHHHHHHHHHHHHHHHHHHHHhhccCccccchhHHHHHHHHHHHHhhHHH-hcCCCcccccHHH-hhhhcCC----
Confidence            999999999999999999999999999999999999999999999999999998 6677655555442 2221111    


Q ss_pred             cCCCCCCCcccccccccCCCccccccceeEEeeccCCccceEeeeccCCCCceEEEEEeccCCCCcceEeecCCCCCCCC
Q 001306          412 GSQAPSSSSCTVQWSAEGLDKDLYIQTATVTVLAMDGKRRWLDIQKLGANGKDHFIFVTNLAPCTGVRIHLWPEKGKSTT  491 (1104)
Q Consensus       412 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~l~i~~~~~~~~~~f~l~t~l~~~~~~~v~l~~~~~~~~~  491 (1104)
                              .|...|...-.+...+.+   ++++.+...++++.....+.+++.++.|.+++.+|++.+++.|.|+.+..+
T Consensus       374 --------~~f~~~~~~~~~~~~~~q---~~vl~~~~~~~~l~~~~s~~~~~ehl~fq~~~~~~s~~~I~~c~ek~k~~s  442 (973)
T KOG3724|consen  374 --------TGFSVWETQFALLILYKQ---FEVLEKRHNAFPLNNMTSVIYDEEHLYFQNSLDSASNTWIYACLEKEKEVS  442 (973)
T ss_pred             --------CceEehhhhhHHHHHHHH---HHHHHHhhhccccccccccccccceEEEeccccccccceeeeeccccchhh
Confidence                    133335332223333333   456667778888877777777888988988999999999999998766555


Q ss_pred             CCCCcccceeccccceecCCCCCCCCCCCCCCCCCCCCeeEEEeCccccCCccEEEEEeCCCCCCCCCCCCcceeeeeec
Q 001306          492 DLPGSKRILEVTSKMVHIPSRAAPRQLEPGSQTEQAPPSAVFQLGPEDMRGFRFLTISVAPTPTISGRPPPAVSMAVGQF  571 (1104)
Q Consensus       492 ~~~~~~~~~~~t~~~~~iP~s~~~~~~~p~s~~~~~~pf~~L~~~~~dL~~~~fi~I~~aprp~~~~~~~~~~~~~v~~f  571 (1104)
                      ...+|+..-+++..+...+...++++.+|.++...+.|.....+...|+..+++.... +|+.+.++.++-...+.+.++
T Consensus       443 ~l~~vd~~~~v~~~~s~~~~~~~~~~~~~~s~~~~avp~~~~~l~~~d~~~~r~~~~~-~~se~~~~~p~~~~~~~~l~~  521 (973)
T KOG3724|consen  443 CLLAVDAPLSVDIQMSPPMLVQALRFYEPASSHLHAVPSGMISLSVYDAILFRKTTYY-APSETASLLPNLGFLFFVLSN  521 (973)
T ss_pred             hhHhhhcccccccccccchhhhhhhhccccccceecCCcccceeeeeeeeeeeccccc-cchhhhccCCceeEEEEEeec
Confidence            6667888888888888888888888888999889999999999999999999999988 888888877777766777776


Q ss_pred             cCCcccccccChhHHHhhccCCcceeccCCCCeEEEEEEecccCcceeEEEEEe--ecccccCCCCcccccCchhhhhcc
Q 001306          572 FNPQEGEREFSSQSMLLSAYSPKDLFLKEDHPLVFNLTFAISLGLLPITLSLRT--ASCGIQNSGFANEEAGDIEHSRLC  649 (1104)
Q Consensus       572 ~~~~~~~~~~s~~~ll~~~~~~~~~~L~~~~pl~~~i~~p~s~SLl~y~ls~~~--~~c~~~~~~f~r~~~~~~e~~~~~  649 (1104)
                      .++-+.....+..-.++...+.+++..+++++.+.++++-.. |+++|+.+.+.  ..|+++.           +     
T Consensus       522 ~s~~~~t~~~~sql~Lf~~g~~~qi~~k~di~k~~~~~~~~t-Sllal~i~~s~e~s~~~i~a-----------~-----  584 (973)
T KOG3724|consen  522 VSDVDDTTTLPSQLELFMAGGWRQIFFKVDISKVSRFSFVKT-SLLALRIDKSYEGSYLGISA-----------I-----  584 (973)
T ss_pred             cccccCccccHhHHHHHHccchhhhheeccHhHheecccchh-heeEeecceeeccccccccc-----------c-----
Confidence            565555555555555555556678888889888877777665 79999988874  4555421           1     


