Citrus Sinensis ID: 001307


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100---
MAAESTHLQQSQLAVILGPDSAPFETLISHLMSTSNEQRSEAELLFNLCKQQDPDSLTLKLAHLLQRSPHPEARAMAAVLLRKLLTRDDSFLWPRLSLHTQSSLKSMLLQSIQLESAKSISKKLCDTVSELASNILPENGWPELLPFMFQCVSSDSVKLQESAFLIFAQLSQYIGDTLTPHLKHLHAVFLNCLTNSNNPDVKIAALNAVINFIQCLTSSADRDRFQDLLPLMMRTLTESLNNGNEATAQEALELLIELAGTEPRFLRRQLVDVVGSMLQIAEAESLEEGTRHLAIEFVITLAEARERAPGMMRKLPQFINRLFAILMSMLLDIEDDPLWHSAETEDEDAGESSNYSVGQECLDRLAIALGGNTIVPVASEQLPAYLAAPEWQKHHAALIALAQIAEGCAKVMVKNLEQVLSMVLNSFRDPHPRVRWAAINAIGQLSTDLGPDLQNQFHPQVLPALAGAMDDFQNPRVQAHAASAVLNFSENCTPEILTPYLDGIVSKLLVLLQNGKQMVQEGALTALASVADSSQEHFQKYYDAVMPFLKAILVNATDKSNRMLRAKSMECISLVGMAVGKDKFRDDAKQVMEVLMSLQGSQMETDDPTTSYMLQAWARLCKCLGQDFLPYMSVVMPPLLQSAQLKPDVTITSADSDNEIEDSDDDSMETITLGDKRIGIKTSVLEEKATACNMLCCYADELKEGFFPWIDQVAPTLVPLLKFYFHEEVRKAAVSAMPELLRSAKLAIEKGLAPGRNESYVKQLSDFIIPALVEALHKEPDTEICASMLDSLNECIQISGPLLDEGQVRSIVDEIKQVITASSSRKRERAERAKAEDFDAEESELIKEENEQEEEVFDQVGEILGTLIKTFKAAFLPFFDELSSYLTPMWGKDKTAEERRIAICIFDDVAEQCREAALKYYETYLPFLLEAAVYGLGVCAEFGGSVVKPLVGEALSRLNVVIRHPNALQPENLMAYDNAVSALGKICQFHRDSIDAAQVVPAWLNCLPIKGDLIEAKIVHEQLCSMVERSDSDLLGPNHQYLPKIVSVFAEILCGKDLATEQTLSRIVNLLKQLQQTLPPATLASTWSSLQPQQQLALQSILS
cccccHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHc
**************VIL*PDSAPFETLISHLMSTSNEQRSEAELLFNLCKQQDPDSLTLKLAHLLQRSPHPEARAMAAVLLRKLLTRDDSFLWPRLSLHTQSSLKSMLLQSIQLESAKSISKKLCDTVSELASNILPENGWPELLPFMFQCVSSDSVKLQESAFLIFAQLSQYIGDTLTPHLKHLHAVFLNCLTNSNNPDVKIAALNAVINFIQCLTSSADRDRFQDLLPLMMRTLTESLNNGNEATAQEALELLIELAGTEPRFLRRQLVDVVGSMLQIAEAESLEEGTRHLAIEFVITLAEARERAPGMMRKLPQFINRLFAILMSMLLDIEDDPLWHSA********ESSNYSVGQECLDRLAIALGGNTIVPVASEQLPAYLAAPEWQKHHAALIALAQIAEGCAKVMVKNLEQVLSMVLNSFRDPHPRVRWAAINAIGQLSTDLGPDLQNQFHPQVLPALAGAMDDFQNPRVQAHAASAVLNFSENCTPEILTPYLDGIVSKLLVLLQNGKQMVQEGALTALASVADSSQEHFQKYYDAVMPFLKAILVNATDKSNRMLRAKSMECISLVGMAVGKDKFRDDAKQVMEVLMSLQGSQME*DDPTTSYMLQAWARLCKCLGQDFLPYMSVVMPPLLQSAQLKPDVTITSADSDNEIEDSDDDSMETITLGDKRIGIKTSVLEEKATACNMLCCYADELKEGFFPWIDQVAPTLVPLLKFYFHEEVRKAAVSAMPELLRSAKLAIEKGLAPGRNESYVKQLSDFIIPALVEALHKEPDTEICASMLDSLNECIQISGPLLDEGQVRSIVDEIKQVITASSSRKRERAERAK*EDFDAEESELIKEENEQEEEVFDQVGEILGTLIKTFKAAFLPFFDELSSYLTPMWGKDKTAEERRIAICIFDDVAEQCREAALKYYETYLPFLLEAAVYGLGVCAEFGGSVVKPLVGEALSRLNVVIRHPNALQPENLMAYDNAVSALGKICQFHRDSIDAAQVVPAWLNCLPIKGDLIEAKIVHEQLCSMVERSDSDLLGPNHQYLPKIVSVFAEILCGKDLATEQTLSRIVNLLKQLQQTLPPATLASTWSSLQPQQQLALQSILS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAESTHLQQSQLAVILGPDSAPFETLISHLMSTSNEQRSEAELLFNLCKQQDPDSLTLKLAHLLQRSPHPEARAMAAVLLRKLLTRDDSFLWPRLSLHTQSSLKSMLLQSIQLESAKSISKKLCDTVSELASNILPENGWPELLPFMFQCVSSDSVKLQESAFLIFAQLSQYIGDTLTPHLKHLHAVFLNCLTNSNNPDVKIAALNAVINFIQCLTSSADRDRFQDLLPLMMRTLTESLNNGNEATAQEALELLIELAGTEPRFLRRQLVDVVGSMLQIAEAESLEEGTRHLAIEFVITLAEARERAPGMMRKLPQFINRLFAILMSMLLDIEDDPLWHSAETEDEDAGESSNYSVGQECLDRLAIALGGNTIVPVASEQLPAYLAAPEWQKHHAALIALAQIAEGCAKVMVKNLEQVLSMVLNSFRDPHPRVRWAAINAIGQLSTDLGPDLQNQFHPQVLPALAGAMDDFQNPRVQAHAASAVLNFSENCTPEILTPYLDGIVSKLLVLLQNGKQMVQEGALTALASVADSSQEHFQKYYDAVMPFLKAILVNATDKSNRMLRAKSMECISLVGMAVGKDKFRDDAKQVMEVLMSLQGSQMETDDPTTSYMLQAWARLCKCLGQDFLPYMSVVMPPLLQSAQLKPDVTITSADSDNEIEDSDDDSMETITLGDKRIGIKTSVLEEKATACNMLCCYADELKEGFFPWIDQVAPTLVPLLKFYFHEEVRKAAVSAMPELLRSAKLAIEKGLAPGRNESYVKQLSDFIIPALVEALHKEPDTEICASMLDSLNECIQISGPLLDEGQVRSIVDEIKQVITASSSRKRERAERAKxxxxxxxxxxxxxxxxxxxxxVFDQVGEILGTLIKTFKAAFLPFFDELSSYLTPMWGKDKTAEERRIAICIFDDVAEQCREAALKYYETYLPFLLEAAVYGLGVCAEFGGSVVKPLVGEALSRLNVVIRHPNALQPENLMAYDNAVSALGKICQFHRDSIDAAQVVPAWLNCLPIKGDLIEAKIVHEQLCSMVERSDSDLLGPNHQYLPKIVSVFAEILCGKDLATEQTLSRIVNLLKQLQQTLPPATLASTWSSLQPQQQLALQSILS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Importin-5 Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev.probableO00410
Importin subunit beta-3 Involved in the nuclear import of cdc25 and mcs1.probableO74476
Importin-5 Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A (By similarity). In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones.probableQ8BKC5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B3U, chain A
Confidence level:very confident
Coverage over the Query: 106-333,351-645,666-667,685-744,757-795
View the alignment between query and template
View the model in PyMOL
Template: 1WA5, chain B
Confidence level:very confident
Coverage over the Query: 58-321,361-533
View the alignment between query and template
View the model in PyMOL
Template: 1B3U, chain A
Confidence level:very confident
Coverage over the Query: 19-333,351-642
View the alignment between query and template
View the model in PyMOL
Template: 4FDD, chain A
Confidence level:very confident
Coverage over the Query: 22-565,612-644,723-724,740-744,774-779,835-840,852-1103
View the alignment between query and template
View the model in PyMOL
Template: 1QGR, chain A
Confidence level:very confident
Coverage over the Query: 23-335,346-616,695-745,759-821,835-943
View the alignment between query and template
View the model in PyMOL
Template: 2X1G, chain F
Confidence level:confident
Coverage over the Query: 152-649,688-822,836,852-924,951-1098
View the alignment between query and template
View the model in PyMOL
Template: 3OQS, chain A
Confidence level:probable
Coverage over the Query: 361-559
View the alignment between query and template
View the model in PyMOL