Citrus Sinensis ID: 001328


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------110
MHIKQVIIEGFKSYREQIATEPFSPQVNCVVGANGSGKTNFFHAIRFVLSDIFQNLRSEDRHALLHEGAGHQVLSAFVEIVFDNSDNRIPVDKEEVRLRRTIGLKKDEYFLDGKHITKTEVMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLKEIGGTRVYEERRRESLKIMQDTGNKRQQIIQVVKYLDERLKELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDARQKLLEVDDTRTRFSDESAKMYNSLLDAQEKSKDSDKRFKDLMKEVQTLNKEKEAIEKRLTEAIKNQTAFELDVKDIQERISGNSQARDDAKKQLRSLLEEIDDSSKELDKANTLYENKCIEEKKITKDIMEREKQLSILYQKQGRATQFSSKDARDKWLQKEIDDLERVHSSNLKQDQKLQEEIQRLKGDLKERDEYIESRKREIAYLESSISQSREGFNNHKTQRDKMQDERKSLWVKESELCAEIDKLKAEVEKAEKSLDHATPGDVRRGLNSIRRICREYKIDGVYGPIIELLDCDEKFFTAVEVTAGNSLFHVVVDNDETSTKIIRHLNSLKGGRVTFIPLNRVKAPRVTYPKSNDVIPLLDRLEFSPNFKPAFAQVFARTVICRDLDVCTRVARTDGLDCITLEGDQVSKKGGMTGGFYDYRRSKLKFMNIIMRNTKTINAREEEVEKLISQLDQKITEHVTEQQKTDAKRAHDKSELEQLKQDIANANKQKQIISKALENKEKSLADVRTQLDQLEASMAMKQAEMNTDLIDHLSLDEKNLLSRLNPEITELKEKLITCRTDRIEYETRKAELETNLTTNLMRRKQELEALISSAENDVMLSEAESKKQELADAKSFVEDARQELKRVSDSIVQLTKELNKIKDEKTKLKTLEDNYERKLQDDARELEQLLSRRNILLAKQEEYSKKIRELGPLSSDAFDTYKRKGVKELLKMLHRCNEQLQQFSHVNKKALDQYVNFTEQREELQRRQAELDAGDEKIKELISVLDQRKDESIERTFKGVARHFREVFSELVQGGHGHLVMMKKKDGDHGDDDDDDGPRESDVEGRVEKYIGVKVKACTSVKMNSFAFIKIELLNI
ccEEEEEEcccccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEcccccccccccEEEEEEEEEccccEEEEccccccHHHHHHHHHHccccccccccEEccccHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccCEEEccccccccHHHHHHHHHHHccccccEEEccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHHcccEEEEccHHHHHHHHHcccccEEEccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHccc
MHIKQVIIEGFKSYREQIATEPFSPQVNCVVGANGSGKTNFFHAIRFVLSDIFQNLRSEDRHALLHEGAGHQVLSAFVEIVFDNSDNRIPVDKEEVRLRRTIGLKKDEYFLDGKHITKTEVMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLKEIGGTRVYEERRRESLKIMQDTGNKRQQIIQVVKYLDERLKELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDARQ*****************************************************************************************************************YENKCIE***I************IL*************************************************************************************************WV****LCAEI*********************VRRGLNSIRRICREYKIDGVYGPIIELLDCDEKFFTAVEVTAGNSLFHVVVDNDETSTKIIRHLNSLKGGRVTFIPLNRVKAPRVTYPKSNDVIPLLDRLEFSPNFKPAFAQVFARTVICRDLDVCTRVARTDGLDCITLEGDQVSKKGGMTGGFYDYRRSKLKFMNIIMRNTKTIN*******************************************************************************************IDHLSL**KNLLSRLNPEITELKEKLITCRTDRIEYETR**********************************************************************************************************ILL***EEYSKKIRELGPLSSDAFDTYKRKGVKELLKMLHRCNEQLQQFSHVNKKALDQYVNFTEQREELQRRQAELDAGDEKIKELISVLDQRKDESIERTFKGVARHFREVFSELVQGGHGHLVMMKKK*********************VEKYIGVKVKACTSVKMNSFAFIKIELLNI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHIKQVIIEGFKSYREQIATEPFSPQVNCVVGANGSGKTNFFHAIRFVLSDIFQNLRSEDRHALLHEGAGHQVLSAFVEIVFDNSDNRIPVDKEEVRLRRTIGLKKDEYFLDGKHITKTEVMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLKEIGGTRVYEERRRESLKIMQDTGNKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDKQRKSLEYTIYDKELHDARQKLLEVDDTRTRFSDESAKMYNSLLDAQEKSKDSDKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxQTAFELDVKDIQERISGNSQAxxxxxxxxxxxxxxxxxxxxxxxxxxxxYENKCIEEKKITKDIMEREKQLSILYQKQGRATQFSSKDARDKWLQKEIDDLERVHSSNLKQDQKLQEEIQRLKGDLKERDEYIESRKREIAYLESSISQSREGFNNHKTQRDKMQDERKSLWVKxxxxxxxxxxxxxxxxxxxxxLDHATPGDVRRGLNSIRRICREYKIDGVYGPIIELLDCDEKFFTAVEVTAGNSLFHVVVDNDETSTKIIRHLNSLKGGRVTFIPLNRVKAPRVTYPKSNDVIPLLDRLEFSPNFKPAFAQVFARTVICRDLDVCTRVARTDGLDCITLEGDQVSKKGGMTGGFYDYRRSKLKFMNIIMRNTKTxxxxxxxxxxxxxxxxxxxxxHVTEQQKTDAKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMNTDLIDHLSLDEKNLLSRLNPEITELKEKLITCRTDRIEYETRKAELETNLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRNILLAKQEEYSKKIRELGPLSSDAFDTYKRKGVKELLKMLHRCNEQLQQFSHVxxxxxxxxxxxxxxxxxxxxxQAELDAGDEKIKELISVLDQRKDESIERTFKGVARHFREVFSELVQGGHGHLVMMKKKDGDHGDDDDDDGPRESDVEGRVEKYIGVKVKACTSVKMNSFAFIKIELLNI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Structural maintenance of chromosomes protein 3 Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement (By similarity). Essential protein plant viability. Required for chromosome segregation (e.g. sister chromatid alignment) and cell division during embryogenesis.confidentQ56YN8
Structural maintenance of chromosomes protein 3 Involved in chromosome cohesion during cell cycle and in DNA repair. Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate.probableP47037
Chromosome segregation protein sudA Involved in chromosome segregation in mitosis.probableQ00737

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 121-148
View the alignment between query and template
View the model in PyMOL
Template: 1W1W, chain A
Confidence level:very confident
Coverage over the Query: 1-159
View the alignment between query and template
View the model in PyMOL
Template: 2WD5, chain B
Confidence level:very confident
Coverage over the Query: 521-677
View the alignment between query and template
View the model in PyMOL
Template: 1W1W, chain A
Confidence level:very confident
Coverage over the Query: 984-1006,1019-1043,1077-1087
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:confident
Coverage over the Query: 313-378
View the alignment between query and template
View the model in PyMOL
Template: 2EFR, chain A
Confidence level:probable
Coverage over the Query: 273-347
View the alignment between query and template
View the model in PyMOL
Template: 2B9C, chain A
Confidence level:probable
Coverage over the Query: 245-252
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 272-354,413-497
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 272-354,413-497
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 272-354,413-497
View the alignment between query and template
View the model in PyMOL
Template: 2W00, chain A
Confidence level:probable
Coverage over the Query: 716-893
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 272-354,413-497
View the alignment between query and template
View the model in PyMOL