Q ss_pred             ccccCCceeeeecCC---CceEEccCCCcccccccCCCccccCCCC-CceEEEEEeeCCCCce--eEEEEEeHHHHHHHH
Q 001306          650 KMRCFPPVALAWDPT---SGLYVFPNLFSETIIIDSSPALWSYSQG-SEKTIVVLLVDPHCSY--KTSVSVSVTAAASRF  723 (1104)
Q Consensus       650 ~~~~F~P~~~qW~~~---s~~~i~pNv~~~~~i~~~aP~~~~~~~~-~~~l~l~l~~DP~C~~--~isl~is~~~sl~rL  723 (1104)
                           .     |+.+   .|||+  |+.. ...|. +|+.+.+... ..++++.+...|..+.  .+.+...|..+++++
T Consensus       585 -----~-----~i~~~~e~k~hl--~i~~-k~~hv-~Pf~~l~~~e~~~s~~lk~~~~P~~s~~~~~~iql~~~~~ly~l  650 (973)
T KOG3724|consen  585 -----E-----LIMAEFEGKIHL--IILL-KYLHV-APFAVLNISETLISLTLKLFGFPWFSLDVLIVIQLQYQPALYAL  650 (973)
T ss_pred             -----c-----cccCCcccceee--eeec-ccccc-cchhhhcccccceeeeEEEeeCchHhhhHHhhhchhhhHhhhhh
Confidence                 1     3333   78887  6653 22333 5888776554 4569999999998777  566666699999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCHHHHHHHhhcCChhHHHHHHHHHHHHHHHHhhcc-------CCCC
Q 001306          724 LLLYGSQIAGLSVAVVFFALMRQAYAWDYYLPMPSMLTVVEYNLQMPFPFLLLAILPILVSLFHSFLMS-------QPFP  796 (1104)
Q Consensus       724 ~lrYr~~i~afpvaVi~lvL~~Qf~~y~~t~~FpSF~~aL~~~Lr~~lp~lll~~~~l~~~~~~~~~~~-------~~~p  796 (1104)
                      .+|||+..|.||+..+.+++..||++++.+..++|+++|++..+|+.+..+++-+.+.+- ...+-++.       +|.|
T Consensus       651 ~iryr~~lAsfpv~~i~l~~~~qf~~ph~~y~~~s~~sal~~~~rk~li~~~f~v~~ss~-vv~~~l~~q~~~~v~dpvp  729 (973)
T KOG3724|consen  651 GIRYRGLLASFPVRQITLRLLVQFLVPHFLYLITSPLSALSGFTRKILITARFVVFPSSK-VVTPPLPEQERVQVEDPVP  729 (973)
T ss_pred             hheeehhhhhcchhHHHHHHHHhhhhhccceeecchHHHHHHHHHHHHHHHHHHhhhhhh-hhchhhHHHHHHhhcCCcc
Confidence            999999999999999999999999999999999999999999999877777666655552 22222222       4555


Q ss_pred             CccccceehhhHHHhhhhHHHHHHHHHhhhhhhhhheeeeeehhhhhhccCchh-----hHHHHHHhhcccchh------
Q 001306          797 PIMSFAVVSLICYVLANGLIALLILVSQLVFYVTATAHVFIKTRWEVWEGNFCF-----AFLLWFVNLSSSFFS------  865 (1104)
Q Consensus       797 ~~~~~~~v~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~------  865 (1104)
                      +.-.+..                                        |+.|...     +.+-||.++=-+++-      
T Consensus       730 ~~~p~~~----------------------------------------~~~nmh~~f~ll~v~~wf~s~~~~l~~v~~v~L  769 (973)
T KOG3724|consen  730 IQLPNNR----------------------------------------QRYNMHNRFRLLAVLPWFSSLFYSLLMVQPVPL  769 (973)
T ss_pred             cccchhH----------------------------------------HhhcccchhhHHHHHHHHHHHHHHHHhhchhHH
Confidence            4322110                                        1222111     112233322211111      


Q ss_pred             hhhHHHhhccchhhhhhhhhhhhhhhccchhHHHHHhhhhccccccchhhhhhhhhccccCCCCCcccccccccccCCCC
Q 001306          866 LKVVRVIRANQLLVAALAAITLVCFVHPALGLIVILLSHAFCCHTSLSSHAWRKELYDYNTNNNGRSKLRYTRERRFSPN  945 (1104)
Q Consensus       866 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  945 (1104)
                      +-.+-++|-|-.|.+.+.|-.|+.+|||++|+|+++-+||.|.------.-.+||..|+.++..++.           ++
T Consensus       770 laf~~~I~~s~~iL~t~~~rkL~~~~~~~l~~F~~~~~~ay~~r~~~~mllll~~~~~~p~q~~~~~-----------~l  838 (973)
T KOG3724|consen  770 LAFTVAIRISTTILMTLIARKLVSFVHPALGLFVLLASHAYCSRCCIMMLLLLKESLDQPNQAERKT-----------RL  838 (973)
T ss_pred             HHHHHHHhhhhHHHHHHHHHHHhhccCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcCchhhhhhh-----------cc
Confidence            1122345668888889999999999999999999999999991111133456789999888777665           56


Q ss_pred             CCCCCCCCCCCCCCcccccccchhhcchhhHHHHHHHHHHhhhhHHHHHHHHhcCCCCChhhhhhhhhHHhhhhhcccCC
Q 001306          946 LPLDDCSSSSPDSSKTFSDTQLEIFHHRHGLLILHLLASLMFVPSLMAWFQRISMGHSFPWFLDSVLCIGVILHGTVISK 1025 (1104)
Q Consensus       946 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~lh~~~~~m~~ps~~aw~q~~~~~~~~p~~~d~~~~~g~~~hg~~~s~ 1025 (1104)
                      ....+...+.+..+|||++ |+++|+||||||||||+||+||+|++++|+||||||++||||-|+.+|+||++|||.   
T Consensus       839 ~~q~~t~v~~~ll~~s~~e-~~d~~N~~~tlliL~Ll~a~~~~P~livw~~ni~~~ws~pf~~hhn~~~~vpfi~l~---  914 (973)
T KOG3724|consen  839 PSQRETPVSGDLLEKSFVE-QADIFNHRHTLLILHLLAALMFVPSLIVWFQNIGTGWSFPFFAHHNLCVGVPFIGLL---  914 (973)
T ss_pred             ccccccccHHHHHHHHHHH-HHHHhccchHHHHHHHHHHHhhhHHHHHHHHhcccCcccccccccceeEechhheeh---
Confidence            6667788888999999999 999999999999999999999999999999999999999999999999999999999   


Q ss_pred             CCCccccccCCccccccchhhhhhhhhHHHHhhccccchhHHHHHHHHhhhhhhhhhHH
Q 001306         1026 PEYNYLVSFPGILGQELRLNSIYLLAGYYSFLSGLALAPYRVFYAMAAIGVISLASKII 1084 (1104)
Q Consensus      1026 ~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~p~~~~y~~~~~g~~~~~~~~~ 1084 (1104)
                      |+.....||| ..|+|++..+||+++||||++.+.++|||+.+||.|.+|++.+.++++
T Consensus       915 ~i~~~~~s~P-l~~~~~~~~~i~l~~l~~~sfiyg~~~pY~ih~~v~~~~~wlLfl~~~  972 (973)
T KOG3724|consen  915 PISSILRSFP-LSGHQIRPHHIYLLALYYCSFIYGELAPYKIHYAVASLGYWLLFLKIS  972 (973)
T ss_pred             hhhhcccccc-cCCcccceeEEehHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHheeec
Confidence            8888899999 999999999999999999999999999999999999999999998875



>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>KOG2029 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1104
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-12
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 6e-05
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 8e-05
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 5e-04
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 9e-04
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 9e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 68.7 bits (167), Expect = 9e-12
 Identities = 45/327 (13%), Positives = 97/327 (29%), Gaps = 78/327 (23%)

Query: 70  KKIDFEEHLKQLNGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEAS-LTLE 128
             +   + L +L     + I G  GS K    +A +   +Y    ++     +   L L 
Sbjct: 136 PYLKLRQALLELRPAKNVLIDGVLGSGKTW--VALDVCLSY---KVQCKMDFKIFWLNL- 189

Query: 129 EGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSAMDGQILEEHA------EYVVYAIHR- 181
               N   ++     +   ++D    +            L  H+        +    +  
Sbjct: 190 -KNCNSPETVLEMLQKLLYQID---PNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYEN 245

Query: 182 ---ILD--QYRESQDA-----------REREGAATSGSLPKSVILVGHSVGGFVARAAII 225
              +L   Q  ++ +A           R ++      +   + I + H            
Sbjct: 246 CLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVK- 304

Query: 226 HPLLRKSAVETVLTLSSPHQSP---PLALQ---PSLGNYFARVNDEWRKGYEAHTTPTGH 279
             LL K        L  P +     P  L     S+ +  A   D W+            
Sbjct: 305 -SLLLKYLDCRPQDL--PREVLTTNPRRLSIIAESIRDGLAT-WDNWK------------ 348

Query: 280 HVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMISSTGMKNVWLSMEHQAI 339
           HV+  +L+ ++  S++      + R   + L  + P             +  +     ++
Sbjct: 349 HVNCDKLTTIIESSLNV-LEPAEYRKMFDRL-SVFP------------PSAHIPTILLSL 394

Query: 340 LWCN------QLVVQVSHTLLSLIDSR 360
           +W +       +VV   H   SL++ +
Sbjct: 395 IWFDVIKSDVMVVVNKLHK-YSLVEKQ 420


>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Length = 484 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Length = 320 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1104
3lp5_A250 Putative cell surface hydrolase; structural genom 99.7
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.57
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.54
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.43
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.25
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.2
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.1
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.1
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.09
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.05
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.05
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.05
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.05
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.04
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.04
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.03
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.03
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.02
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.01
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.01
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.01
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.0
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.0
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.0
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.99
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.99
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.98
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.98
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.97
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.97
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.97
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 98.96
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 98.96
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.96
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.96
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 98.95
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.95
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 98.95
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 98.95
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.95
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 98.95
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.95
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 98.95
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.95
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.95
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 98.94
1r3d_A264 Conserved hypothetical protein VC1974; structural 98.93
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.93
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 98.92
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.92
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.91
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.9
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.9
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.9
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 98.89
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 98.89
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.88
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.88
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.87
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.87
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 98.86
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.85
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.85
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.84
3h04_A275 Uncharacterized protein; protein with unknown func 98.84
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.83
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.82
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 98.82
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.81
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.81
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.81
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.8
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 98.8
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 98.8
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 98.79
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.79
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.78
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 98.78
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.78
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 98.77
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.77
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.77
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.77
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.76
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.76
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.76
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.76
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.76
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 98.75
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 98.75
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.74
1kez_A300 Erythronolide synthase; polyketide synthase, modul 98.71
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 98.7
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.69
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 98.68
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 98.68
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.68
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 98.66
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 98.65
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.1
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.65
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 98.64
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.64
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.62
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.61
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 98.61
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.6
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 98.6
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 98.6
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 98.6
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.59
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.59
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.56
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 98.54
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 98.54
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.53
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.53
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.52
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.52
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 98.51
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.51
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.5
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 98.5
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.5
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.49
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 98.49
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 98.49
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 98.47
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.47
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.46
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.46
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.44
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.43
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.42
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 98.4
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 98.39
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.39
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.39
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.35
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.32
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.31
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 98.3
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 98.28
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 98.25
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.25
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.24
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.21
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 98.21
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.2
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.2
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 98.18
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.18
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 98.17
4fle_A202 Esterase; structural genomics, PSI-biology, northe 98.16
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 98.13
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.12
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.12
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.1
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.08
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.06
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.05
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.04
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 98.04
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.03
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 97.99
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.99
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.97
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 97.97
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 97.93
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 97.9
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 97.87
3d59_A383 Platelet-activating factor acetylhydrolase; secret 97.84
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.82
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.82
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 97.81
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.8
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 97.8
3ain_A323 303AA long hypothetical esterase; carboxylesterase 97.8
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 97.79
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 97.79
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 97.75
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 97.74
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 97.73
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 97.73
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 97.66
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 97.65
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 97.64
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 97.57
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 97.56
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 97.54
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.53
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.51
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 97.5
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.47
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.46
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 97.46
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.36
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.32
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 97.29
3nuz_A398 Putative acetyl xylan esterase; structural genomic 97.29
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 97.23
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 97.2
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.13
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.96
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 96.95
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 96.93
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 96.92
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 96.81
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 96.68
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 96.65
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.57
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 96.42
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 96.39
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 96.3
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.27
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 96.2
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 96.2
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 96.04
4f21_A246 Carboxylesterase/phospholipase family protein; str 95.98
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.9
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 95.86
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 95.67
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 95.66
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 95.52
3i2k_A587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 95.47
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 95.43
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 95.37
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 95.23
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 94.99
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 94.8
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 94.65
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 94.4
1mpx_A615 Alpha-amino acid ester hydrolase; alpha/beta hydro 94.27
1lns_A763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 93.96
2h7c_A542 Liver carboxylesterase 1; enzyme, cholesteryl este 93.94
1p0i_A529 Cholinesterase; serine hydrolase, butyrate, hydrol 93.85
2fj0_A551 JuvenIle hormone esterase; manduca sexta, alpha-be 93.76
3iii_A560 COCE/NOND family hydrolase; structural genomics, c 93.25
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 93.24
1ea5_A537 ACHE, acetylcholinesterase; hydrolase, serine hydr 93.2
2ha2_A543 ACHE, acetylcholinesterase; hydrolase fold, serine 92.88
2b9v_A652 Alpha-amino acid ester hydrolase; catalytic triad, 92.22
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 91.6
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 90.9
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 90.87
1dx4_A585 ACHE, acetylcholinesterase; hydrolase, serine este 90.74
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 89.95
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 89.76
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 89.68
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 89.66
2bce_A579 Cholesterol esterase; hydrolase, serine esterase, 89.27
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 88.95
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 87.51
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 85.36
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 84.42
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 83.91
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 82.45
3bix_A574 Neuroligin-1, neuroligin I; esterase domain, alpha 80.28
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
Probab=99.70  E-value=1.1e-16  Score=170.54  Aligned_cols=224  Identities=17%  Similarity=0.232  Sum_probs=138.8

Q ss_pred             CCccEEEecCCCCcHHHHHHHHHHHHHHhcCCCCcchhhhhhhhccccCCccccccccccccccccceeEEEEeCCCCCC
Q 001306           82 NGVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHS  161 (1104)
Q Consensus        82 ~GvPVLFIPGNAGSYkQvRSLAs~a~r~y~~~~~~~~~~~~~~l~p~~~~~~~e~~~~~~~~~~~~~lD~FaVDFnEE~S  161 (1104)
                      .|.|||||||..||...|+.++..+.+.+...-+--. +.   + +..|...  . .-.+....  .--++-+.|.... 
T Consensus         3 ~~~pvv~iHG~~~~~~~~~~~~~~L~~~~~~~~~vi~-~~---v-~~~G~~~--~-~G~~~~~~--~~P~i~v~f~~n~-   71 (250)
T 3lp5_A            3 RMAPVIMVPGSSASQNRFDSLITELGKETPKKHSVLK-LT---V-QTDGTIK--Y-SGSIAAND--NEPFIVIGFANNR-   71 (250)
T ss_dssp             SCCCEEEECCCGGGHHHHHHHHHHHHHHSSSCCCEEE-EE---E-CTTSCEE--E-EECCCTTC--SSCEEEEEESCCC-
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHhcCCCCceEEE-EE---E-ecCCeEE--E-eeecCCCC--cCCeEEEEeccCC-
Confidence            5789999999999999999999998776410000000 00   0 0000000  0 00000000  0012333333321 


Q ss_pred             Ccchh-hHHHHHHHHHHHHHHHHHHcccchhhhhhcccccCCCCCceEEEEEEchhHHHHHHHHh-CCC-cccccccEEE
Q 001306          162 AMDGQ-ILEEHAEYVVYAIHRILDQYRESQDAREREGAATSGSLPKSVILVGHSVGGFVARAAII-HPL-LRKSAVETVL  238 (1104)
Q Consensus       162 Af~G~-tL~dQAeyVn~aI~~ILslY~~~~~~r~~~~~~~~~~~p~sViLVGHSMGGiVAr~~l~-~P~-~~~~~V~~II  238 (1104)
                        .|. .+.+||+++.++++++.+.|.                 .++++||||||||.+|+.++. ++. ..+..|+++|
T Consensus        72 --~~~~~~~~~a~~l~~~~~~l~~~~~-----------------~~~~~lvGHSmGg~~a~~~~~~~~~~~~~~~v~~lv  132 (250)
T 3lp5_A           72 --DGKANIDKQAVWLNTAFKALVKTYH-----------------FNHFYALGHSNGGLIWTLFLERYLKESPKVHIDRLM  132 (250)
T ss_dssp             --CSHHHHHHHHHHHHHHHHHHHTTSC-----------------CSEEEEEEETHHHHHHHHHHHHTGGGSTTCEEEEEE
T ss_pred             --CcccCHHHHHHHHHHHHHHHHHHcC-----------------CCCeEEEEECHhHHHHHHHHHHccccccchhhCEEE
Confidence              222 689999999999999987774                 468999999999999999775 321 1145799999


Q ss_pred             EecCCCCCCCcccCcchHHHHHHHHHHHHhcccCCCCCCCccccCCCCCcceEEEEecCC---CCccccCCCccc-cCCC
Q 001306          239 TLSSPHQSPPLALQPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGY---HDYQVRSKIESL-DGIV  314 (1104)
Q Consensus       239 TLsTPH~~pPvafD~~l~~fY~~vn~~W~~~~~~~~s~~~~~~~~~~l~~V~LVSIaGG~---rD~~VPsdlTsl-~~lv  314 (1104)
                      +++||+.+...... .....|+.+.+. +..          +   +  .++++++|+|..   .|.+||.+.+.. ..++
T Consensus       133 ~l~~p~~g~~~~~~-~~~~~~~~l~~~-~~~----------l---p--~~vpvl~I~G~~~~~~Dg~Vp~~sa~~l~~l~  195 (250)
T 3lp5_A          133 TIASPYNMESTSTT-AKTSMFKELYRY-RTG----------L---P--ESLTVYSIAGTENYTSDGTVPYNSVNYGKYIF  195 (250)
T ss_dssp             EESCCTTTTCCCSS-CCCHHHHHHHHT-GGG----------S---C--TTCEEEEEECCCCCCTTTBCCHHHHTTHHHHH
T ss_pred             EECCCCCccccccc-ccCHHHHHHHhc-ccc----------C---C--CCceEEEEEecCCCCCCceeeHHHHHHHHHHh
Confidence            99999998765532 234555554321 111          1   1  278999999984   888888877632 3344


Q ss_pred             CCC-cceeeeecccCceeecCCCchhhhhHHHHHHHHHHHHhh
Q 001306          315 PPT-HGFMISSTGMKNVWLSMEHQAILWCNQLVVQVSHTLLSL  356 (1104)
Q Consensus       315 P~t-~g~tV~TTsIPgVWvs~DH~aIVWC~QLv~~IAraLl~l  356 (1104)
                      +.. .......  +.+  ..++|..+.++.|+.+.|.++|.+.
T Consensus       196 ~~~~~~~~~~~--v~g--~~a~H~~l~e~~~v~~~I~~FL~~~  234 (250)
T 3lp5_A          196 QDQVKHFTEIT--VTG--ANTAHSDLPQNKQIVSLIRQYLLAE  234 (250)
T ss_dssp             TTTSSEEEEEE--CTT--TTBSSCCHHHHHHHHHHHHHHTSCC
T ss_pred             cccccceEEEE--EeC--CCCchhcchhCHHHHHHHHHHHhcc
Confidence            431 2222111  222  3578999999999999999998643



>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1104
d1tcaa_317 c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand 3e-04
d1ei9a_279 c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {C 3e-04
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Yeast (Candida antarctica), form b [TaxId: 34362]
 Score = 42.0 bits (98), Expect = 3e-04
 Identities = 14/83 (16%), Positives = 32/83 (38%), Gaps = 17/83 (20%)

Query: 168 LEEHAEYVVYAIHRILDQYRESQDAREREGAATSGSLPKSVILVGHSVGGFVARAAIIHP 227
            + + EY+V AI  +      ++                 + ++  S GG VA+  +   
Sbjct: 76  TQVNTEYMVNAITALYAGSGNNK-----------------LPVLTWSQGGLVAQWGLTFF 118

Query: 228 LLRKSAVETVLTLSSPHQSPPLA 250
              +S V+ ++  +  ++   LA
Sbjct: 119 PSIRSKVDRLMAFAPDYKGTVLA 141


>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 279 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1104
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.63
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.33
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.31
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.11
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.08
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.06
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 99.04
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.0
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.99
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.99
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.97
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.94
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 98.91
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.91
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.91
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.9
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.89
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.89
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 98.88
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.88
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.87
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.86
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.85
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.85
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.82
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 98.8
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.77
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.74
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.72
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 98.71
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 98.67
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.66
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.63
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.6
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 98.6
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.54
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.53
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.36
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.28
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 98.15
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.13
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 98.11
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.0
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.88
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 97.87
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 97.85
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 97.79
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.79
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 97.7
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 97.7
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 97.66
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.31
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 96.57
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 96.38
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 96.29
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 96.01
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 95.99
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 95.92
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 95.78
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 95.69
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 95.65
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 95.56
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 95.29
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 95.19
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 95.17
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 95.12
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 94.96
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 94.8
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 94.66
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 94.4
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 94.28
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 94.26
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 94.17
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 94.09
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 93.94
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 93.85
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 93.31
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 93.06
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 93.01
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 92.95
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 91.22
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 87.07
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 83.63
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 82.89
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Bacterial lipase
domain: Lipase A
species: Bacillus subtilis [TaxId: 1423]
Probab=99.63  E-value=9.4e-16  Score=150.69  Aligned_cols=170  Identities=18%  Similarity=0.189  Sum_probs=114.4

Q ss_pred             CccEEEecCCCCcHHHHHHHHHHHHHHhcCCCCcchhhhhhhhccccCCccccccccccccccccceeEEEEeCCCCCCC
Q 001306           83 GVPVLFIPGNAGSYKQVRSLAAESDRAYQGGPLEHSFYQEASLTLEEGGVNIDASIFHSSNQYTRRLDWFAVDLEGEHSA  162 (1104)
Q Consensus        83 GvPVLFIPGNAGSYkQvRSLAs~a~r~y~~~~~~~~~~~~~~l~p~~~~~~~e~~~~~~~~~~~~~lD~FaVDFnEE~SA  162 (1104)
                      +-|||||||..|+...++.++..+.++.         |                             ..+++|..+... 
T Consensus         2 ~~PVv~vHG~~~~~~~~~~l~~~l~~~g---------~-----------------------------~~~~~~~~~~~~-   42 (179)
T d1ispa_           2 HNPVVMVHGIGGASFNFAGIKSYLVSQG---------W-----------------------------SRDKLYAVDFWD-   42 (179)
T ss_dssp             CCCEEEECCTTCCGGGGHHHHHHHHHTT---------C-----------------------------CGGGEEECCCSC-
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHcC---------C-----------------------------eEEEEecCCccc-
Confidence            5699999999999999999998866542         1                             111122222111 


Q ss_pred             cchhhHHHHHHHHHHHHHHHHHHcccchhhhhhcccccCCCCCceEEEEEEchhHHHHHHHHhCCCcccccccEEEEecC
Q 001306          163 MDGQILEEHAEYVVYAIHRILDQYRESQDAREREGAATSGSLPKSVILVGHSVGGFVARAAIIHPLLRKSAVETVLTLSS  242 (1104)
Q Consensus       163 f~G~tL~dQAeyVn~aI~~ILslY~~~~~~r~~~~~~~~~~~p~sViLVGHSMGGiVAr~~l~~P~~~~~~V~~IITLsT  242 (1104)
                       ......+.++.+.+.|+.+++.+.                 .++++||||||||.+|+.++.... .+++|+++|+|++
T Consensus        43 -~~~~~~~~~~~l~~~i~~~~~~~~-----------------~~~v~lvGHSmGG~va~~~~~~~~-~~~~V~~~V~l~~  103 (179)
T d1ispa_          43 -KTGTNYNNGPVLSRFVQKVLDETG-----------------AKKVDIVAHSMGGANTLYYIKNLD-GGNKVANVVTLGG  103 (179)
T ss_dssp             -TTCCHHHHHHHHHHHHHHHHHHHC-----------------CSCEEEEEETHHHHHHHHHHHHSS-GGGTEEEEEEESC
T ss_pred             -cccccchhhhhHHHHHHHHHHhcC-----------------CceEEEEeecCcCHHHHHHHHHcC-CchhhCEEEEECC
Confidence             112344566667777777765432                 468999999999999999886322 2567999999999


Q ss_pred             CCCCCCcccCcchHHHHHHHHHHHHhcccCCCCCCCccccCCCCCcceEEEEecCCCCccccCCCccccCCCCCCcceee
Q 001306          243 PHQSPPLALQPSLGNYFARVNDEWRKGYEAHTTPTGHHVSNSRLSHVVVVSISAGYHDYQVRSKIESLDGIVPPTHGFMI  322 (1104)
Q Consensus       243 PH~~pPvafD~~l~~fY~~vn~~W~~~~~~~~s~~~~~~~~~~l~~V~LVSIaGG~rD~~VPsdlTsl~~lvP~t~g~tV  322 (1104)
                      ||.+.+...                  +.          ......++++.+|.|. .|.+||...+.+++          
T Consensus       104 p~~g~~~~~------------------l~----------~~~~~~~~~~~~i~~~-~D~~v~~~~~~l~~----------  144 (179)
T d1ispa_         104 ANRLTTGKA------------------LP----------GTDPNQKILYTSIYSS-ADMIVMNYLSRLDG----------  144 (179)
T ss_dssp             CGGGTCSBC------------------CC----------CSCTTCCCEEEEEEET-TCSSSCHHHHCCBT----------
T ss_pred             CCCCchhhh------------------cC----------CcccccCceEEEEEec-CCcccCchhhcCCC----------
Confidence            998765431                  11          1123347889999886 67788765543321          


Q ss_pred             eecccCce-eecCCCchhhhhHHHHHHHHHHH
Q 001306          323 SSTGMKNV-WLSMEHQAILWCNQLVVQVSHTL  353 (1104)
Q Consensus       323 ~TTsIPgV-Wvs~DH~aIVWC~QLv~~IAraL  353 (1104)
                          ..++ ...+.|.+++++.++.+.|.++|
T Consensus       145 ----~~~~~~~~~~H~~l~~~~~v~~~i~~~L  172 (179)
T d1ispa_         145 ----ARNVQIHGVGHIGLLYSSQVNSLIKEGL  172 (179)
T ss_dssp             ----SEEEEESSCCTGGGGGCHHHHHHHHHHH
T ss_pred             ----ceEEEECCCCchhhccCHHHHHHHHHHH
Confidence                1222 23468999999999999988886



>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure