Citrus Sinensis ID: 001328
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1099 | 2.2.26 [Sep-21-2011] | |||||||
| Q56YN8 | 1204 | Structural maintenance of | yes | no | 0.982 | 0.897 | 0.708 | 0.0 | |
| Q9CW03 | 1217 | Structural maintenance of | yes | no | 0.968 | 0.874 | 0.386 | 0.0 | |
| Q5R4K5 | 1217 | Structural maintenance of | yes | no | 0.968 | 0.874 | 0.387 | 0.0 | |
| Q9UQE7 | 1217 | Structural maintenance of | yes | no | 0.968 | 0.874 | 0.387 | 0.0 | |
| P97690 | 1191 | Structural maintenance of | yes | no | 0.968 | 0.893 | 0.385 | 0.0 | |
| O93309 | 1209 | Structural maintenance of | N/A | no | 0.972 | 0.884 | 0.397 | 0.0 | |
| O97594 | 1218 | Structural maintenance of | yes | no | 0.934 | 0.843 | 0.395 | 0.0 | |
| Q00737 | 1215 | Chromosome segregation pr | yes | no | 0.973 | 0.880 | 0.381 | 0.0 | |
| O42649 | 1194 | Structural maintenance of | yes | no | 0.970 | 0.893 | 0.371 | 0.0 | |
| Q552D9 | 1437 | Structural maintenance of | yes | no | 0.950 | 0.727 | 0.338 | 1e-146 |
| >sp|Q56YN8|SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana GN=SMC3 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 1497 bits (3876), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 769/1085 (70%), Positives = 917/1085 (84%), Gaps = 5/1085 (0%)
Query: 1 MHIKQVIIEGFKSYREQIATEPFSPQVNCVVGANGSGKTNFFHAIRFVLSDIFQNLRSED 60
M IKQVIIEGFKSY+EQ+ATE FS +VNCVVGANGSGK+NFFHAIRFVLSDI+QNLRSED
Sbjct: 1 MFIKQVIIEGFKSYKEQVATEEFSNKVNCVVGANGSGKSNFFHAIRFVLSDIYQNLRSED 60
Query: 61 RHALLHEGAGHQVLSAFVEIVFDNSDNRIPVDKEEVRLRRTIGLKKDEYFLDGKHITKTE 120
RHALLHEGAGHQV+SAFVEIVFDNSDNR PVDKEE+RLRRT+GLKKD+YFLDGKHITK E
Sbjct: 61 RHALLHEGAGHQVVSAFVEIVFDNSDNRFPVDKEEIRLRRTVGLKKDDYFLDGKHITKGE 120
Query: 121 VMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLKEIGGTRVYEERRRESLKIMQ 180
VMNLLESAGFSR+NPYYVVQQGKIASLTLMKD ERLDLLKEIGGTRVYEERRRESL+IMQ
Sbjct: 121 VMNLLESAGFSRANPYYVVQQGKIASLTLMKDIERLDLLKEIGGTRVYEERRRESLRIMQ 180
Query: 181 DTGNKRQQIIQVVKYLDERLKELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDARQKLL 240
+TGNKR+QII+VV YLDERL+ELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDAR+KL
Sbjct: 181 ETGNKRKQIIEVVHYLDERLRELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDAREKLE 240
Query: 241 EVDDTRTRFSDESAKMYNSLLDAQEKSKDSDKRFKDLMKEVQTLNKEKEAIEKRLTEAIK 300
+V+ RT+ S+ES KMY+ + AQ+ SK D+ K+L KE+QTL KEKE +E + T+A+K
Sbjct: 241 QVEVARTKASEESTKMYDRVEKAQDDSKSLDESLKELTKELQTLYKEKETVEAQQTKALK 300
Query: 301 NQTAFELDVKDIQERISGNSQARDDAKKQLRSLLEEIDDSSKELDKANTLYENKCIEEKK 360
+T ELDVKD Q+RI+GN Q+++DA +QL ++ E+ DS +EL+ LYE++ +E +
Sbjct: 301 KKTKLELDVKDFQDRITGNIQSKNDALEQLNTVEREMQDSLRELEAIKPLYESQVDKENQ 360
Query: 361 ITKDIMEREKQLSILYQKQGRATQFSSKDARDKWLQKEIDDLERVHSSNLKQDQKLQEEI 420
+K I E EK LSILYQKQGRATQFS+K ARDKWL+KEI+DL+RV SN Q+QKLQ+EI
Sbjct: 361 TSKRINELEKTLSILYQKQGRATQFSNKAARDKWLRKEIEDLKRVLDSNTVQEQKLQDEI 420
Query: 421 QRLKGDLKERDEYIESRKREIAYLESSISQSREGFNNHKTQRDKMQDERKSLWVKESELC 480
RL DL ERDE+I+ + EI LES IS+S E FN K +RD+ Q +RK W +ES+L
Sbjct: 421 LRLNTDLTERDEHIKKHEVEIGELESRISKSHELFNTKKRERDEEQRKRKEKWGEESQLS 480
Query: 481 AEIDKLKAEVEKAEKSLDHATPGDVRRGLNSIRRICREYKIDGVYGPIIELLDCDEKFFT 540
+EIDKLK E+E+A+K+LDHATPGDVRRGLNSIRRIC +Y+I+GV+GP++EL+DCDEKFFT
Sbjct: 481 SEIDKLKTELERAKKNLDHATPGDVRRGLNSIRRICADYRINGVFGPLVELVDCDEKFFT 540
Query: 541 AVEVTAGNSLFHVVVDNDETSTKIIRHLNSLKGGRVTFIPLNRVKAPRVTYPKSNDVIPL 600
AVEVTAGNSLF+VVV+ND+ STKIIRHLNSLKGGRVTF+PLNR+KAPRV YPK +D IPL
Sbjct: 541 AVEVTAGNSLFNVVVENDDISTKIIRHLNSLKGGRVTFLPLNRIKAPRVNYPKDSDAIPL 600
Query: 601 LDRLEFSPNFKPAFAQVFARTVICRDLDVCTRVARTDGLDCITLEGDQVSKKGGMTGGFY 660
L +L+F F+PA QVF RTV+CRDL+V TRVA+ D LDCIT+EGDQVS+KGGMTGGFY
Sbjct: 601 LKKLKFDSKFEPALGQVFGRTVVCRDLNVATRVAKNDDLDCITMEGDQVSRKGGMTGGFY 660
Query: 661 DYRRSKLKFMNIIMRNTKTINAREEEVEKLISQL---DQKITEHVTEQQKTDAKRAHDKS 717
D+RRSKL+FMNIIM+NTK+IN +E+E+E + QL DQ+IT+ VTEQQ+ +A K
Sbjct: 661 DHRRSKLRFMNIIMQNTKSINEKEKELEDVRRQLQVIDQQITQLVTEQQRLEADWTLCKL 720
Query: 718 ELEQLKQDIANANKQKQIISKALENKEKSLADVRTQLDQLEASMAMKQAEMNTDLIDHLS 777
++EQLKQ+IANANKQK I KA+E KEK L D+RT++DQ+ +SM+MK+AEM T+L+DHL+
Sbjct: 721 QVEQLKQEIANANKQKHAIHKAIEYKEKLLGDIRTRIDQVRSSMSMKEAEMGTELVDHLT 780
Query: 778 LDEKNLLSRLNPEITELKEKLITCRTDRIEYETRKAELETNLTTNLMRRKQELEALISSA 837
+E+ LS+LNPEI +LKEK + DRIE ETRKAELE N+ TNL RR EL+A I+S
Sbjct: 781 PEEREQLSKLNPEIKDLKEKKFAYQADRIERETRKAELEANIATNLKRRITELQATIASI 840
Query: 838 ENDVMLSEAESKKQELADAKSFVEDARQELKRVSDSIVQLTKELNKIKDEKTKLKTLEDN 897
++D + S A +K+QEL DAK V +A +ELK V DSI + TK++ KIKDEK KLKTLED+
Sbjct: 841 DDDSLPSSAGTKEQELDDAKLSVNEAAKELKSVCDSIDEKTKQIKKIKDEKAKLKTLEDD 900
Query: 898 YERKLQDDARELEQLLSRRNILLAKQEEYSKKIRELGPLSSDAFDTYKRKGVKELLKMLH 957
+ LQD ++LE+L S RN LLAKQ+EY+KKIR LGPLSSDAFDTYKRK +KEL KMLH
Sbjct: 901 CKGTLQDLDKKLEELFSLRNTLLAKQDEYTKKIRGLGPLSSDAFDTYKRKNIKELQKMLH 960
Query: 958 RCNEQLQQFSHVNKKALDQYVNFTEQREELQRRQAELDAGDEKIKELISVLDQRKDESIE 1017
RC+EQLQQFSHVNKKALDQYVNFTEQREELQ RQAELDAGDEKIKELI+VLDQRKDESIE
Sbjct: 961 RCSEQLQQFSHVNKKALDQYVNFTEQREELQNRQAELDAGDEKIKELITVLDQRKDESIE 1020
Query: 1018 RTFKGVARHFREVFSELVQGGHGHLVMMKKK--DGDHGDDDDDDGPRESDVEGRVEKYIG 1075
RTFKGVA HFR+VFSELVQ G+G+L++MKKK D D DDDDDDG RE+ EGRVEKYIG
Sbjct: 1021 RTFKGVAHHFRDVFSELVQDGYGNLIIMKKKDLDNDDEDDDDDDGGREAVTEGRVEKYIG 1080
Query: 1076 VKVKA 1080
VKVK
Sbjct: 1081 VKVKV 1085
|
Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement (By similarity). Essential protein plant viability. Required for chromosome segregation (e.g. sister chromatid alignment) and cell division during embryogenesis. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9CW03|SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus GN=Smc3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5R4K5|SMC3_PONAB Structural maintenance of chromosomes protein 3 OS=Pongo abelii GN=SMC3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus GN=Smc3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O93309|SMC3_XENLA Structural maintenance of chromosomes protein 3 OS=Xenopus laevis GN=smc3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes protein 3 OS=Bos taurus GN=SMC3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q00737|SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sudA PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|O42649|SMC3_SCHPO Structural maintenance of chromosomes protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q552D9|SMC3_DICDI Structural maintenance of chromosome protein 3 OS=Dictyostelium discoideum GN=smc3 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1099 | ||||||
| 255577566 | 1246 | Structural maintenance of chromosome, pu | 0.982 | 0.866 | 0.824 | 0.0 | |
| 225464350 | 1204 | PREDICTED: structural maintenance of chr | 0.983 | 0.897 | 0.806 | 0.0 | |
| 449448840 | 1207 | PREDICTED: structural maintenance of chr | 0.983 | 0.895 | 0.788 | 0.0 | |
| 296083795 | 1205 | unnamed protein product [Vitis vinifera] | 0.983 | 0.897 | 0.801 | 0.0 | |
| 224102947 | 1205 | condensin complex components subunit [Po | 0.977 | 0.891 | 0.813 | 0.0 | |
| 356554411 | 1204 | PREDICTED: structural maintenance of chr | 0.982 | 0.897 | 0.764 | 0.0 | |
| 356501306 | 1203 | PREDICTED: structural maintenance of chr | 0.982 | 0.897 | 0.761 | 0.0 | |
| 449521916 | 1117 | PREDICTED: structural maintenance of chr | 0.901 | 0.887 | 0.775 | 0.0 | |
| 23476966 | 1205 | SMC3 protein [Arabidopsis thaliana] | 0.982 | 0.896 | 0.707 | 0.0 | |
| 145329965 | 1204 | structural maintenance of chromosome 3 ( | 0.982 | 0.897 | 0.708 | 0.0 |
| >gi|255577566|ref|XP_002529661.1| Structural maintenance of chromosome, putative [Ricinus communis] gi|223530887|gb|EEF32748.1| Structural maintenance of chromosome, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1784 bits (4621), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 900/1092 (82%), Positives = 977/1092 (89%), Gaps = 12/1092 (1%)
Query: 1 MHIKQVIIEGFKSYREQIATEPFSPQVNCVVGANGSGKTNFFHAIRFVLSDIFQNLRSED 60
M+IKQVIIEGFKSYREQIATE FSP++NCVVGANGSGKTNFFHAIRFVLSD+FQNLRSED
Sbjct: 1 MYIKQVIIEGFKSYREQIATENFSPKINCVVGANGSGKTNFFHAIRFVLSDLFQNLRSED 60
Query: 61 RHALLHEGAGHQVLSAFVEIVFDNSDNRIPVDKEEVRLRRTIGLKKDEYFLDGKHITKTE 120
RHALLHEGAGHQVLSAFVEIVFDNSDNRIPVDKEEVRLRRTIGLKKDEYFLDGKHITKTE
Sbjct: 61 RHALLHEGAGHQVLSAFVEIVFDNSDNRIPVDKEEVRLRRTIGLKKDEYFLDGKHITKTE 120
Query: 121 VMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLKEIGGTRVYEERRRESLKIMQ 180
VMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLKEIGGTRVYEERRRESLKIMQ
Sbjct: 121 VMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLKEIGGTRVYEERRRESLKIMQ 180
Query: 181 DTGNKRQQIIQVVKYLDERLKELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDARQKLL 240
+TGNKR+QIIQVV+YLDERL+ELDEEKEELRKYQQLD+QRKSLE+TIYDKELHDARQKL
Sbjct: 181 ETGNKRKQIIQVVQYLDERLRELDEEKEELRKYQQLDRQRKSLEFTIYDKELHDARQKLG 240
Query: 241 EVDDTRTRFSDESAKMYNSLLDAQEKSKDSDKRFKDLMKEVQTLNKEKEAIEKRLTEAIK 300
EV + R R S+ SAKMYN +LDA E+SKD +K KDL KEVQ LNKEKE +EKR TEAIK
Sbjct: 241 EVKEARNRVSETSAKMYNDVLDAHERSKDLEKMLKDLTKEVQGLNKEKEVVEKRQTEAIK 300
Query: 301 NQTAFELDVKDIQERISGNSQARDDAKKQLRSLLEEIDDSSKELDKANTLYENKCIEEKK 360
QT ELDVKD+QERISGN+QA++DA KQL L EI DS +ELDK LYEN+ I+EK+
Sbjct: 301 KQTELELDVKDMQERISGNAQAKEDAMKQLDFLQREIQDSMEELDKITPLYENQAIKEKE 360
Query: 361 ITKDIMEREKQLSILYQKQGRATQFSSKDARDKWLQKEIDDLERVHSSNLKQDQKLQEEI 420
I K IMEREKQLSILYQKQGRATQFSSK ARDKWLQKEIDDL+RV SSNL Q+QKLQ+EI
Sbjct: 361 IAKGIMEREKQLSILYQKQGRATQFSSKAARDKWLQKEIDDLQRVLSSNLAQEQKLQDEI 420
Query: 421 QRLKGDLKERDEYIESRKREIAYLESSISQSREGFNNHKTQRDKMQDERKSLWVKESELC 480
+L DL+ERD YIE+RK EIA ES I QSREGFN+H+ QRDK+QDERKSLW KES L
Sbjct: 421 HKLNVDLEERDAYIENRKAEIAVSESVIFQSREGFNSHRAQRDKLQDERKSLWAKESALI 480
Query: 481 AEIDKLKAEVEKAEKSLDHATPGDVRRGLNSIRRICREYKIDGVYGPIIELLDCDEKFFT 540
AEIDKL+ EVEKAEKSLDHATPGDVRRGLNSIRRICR+YKI+GV+GPIIEL+DCDEKFFT
Sbjct: 481 AEIDKLRTEVEKAEKSLDHATPGDVRRGLNSIRRICRDYKINGVFGPIIELIDCDEKFFT 540
Query: 541 AVEVTAGNSLFHVVVDNDETSTKIIRHLNSLKGGRVTFIPLNRVKAPRVTYPKSNDVIPL 600
AVEVTAGNSLFHVVV+NDE ST+IIRHLNS KGGRVTFIPLNRVKAP V YP+S+DVIPL
Sbjct: 541 AVEVTAGNSLFHVVVENDEISTQIIRHLNSSKGGRVTFIPLNRVKAPHVHYPQSSDVIPL 600
Query: 601 LDRLEFSPNFKPAFAQVFARTVICRDLDVCTRVARTDGLDCITLEGDQVSKKGGMTGGFY 660
L +L+FS NF PAFAQVFARTVICRDLDV TRVAR DGLDCITLEGDQVSKKGGMTGGFY
Sbjct: 601 LKKLKFSSNFTPAFAQVFARTVICRDLDVATRVARADGLDCITLEGDQVSKKGGMTGGFY 660
Query: 661 DYRRSKLKFMNIIMRNTKTINAREEEVEKLISQLDQ-----------KITEHVTEQQKTD 709
D+RRSKLKFMNIIM+NT++IN +EEE+EK+ S L KITE VTEQQK D
Sbjct: 661 DHRRSKLKFMNIIMQNTRSINMKEEELEKVRSMLQDILFFWSLIYLLKITEQVTEQQKID 720
Query: 710 AKRAHDKSELEQLKQDIANANKQKQIISKALENKEKSLADVRTQLDQLEASMAMKQAEMN 769
AKRAHDKSELEQLKQDIANA KQKQ ISKAL +K KSLADV+TQ+DQL SMAMKQAEM
Sbjct: 721 AKRAHDKSELEQLKQDIANATKQKQFISKALVSKGKSLADVQTQVDQLRGSMAMKQAEMG 780
Query: 770 TDLIDHLSLDEKNLLSRLNPEITELKEKLITCRTDRIEYETRKAELETNLTTNLMRRKQE 829
T+LIDHL+ +EK+LLSRLNPEI +LKEKLI CRTDRIE ETRKAELETNLTTNL RRKQE
Sbjct: 781 TELIDHLTPEEKDLLSRLNPEIADLKEKLIACRTDRIETETRKAELETNLTTNLKRRKQE 840
Query: 830 LEALISSAENDVMLSEAESKKQELADAKSFVEDARQELKRVSDSIVQLTKELNKIKDEKT 889
LEA+ISSAE D++ EAE K QEL DA+S VE QELKRVSDSI +LTK+L KIKDEKT
Sbjct: 841 LEAVISSAETDILHGEAELKGQELTDARSLVEVTTQELKRVSDSISELTKQLKKIKDEKT 900
Query: 890 KLKTLEDNYERKLQDDARELEQLLSRRNILLAKQEEYSKKIRELGPLSSDAFDTYKRKGV 949
KLK +EDNYER LQ++A+ELEQLLS+RN+L AKQEEYS KIRELGPLSSDAF+TYKRK +
Sbjct: 901 KLKGMEDNYERTLQEEAKELEQLLSKRNVLQAKQEEYSNKIRELGPLSSDAFETYKRKSI 960
Query: 950 KELLKMLHRCNEQLQQFSHVNKKALDQYVNFTEQREELQRRQAELDAGDEKIKELISVLD 1009
KEL KMLHRCNEQLQQFSHVNKKALDQYVNFTEQREELQ+RQAELDAGDEKI+ELISVLD
Sbjct: 961 KELHKMLHRCNEQLQQFSHVNKKALDQYVNFTEQREELQKRQAELDAGDEKIRELISVLD 1020
Query: 1010 QRKDESIERTFKGVARHFREVFSELVQGGHGHLVMM-KKKDGDHGDDDDDDGPRESDVEG 1068
QRKDESIERTFKGVARHFREVFSELVQGGHGHLVMM KK DD DDDGPRE+D+EG
Sbjct: 1021 QRKDESIERTFKGVARHFREVFSELVQGGHGHLVMMKKKDGDHGDDDYDDDGPREADLEG 1080
Query: 1069 RVEKYIGVKVKA 1080
RVEKYIGVKVK
Sbjct: 1081 RVEKYIGVKVKV 1092
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225464350|ref|XP_002273318.1| PREDICTED: structural maintenance of chromosomes protein 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449448840|ref|XP_004142173.1| PREDICTED: structural maintenance of chromosomes protein 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296083795|emb|CBI24012.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224102947|ref|XP_002312865.1| condensin complex components subunit [Populus trichocarpa] gi|222849273|gb|EEE86820.1| condensin complex components subunit [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356554411|ref|XP_003545540.1| PREDICTED: structural maintenance of chromosomes protein 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356501306|ref|XP_003519466.1| PREDICTED: structural maintenance of chromosomes protein 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449521916|ref|XP_004167975.1| PREDICTED: structural maintenance of chromosomes protein 3-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|23476966|emb|CAD43403.2| SMC3 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|145329965|ref|NP_001077968.1| structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6) [Arabidopsis thaliana] gi|145360381|ref|NP_180285.4| structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6) [Arabidopsis thaliana] gi|62319915|dbj|BAD93989.1| putative chromosome associated protein [Arabidopsis thaliana] gi|330252854|gb|AEC07948.1| structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6) [Arabidopsis thaliana] gi|330252855|gb|AEC07949.1| structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6) [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1099 | ||||||
| TAIR|locus:2045159 | 1204 | TTN7 "AT2G27170" [Arabidopsis | 0.981 | 0.896 | 0.673 | 0.0 | |
| MGI|MGI:1339795 | 1217 | Smc3 "structural maintenance o | 0.946 | 0.854 | 0.373 | 9.4e-201 | |
| UNIPROTKB|O93309 | 1209 | smc3 "Structural maintenance o | 0.974 | 0.885 | 0.371 | 1.2e-200 | |
| UNIPROTKB|A7Z065 | 1217 | SMC3 "Structural maintenance o | 0.946 | 0.854 | 0.373 | 1.5e-200 | |
| UNIPROTKB|G3N365 | 1216 | SMC3 "Structural maintenance o | 0.946 | 0.855 | 0.373 | 1.5e-200 | |
| UNIPROTKB|O97594 | 1218 | SMC3 "Structural maintenance o | 0.946 | 0.853 | 0.373 | 1.5e-200 | |
| UNIPROTKB|E2R7T4 | 1217 | SMC3 "Uncharacterized protein" | 0.946 | 0.854 | 0.373 | 1.5e-200 | |
| UNIPROTKB|Q9UQE7 | 1217 | SMC3 "Structural maintenance o | 0.946 | 0.854 | 0.373 | 1.5e-200 | |
| UNIPROTKB|Q5R4K5 | 1217 | SMC3 "Structural maintenance o | 0.946 | 0.854 | 0.373 | 1.5e-200 | |
| UNIPROTKB|D4A1B9 | 1217 | Smc3 "Structural maintenance o | 0.946 | 0.854 | 0.373 | 1.5e-200 |
| TAIR|locus:2045159 TTN7 "AT2G27170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3653 (1291.0 bits), Expect = 0., P = 0.
Identities = 730/1084 (67%), Positives = 877/1084 (80%)
Query: 1 MHIKQVIIEGFKSYREQIATEPFSPQVNCVVGANGSGKTNFFHAIRFVLSDIFQNLRSED 60
M IKQVIIEGFKSY+EQ+ATE FS +VNCVVGANGSGK+NFFHAIRFVLSDI+QNLRSED
Sbjct: 1 MFIKQVIIEGFKSYKEQVATEEFSNKVNCVVGANGSGKSNFFHAIRFVLSDIYQNLRSED 60
Query: 61 RHALLHEGAGHQVLSAFVEIVFDNSDNRIPVDKEEVRLRRTIGLKKDEYFLDGKHITKTE 120
RHALLHEGAGHQV+SAFVEIVFDNSDNR PVDKEE+RLRRT+GLKKD+YFLDGKHITK E
Sbjct: 61 RHALLHEGAGHQVVSAFVEIVFDNSDNRFPVDKEEIRLRRTVGLKKDDYFLDGKHITKGE 120
Query: 121 VMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLKEIGGTRVYEERRRESLKIMQ 180
VMNLLESAGFSR+NPYYVVQQGKIASLTLMKD ERLDLLKEIGGTRVYEERRRESL+IMQ
Sbjct: 121 VMNLLESAGFSRANPYYVVQQGKIASLTLMKDIERLDLLKEIGGTRVYEERRRESLRIMQ 180
Query: 181 DTGNKRQQIIQVVXXXXXXXXXXXXXXXXXXXXQQLDKQRKSLEYTIYDKELHDARQKLL 240
+TGNKR+QII+VV QQLDKQRKSLEYTIYDKELHDAR+KL
Sbjct: 181 ETGNKRKQIIEVVHYLDERLRELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDAREKLE 240
Query: 241 EVDDTRTRFSDESAKMYNSLLDAQEKSKDSDKRFKDLMKEVQTLNKEKEAIEKRLTEAIK 300
+V+ RT+ S+ES KMY+ + AQ+ SK D+ K+L KE+QTL KEKE +E + T+A+K
Sbjct: 241 QVEVARTKASEESTKMYDRVEKAQDDSKSLDESLKELTKELQTLYKEKETVEAQQTKALK 300
Query: 301 NQTAFELDVKDIQERISGNSQARDDAKKQLRSLLEEIDDSSKELDKANTLYENKCIEEKK 360
+T ELDVKD Q+RI+GN Q+++DA +QL ++ E+ DS +EL+ LYE++ +E +
Sbjct: 301 KKTKLELDVKDFQDRITGNIQSKNDALEQLNTVEREMQDSLRELEAIKPLYESQVDKENQ 360
Query: 361 ITKDIMEREKQLSILYQKQGRATQFSSKDARDKWLQKEIDDLERVHSSNLKQDQKLQEEI 420
+K I E EK LSILYQKQGRATQFS+K ARDKWL+KEI+DL+RV SN Q+QKLQ+EI
Sbjct: 361 TSKRINELEKTLSILYQKQGRATQFSNKAARDKWLRKEIEDLKRVLDSNTVQEQKLQDEI 420
Query: 421 QRLKGDLKERDEYIESRKREIAYLESSISQSREGFNNHKTQRDKMQDERKSLWVKESELC 480
RL DL ERDE+I+ + EI LES IS+S E FN K +RD+ Q +RK W +ES+L
Sbjct: 421 LRLNTDLTERDEHIKKHEVEIGELESRISKSHELFNTKKRERDEEQRKRKEKWGEESQLS 480
Query: 481 AEIDKLKAEVEKAEKSLDHATPGDVRRGLNSIRRICREYKIDGVYGPIIELLDCDEKFFT 540
+EIDKLK E+E+A+K+LDHATPGDVRRGLNSIRRIC +Y+I+GV+GP++EL+DCDEKFFT
Sbjct: 481 SEIDKLKTELERAKKNLDHATPGDVRRGLNSIRRICADYRINGVFGPLVELVDCDEKFFT 540
Query: 541 AVEVTAGNSLFHVVVDNDETSTKIIRHLNSLKGGRVTFIPLNRVKAPRVTYPKSNDVIPL 600
AVEVTAGNSLF+VVV+ND+ STKIIRHLNSLKGGRVTF+PLNR+KAPRV YPK +D IPL
Sbjct: 541 AVEVTAGNSLFNVVVENDDISTKIIRHLNSLKGGRVTFLPLNRIKAPRVNYPKDSDAIPL 600
Query: 601 LDRLEFSPNFKPAFAQVFARTVICRDLDVCTRVARTDGLDCITLEGDQVSKKGGMTGGFY 660
L +L+F F+PA QVF RTV+CRDL+V TRVA+ D LDCIT+EGDQVS+KGGMTGGFY
Sbjct: 601 LKKLKFDSKFEPALGQVFGRTVVCRDLNVATRVAKNDDLDCITMEGDQVSRKGGMTGGFY 660
Query: 661 DYRRSKLKFMNIIMRNTKTINAREEEVEKLISQL---DQKITEHVTEQQKTDAKRAHDKS 717
D+RRSKL+FMNIIM+NTK+IN +E+E+E + QL DQ+IT+ VTEQQ+ +A K
Sbjct: 661 DHRRSKLRFMNIIMQNTKSINEKEKELEDVRRQLQVIDQQITQLVTEQQRLEADWTLCKL 720
Query: 718 ELEQLKQDIANANKQKQIISKALENKEKSLADVRTQLDQLEASMAMKQAEMNTDLIDHLS 777
++EQLKQ+IANANKQK I KA+E KEK L D+RT++DQ+ +SM+MK+AEM T+L+DHL+
Sbjct: 721 QVEQLKQEIANANKQKHAIHKAIEYKEKLLGDIRTRIDQVRSSMSMKEAEMGTELVDHLT 780
Query: 778 LDEKNLLSRLNPEITELKEKLITCRTDRIEYETRKAELETNLTTNLMRRKQELEALISSA 837
+E+ LS+LNPEI +LKEK + DRIE ETRKAELE N+ TNL RR EL+A I+S
Sbjct: 781 PEEREQLSKLNPEIKDLKEKKFAYQADRIERETRKAELEANIATNLKRRITELQATIASI 840
Query: 838 ENDVMLSEAESKKQELADAKSFVEDARQELKRVSDSIVQLTKELNKIKDEKTKLKTLEDN 897
++D + S A +K+QEL DAK V +A +ELK V DSI + TK++ KIKDEK KLKTLED+
Sbjct: 841 DDDSLPSSAGTKEQELDDAKLSVNEAAKELKSVCDSIDEKTKQIKKIKDEKAKLKTLEDD 900
Query: 898 YERKLQDDARELEQLLSRRNILLAKQEEYSKKIRELGPLSSDAFDTYKRKGVKELLKMLH 957
+ LQD ++LE+L S RN LLAKQ+EY+KKIR LGPLSSDAFDTYKRK +KEL KMLH
Sbjct: 901 CKGTLQDLDKKLEELFSLRNTLLAKQDEYTKKIRGLGPLSSDAFDTYKRKNIKELQKMLH 960
Query: 958 RCNEQLQQFSHVNKKALDQYVNFTXXXXXXXXXXAELDAGDEKIKELISVLDQRKDESIE 1017
RC+EQLQQFSHVNKKALDQYVNFT AELDAGDEKIKELI+VLDQRKDESIE
Sbjct: 961 RCSEQLQQFSHVNKKALDQYVNFTEQREELQNRQAELDAGDEKIKELITVLDQRKDESIE 1020
Query: 1018 RTFKGVARHFREVFSELVQGGHGHLVMMXXXXXXXXXXXXXXXP--RESDVEGRVEKYIG 1075
RTFKGVA HFR+VFSELVQ G+G+L++M RE+ EGRVEKYIG
Sbjct: 1021 RTFKGVAHHFRDVFSELVQDGYGNLIIMKKKDLDNDDEDDDDDDGGREAVTEGRVEKYIG 1080
Query: 1076 VKVK 1079
VKVK
Sbjct: 1081 VKVK 1084
|
|
| MGI|MGI:1339795 Smc3 "structural maintenance of chromosomes 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O93309 smc3 "Structural maintenance of chromosomes protein 3" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7Z065 SMC3 "Structural maintenance of chromosomes protein 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N365 SMC3 "Structural maintenance of chromosomes protein 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O97594 SMC3 "Structural maintenance of chromosomes protein 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R7T4 SMC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UQE7 SMC3 "Structural maintenance of chromosomes protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R4K5 SMC3 "Structural maintenance of chromosomes protein 3" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A1B9 Smc3 "Structural maintenance of chromosomes protein 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9CW03 | SMC3_MOUSE | No assigned EC number | 0.3863 | 0.9681 | 0.8742 | yes | no |
| Q5R4K5 | SMC3_PONAB | No assigned EC number | 0.3872 | 0.9681 | 0.8742 | yes | no |
| O97594 | SMC3_BOVIN | No assigned EC number | 0.3955 | 0.9344 | 0.8431 | yes | no |
| Q00737 | SUDA_EMENI | No assigned EC number | 0.3812 | 0.9736 | 0.8806 | yes | no |
| Q56YN8 | SMC3_ARATH | No assigned EC number | 0.7087 | 0.9827 | 0.8970 | yes | no |
| Q9UQE7 | SMC3_HUMAN | No assigned EC number | 0.3872 | 0.9681 | 0.8742 | yes | no |
| O42649 | SMC3_SCHPO | No assigned EC number | 0.3719 | 0.9708 | 0.8936 | yes | no |
| P47037 | SMC3_YEAST | No assigned EC number | 0.3123 | 0.9517 | 0.8504 | yes | no |
| P97690 | SMC3_RAT | No assigned EC number | 0.3854 | 0.9681 | 0.8933 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1099 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-125 | |
| cd03272 | 243 | cd03272, ABC_SMC3_euk, ATP-binding cassette domain | 4e-95 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-85 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-70 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-67 | |
| smart00968 | 120 | smart00968, SMC_hinge, SMC proteins Flexible Hinge | 5e-33 | |
| pfam06470 | 117 | pfam06470, SMC_hinge, SMC proteins Flexible Hinge | 5e-30 | |
| cd03273 | 251 | cd03273, ABC_SMC2_euk, ATP-binding cassette domain | 1e-27 | |
| cd03239 | 178 | cd03239, ABC_SMC_head, The SMC head domain belongs | 2e-20 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-15 | |
| cd03275 | 247 | cd03275, ABC_SMC1_euk, ATP-binding cassette domain | 1e-14 | |
| cd03278 | 197 | cd03278, ABC_SMC_barmotin, ATP-binding cassette do | 1e-13 | |
| cd03274 | 212 | cd03274, ABC_SMC4_euk, ATP-binding cassette domain | 4e-11 | |
| pfam13476 | 204 | pfam13476, AAA_23, AAA domain | 1e-08 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-08 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 5e-08 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-07 | |
| TIGR00634 | 563 | TIGR00634, recN, DNA repair protein RecN | 7e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 9e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-05 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-05 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 3e-05 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 3e-05 | |
| PRK00064 | 361 | PRK00064, recF, recombination protein F; Reviewed | 5e-05 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 8e-05 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 9e-05 | |
| COG3206 | 458 | COG3206, GumC, Uncharacterized protein involved in | 1e-04 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 1e-04 | |
| COG1195 | 363 | COG1195, RecF, Recombinational DNA repair ATPase ( | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-04 | |
| TIGR00611 | 365 | TIGR00611, recf, recF protein | 2e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 3e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 5e-04 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 5e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.001 | |
| cd03240 | 204 | cd03240, ABC_Rad50, ATP-binding cassette domain of | 0.001 | |
| COG3593 | 581 | COG3593, COG3593, Predicted ATP-dependent endonucl | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.002 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.002 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.002 | |
| COG4637 | 373 | COG4637, COG4637, Predicted ATPase [General functi | 0.002 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.004 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.004 | |
| COG4717 | 984 | COG4717, COG4717, Uncharacterized conserved protei | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 412 bits (1060), Expect = e-125
Identities = 280/1063 (26%), Positives = 539/1063 (50%), Gaps = 33/1063 (3%)
Query: 1 MHIKQVIIEGFKSYREQIATEPFSPQVNCVVGANGSGKTNFFHAIRFVLSD-IFQNLRSE 59
M++K++ ++GFKS+ + FSP +VG NGSGK+N AIRFVL + +NLR+
Sbjct: 1 MYLKRIELKGFKSFADPT-EINFSPGFTAIVGPNGSGKSNIVDAIRFVLGEQSAKNLRAS 59
Query: 60 DRHALLHEGAGH--QVLSAFVEIVFDNSDNRIPVDKEEVRLRRTIGLKKD-EYFLDGKHI 116
L+ G+G+ A VE+ FDNSDN +P++ EE+ + R I + EY+++G+ +
Sbjct: 60 KMSDLIFAGSGNRKPANYAEVELTFDNSDNTLPLEYEEISVTRRIYRDGESEYYINGEKV 119
Query: 117 TKTEVMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLKEIGGTRVYEERRRESL 176
++ +LL +G + + Y +V QGK+ + K ER L++E G Y+ER+ E+
Sbjct: 120 RLKDIQDLLADSGIGKES-YSIVSQGKVEEIINAKPEERRKLIEEAAGVSKYKERKEEAE 178
Query: 177 KIMQDTGNKRQQIIQVVKYLDERLKELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDAR 236
+ ++ T +++ +++ L+++L++L+ + E+ +YQ+L + + LE + +L + R
Sbjct: 179 RKLERTEENLERLEDLLEELEKQLEKLERQAEKAERYQELKAELRELELALLLAKLKELR 238
Query: 237 QKLLEVDDTRTRFSDESAKMYNSLLDAQEKSKDSDKRFKDLMKEVQTLNKEKEAIEKRLT 296
++L E+++ +R +E ++ QE+ ++++K ++L E++ L +E E +++ L
Sbjct: 239 KELEELEEELSRLEEELEEL-------QEELEEAEKEIEELKSELEELREELEELQEELL 291
Query: 297 EAIKNQTAFELDVKDIQERISGNSQARDDAKKQLRSLLEEIDDSSKELDKANTLYENKCI 356
E + E ++ ++ER+ ++ +++L L E+I+ +EL++ TL E
Sbjct: 292 ELKEEIEELEGEISLLRERLEELENELEELEERLEELKEKIEALKEELEERETLLEELEQ 351
Query: 357 EEKKITKDIMEREKQLSILYQKQGRATQFSSKDARDKWLQKEIDDLERVHSSNLKQDQKL 416
++ + E E++LS L + F + L+ E+ ++ ++ + L
Sbjct: 352 LLAELEEAKEELEEKLSAL--LEELEELFEALREELAELEAELAEIRNELEELKREIESL 409
Query: 417 QEEIQRLKGDLKERDEYIESRKREIAYLESSISQSREGFNNHKTQRDKMQDERKSLWVKE 476
+E ++RL L++ E ++ + E+ L++ + + E + Q ++++D K L +
Sbjct: 410 EERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELEREL 469
Query: 477 SELCAEIDKLKAEVEKAEKSLDHATPGDVRRGLNSIRRICREYKIDGVYGPIIELLDCDE 536
+EL E+ +L+ E+ E LD E + GVYGP+ EL+ E
Sbjct: 470 AELQEELQRLEKELSSLEARLDRLEAEQRASQGVRAVLEALESGLPGVYGPVAELIKVKE 529
Query: 537 KFFTAVEVTAGNSLFHVVVDNDETSTKIIRHLNSLKGGRVTFIPLNRVKAPRVTYPKSND 596
K+ TA+E GN L VVV+N+E + K I L K GR TF+PL+R+K R +
Sbjct: 530 KYETALEAALGNRLQAVVVENEEVAKKAIEFLKENKAGRATFLPLDRIKPLRSLKSDAAP 589
Query: 597 --VIPLLDRLEFSPNFKPAFAQVFARTVICRDLDVCTRVAR--TDGLDCITLEGDQVSKK 652
+ D ++F P ++PA V T++ DL+ R+AR +TL+GD V
Sbjct: 590 GFLGLASDLIDFDPKYEPAVRFVLGDTLVVDDLEQARRLARKLRIKYRIVTLDGDLVEPS 649
Query: 653 GGMTGGFYDYRRSKL--KFMNIIMRNTKTINAREEEVEKLISQLDQKITEHVTEQQKTDA 710
G +TGG + R S + + + + A+ E++E+ + L ++ ++
Sbjct: 650 GSITGGSRNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRR 709
Query: 711 KRAHDKSELEQLKQDIANANKQKQIISKALENKEKSLADVRTQLDQLEASMAMKQAEMNT 770
+ + +LE+LK+++A ++ + + LE E+ L ++ +L++L+ + + E+ +
Sbjct: 710 QLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELES 769
Query: 771 DLIDHLSLDEKNLLSRLNPEITELKEKLITCRTDRIEYETRKAELETNLTTNLMRRKQEL 830
++ K + L + L+E+L + E E R LE L + +R++ L
Sbjct: 770 --LEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLE-QRRERL 826
Query: 831 EALISSAENDVMLSEAESKKQELADAKSFVEDARQELK----RVSDSIVQLTKELNKIKD 886
E I E + + E E K EL + +E +ELK + +L EL ++++
Sbjct: 827 EQEIEELEEE--IEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEE 884
Query: 887 EKTKLKTLEDNYERKLQDDARELEQLLSRRNILLAKQEEYSKKIRELGPLSSDAFDTYKR 946
EK +L+ E +L + E+E+L R L AK E ++ EL + + Y+
Sbjct: 885 EKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEE---ELEEEYED 941
Query: 947 KGVKELLKMLHRCNEQLQQFSHVNKKALDQYVNFTEQREELQRRQAELDAGDEKIKELIS 1006
EL + + R E+++ VN +A+++Y E+ EEL+ ++ +L+ EK+ E+I
Sbjct: 942 TLETELEREIERLEEEIEALGPVNLRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIE 1001
Query: 1007 VLDQRKDESIERTFKGVARHFREVFSELVQGGHGHLVMMKKKD 1049
LD+ K E + TF + +F E+F EL GG L + + D
Sbjct: 1002 ELDKEKRERFKETFDKINENFSEIFKELFGGGTAELELTEPDD 1044
|
Length = 1163 |
| >gnl|CDD|213239 cd03272, ABC_SMC3_euk, ATP-binding cassette domain of eukaryotic SMC3 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|214944 smart00968, SMC_hinge, SMC proteins Flexible Hinge Domain | Back alignment and domain information |
|---|
| >gnl|CDD|219044 pfam06470, SMC_hinge, SMC proteins Flexible Hinge Domain | Back alignment and domain information |
|---|
| >gnl|CDD|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family | Back alignment and domain information |
|---|
| >gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222160 pfam13476, AAA_23, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233065 TIGR00634, recN, DNA repair protein RecN | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|234608 PRK00064, recF, recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225747 COG3206, GumC, Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224116 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233051 TIGR00611, recf, recF protein | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|226121 COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|226984 COG4637, COG4637, Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1099 | |||
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 100.0 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 100.0 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 100.0 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 100.0 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 100.0 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 100.0 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 100.0 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 100.0 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 100.0 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 100.0 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 100.0 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 100.0 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 100.0 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 100.0 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 100.0 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 100.0 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 100.0 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.98 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 99.98 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.97 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.97 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.96 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 99.95 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.95 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.95 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 99.94 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.94 | |
| PF13514 | 1111 | AAA_27: AAA domain | 99.94 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 99.93 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.89 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 99.89 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 99.89 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.88 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.87 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 99.86 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.85 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.85 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 99.83 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 99.82 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 99.82 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 99.81 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.79 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.79 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 99.78 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.77 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 99.74 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.69 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.66 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 99.66 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 99.63 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 99.63 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.61 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 99.6 | |
| COG1195 | 363 | RecF Recombinational DNA repair ATPase (RecF pathw | 99.58 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.55 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 99.55 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.52 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.5 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 99.5 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.46 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.46 | |
| PF06470 | 120 | SMC_hinge: SMC proteins Flexible Hinge Domain; Int | 99.44 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.44 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.39 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 99.38 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.38 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.22 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 99.22 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 99.21 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.21 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 99.05 | |
| COG3950 | 440 | Predicted ATP-binding protein involved in virulenc | 99.02 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 98.98 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.93 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 98.93 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.9 | |
| PF11398 | 373 | DUF2813: Protein of unknown function (DUF2813); In | 98.9 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.83 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.81 | |
| PF13166 | 712 | AAA_13: AAA domain | 98.81 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 98.71 | |
| COG1106 | 371 | Predicted ATPases [General function prediction onl | 98.7 | |
| COG3593 | 581 | Predicted ATP-dependent endonuclease of the OLD fa | 98.63 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 98.51 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.51 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.48 | |
| PF04310 | 227 | MukB: MukB N-terminal; InterPro: IPR007406 This is | 98.47 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 98.47 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.46 | |
| PF13175 | 415 | AAA_15: AAA ATPase domain | 98.41 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.4 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.28 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.23 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 98.21 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.2 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.11 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.09 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.09 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 98.05 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 98.04 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.01 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.96 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.94 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.94 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 97.94 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 97.93 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 97.93 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 97.93 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 97.92 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 97.92 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.91 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.9 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.9 | |
| COG4938 | 374 | Uncharacterized conserved protein [Function unknow | 97.9 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.9 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.89 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 97.84 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.76 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.73 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.7 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 97.68 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.62 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 97.61 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.6 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 97.6 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.59 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 97.58 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.57 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 97.56 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 97.56 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 97.55 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 97.54 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.54 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.54 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.53 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 97.52 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 97.48 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.48 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 97.47 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 97.46 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.45 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 97.45 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.45 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 97.45 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.44 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 97.44 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 97.44 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 97.44 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 97.43 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 97.43 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.42 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 97.42 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 97.42 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.42 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 97.41 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 97.41 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 97.41 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 97.4 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 97.4 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 97.39 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 97.39 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 97.39 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 97.38 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 97.38 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 97.38 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.38 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 97.38 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 97.36 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 97.36 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 97.36 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 97.36 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 97.35 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 97.35 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.35 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 97.35 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 97.35 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 97.34 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.34 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 97.34 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 97.33 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 97.32 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 97.32 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 97.32 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 97.32 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 97.32 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 97.31 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 97.31 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 97.31 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 97.31 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 97.31 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 97.31 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 97.31 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.3 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 97.3 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 97.29 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 97.29 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 97.29 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 97.29 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 97.29 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 97.29 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 97.29 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 97.29 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 97.29 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.28 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 97.28 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 97.28 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 97.27 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 97.27 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 97.27 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 97.27 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 97.27 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.27 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 97.27 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 97.26 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 97.26 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 97.26 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 97.26 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 97.25 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 97.25 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 97.25 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 97.25 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 97.25 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 97.24 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 97.24 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 97.24 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 97.24 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 97.24 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 97.24 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 97.24 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 97.23 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 97.23 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 97.23 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 97.23 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 97.23 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 97.22 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.22 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.22 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 97.22 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 97.22 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 97.22 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 97.21 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 97.21 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 97.21 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 97.21 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 97.2 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 97.2 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 97.2 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 97.19 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 97.19 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 97.19 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 97.19 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.19 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.18 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.18 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 97.18 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 97.17 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.17 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 97.17 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 97.17 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 97.16 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 97.15 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 97.15 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 97.15 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.15 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.15 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 97.15 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 97.15 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 97.15 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 97.14 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 97.14 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 97.14 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.14 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 97.14 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.13 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 97.13 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 97.13 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 97.13 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 97.13 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 97.13 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 97.13 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 97.13 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 97.12 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 97.12 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 97.12 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 97.12 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 97.12 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 97.11 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 97.11 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.11 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 97.11 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 97.1 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 97.1 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 97.1 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 97.1 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 97.1 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.1 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.1 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.09 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 97.09 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 97.09 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 97.09 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.08 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 97.08 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 97.08 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.08 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 97.08 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 97.08 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 97.07 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 97.07 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.07 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 97.07 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.07 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.06 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 97.06 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.06 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 97.06 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 97.06 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.06 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 97.05 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 97.05 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 97.05 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 97.05 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.04 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.04 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 97.04 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 97.04 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 97.03 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 97.03 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.03 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.03 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.03 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.02 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.01 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 97.01 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 97.01 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 97.01 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 97.0 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 96.99 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 96.99 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.99 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 96.99 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 96.99 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 96.98 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 96.98 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 96.97 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 96.97 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 96.97 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 96.97 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 96.97 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.97 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 96.96 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 96.96 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 96.96 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.96 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 96.95 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.95 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 96.95 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.94 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 96.94 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 96.93 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.93 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 96.92 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 96.92 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.91 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 96.9 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 96.9 | |
| PF13514 | 1111 | AAA_27: AAA domain | 96.89 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.89 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.89 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 96.89 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 96.88 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 96.88 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 96.87 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 96.86 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.86 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.85 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 96.85 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.85 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 96.85 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 96.84 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 96.84 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 96.82 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 96.8 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 96.79 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.79 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 96.78 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.78 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 96.78 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 96.77 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 96.76 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 96.75 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 96.74 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 96.72 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 96.71 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 96.71 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 96.7 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.7 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 96.69 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 96.68 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 96.68 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 96.67 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.66 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 96.66 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.65 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 96.64 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 96.63 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 96.61 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 96.61 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 96.6 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 96.6 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 96.59 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 96.59 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 96.58 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.57 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.56 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 96.56 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.54 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.53 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.52 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 96.51 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 96.51 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 96.5 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 96.5 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 96.5 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 96.5 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 96.49 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 96.49 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.48 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 96.47 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 96.46 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 96.44 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 96.44 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 96.44 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 96.43 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 96.43 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 96.42 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 96.41 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 96.41 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 96.41 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 96.39 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 96.39 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 96.35 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 96.35 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 96.35 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 96.33 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 96.32 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 96.3 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 96.3 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 96.3 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 96.3 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 96.29 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 96.28 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.27 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.26 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 96.23 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 96.23 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 96.22 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 96.2 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.19 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 96.17 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 96.16 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 96.14 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 96.14 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 96.14 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 96.14 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.14 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 96.13 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 96.13 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 96.13 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.12 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 96.1 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.1 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 96.09 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 96.08 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 96.07 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 96.04 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 96.03 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 95.99 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 95.99 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 95.98 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 95.97 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 95.97 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.96 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 95.96 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 95.95 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 95.92 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 95.92 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.91 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 95.91 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 95.91 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 95.88 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 95.86 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 95.86 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 95.85 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 95.84 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 95.84 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 95.83 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 95.83 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.82 |
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.2e-117 Score=939.25 Aligned_cols=1085 Identities=47% Similarity=0.736 Sum_probs=981.3
Q ss_pred CeeeEEEEecccccccccccccCCCCcEEEEcCCCCChhHHHHHHHHHhcccccccchhhhhhhhccCCCCcceEEEEEE
Q 001328 1 MHIKQVIIEGFKSYREQIATEPFSPQVNCVVGANGSGKTNFFHAIRFVLSDIFQNLRSEDRHALLHEGAGHQVLSAFVEI 80 (1099)
Q Consensus 1 M~i~~l~l~~f~sf~~~~~~~~f~~~~~~I~G~NGsGKS~i~~ai~~~Lg~~~~~~~~~~~~~~i~~g~~~~~~~a~v~~ 80 (1099)
|||+.|.|.||+||.+.++++||+|..|+|||.|||||||++.||+|||.+.+.+++.....++||.|+++.+..|+|+|
T Consensus 1 MyIk~ViI~GFrSYrd~tvv~~fSph~NvIVGrNGSGKSNFF~AIrFVLSDey~hLk~E~R~gLlHEGsG~~V~sA~VEI 80 (1200)
T KOG0964|consen 1 MYIKQVIIKGFRSYRDETVVDPFSPHHNVIVGRNGSGKSNFFHAIRFVLSDEYSHLKREERQGLLHEGSGAMVMSASVEI 80 (1200)
T ss_pred CceEEeeeccchhhccccccCCCCCCcceEecCCCCCchhhHHHhhhhcccchhhcCHHHHhhhhhcCCCcceEEEEEEE
Confidence 99999999999999999999889999999999999999999999999999988999999999999999999999999999
Q ss_pred EEeCCCCCCCCCCccEEEEEEeecCCCeEEeCCeecCHHHHHHHHHHcCCCCCCCceeecCchHhHhhcCCHHHHHHHHH
Q 001328 81 VFDNSDNRIPVDKEEVRLRRTIGLKKDEYFLDGKHITKTEVMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSERLDLLK 160 (1099)
Q Consensus 81 ~f~~~~~~~~~~~~~~~i~R~~~~~~~~~~in~~~~~~~~~~~l~~~~g~~~~~~~~~i~qg~i~~~~~~~~~~~~~~le 160 (1099)
+|+|+++++|.++++|+|+|.++..++.|++|++.|+..+|..+|.+.||+++|||||++||+|.++..+++.+|+.+|.
T Consensus 81 vF~nsdnr~~~~k~Ev~lrRtVGlKKDeY~lD~k~Vtk~evvnLLESAGFSrsNPYyIV~QGkI~~La~akD~eRL~LLk 160 (1200)
T KOG0964|consen 81 VFDNSDNRLPRGKSEVSLRRTVGLKKDEYFLDNKMVTKGEVVNLLESAGFSRSNPYYIVPQGKINELANAKDSERLELLK 160 (1200)
T ss_pred EEeCcccccCCCCCeEEEEEeecccchhhhcccccccHHHHHHHHHhcCcccCCCceEeechhhHHhhcCCcHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001328 161 EIGGTRVYEERRRESLKIMQDTGNKRQQIIQVVKYLDERLKELDEEKEELRKYQQLDKQRKSLEYTIYDKELHDARQKLL 240 (1099)
Q Consensus 161 e~~g~~~~~~~~~e~~~~l~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~l~ 240 (1099)
+++|+..|.++++++.+.|.+|..+...+...+..+++++..|+.+.+.+..|+++.+..+.++|..+..++.++..++.
T Consensus 161 eVaGtrvYeerreeSlkim~ET~qK~ekI~ell~yieerLreLEeEKeeL~~Yqkldk~rr~lEYtiYdrEl~E~~~~l~ 240 (1200)
T KOG0964|consen 161 EVAGTRVYEERREESLKIMEETKQKREKINELLKYIEERLRELEEEKEELEKYQKLDKERRSLEYTIYDRELNEINGELE 240 (1200)
T ss_pred HhcccchhHHhHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhHhhhhhhhhhhHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhHHHHHHHHhcch
Q 001328 241 EVDDTRTRFSDESAKMYNSLLDAQEKSKDSDKRFKDLMKEVQTLNKEKEAIEKRLTEAIKNQTAFELDVKDIQERISGNS 320 (1099)
Q Consensus 241 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 320 (1099)
.+.......-.........+......+..+...+..+...+..+..+.+.+..+...+.+....++-.+..++.++....
T Consensus 241 ~le~~r~~~~e~s~~~~~~~~~~~d~~~~~~~~i~ele~~l~~l~~ekeq~~a~~t~~~k~kt~lel~~kdlq~~i~~n~ 320 (1200)
T KOG0964|consen 241 RLEEDRSSAPEESEQYIDALDKVEDESEDLKCEIKELENKLTNLREEKEQLKARETKISKKKTKLELKIKDLQDQITGNE 320 (1200)
T ss_pred HHHHHHhccchhhhhHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhHHHHHHhhhhh
Confidence 99999999988888888999999999999999999999999999988888888888888888899999999999999888
Q ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccCCHHHHHHHHHHHHH
Q 001328 321 QARDDAKKQLRSLLEEIDDSSKELDKANTLYENKCIEEKKITKDIMEREKQLSILYQKQGRATQFSSKDARDKWLQKEID 400 (1099)
Q Consensus 321 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 400 (1099)
+........+..+..++.+...++..+.+.+..+..+...+...+..++.....+..+.++..++.+..++..|++.++.
T Consensus 321 q~r~~~l~~l~~~~~ki~e~~~EL~~I~Pky~~l~~ee~~~~~rl~~l~~~~~~l~~Kqgr~sqFssk~eRDkwir~ei~ 400 (1200)
T KOG0964|consen 321 QQRNLALHVLQKVKDKIEEKKDELSKIEPKYNSLVDEEKRLKKRLAKLEQKQRDLLAKQGRYSQFSSKEERDKWIRSEIE 400 (1200)
T ss_pred hhhhhHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHhHHHHHHHHHHHHHHHHHHHHHhhccccccCcHHHHHHHHHHHHH
Confidence 88888889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHhhHhhhHHHHHHHHHHHHHHHHHHHHHH
Q 001328 401 DLERVHSSNLKQDQKLQEEIQRLKGDLKERDEYIESRKREIAYLESSISQSREGFNNHKTQRDKMQDERKSLWVKESELC 480 (1099)
Q Consensus 401 ~l~~~~~~l~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 480 (1099)
.+..-+.........+..++..+..++......+..+...+.....+++.+......+..+++++......+|++-..++
T Consensus 401 ~l~~~i~~~ke~e~~lq~e~~~~e~~l~~~~e~i~~l~~si~e~~~r~~~~~~~~~~~k~~~del~~~Rk~lWREE~~l~ 480 (1200)
T KOG0964|consen 401 KLKRGINDTKEQENILQKEIEDLESELKEKLEEIKELESSINETKGRMEEFDAENTELKRELDELQDKRKELWREEKKLR 480 (1200)
T ss_pred HHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHhhhhhCCcchHHhHHHHHHHHHHcCCCccccccccccccchhhHHHHHHhhccCcceEEecCchH
Q 001328 481 AEIDKLKAEVEKAEKSLDHATPGDVRRGLNSIRRICREYKIDGVYGPIIELLDCDEKFFTAVEVTAGNSLFHVVVDNDET 560 (1099)
Q Consensus 481 ~~l~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~i~~~~~~~~aie~~l~~~l~~~vv~~~~~ 560 (1099)
..+..+...+......+...++.++..++..++.+....++.|++|+|++++.||+.|.+|++++.|+.++++||+++++
T Consensus 481 ~~i~~~~~dl~~~~~~L~~~~~r~v~nGi~~v~~I~e~~k~ngv~G~v~eL~~v~~~f~tavEvtaGNsLF~iVVdndev 560 (1200)
T KOG0964|consen 481 SLIANLEEDLSRAEKNLRATMNRSVANGIDSVRKIKEELKPNGVFGTVYELIKVPNKFKTAVEVTAGNSLFNIVVDNDEV 560 (1200)
T ss_pred HHHHHHHHHHHHHHHHHHHhccchhhhhhHHHHHHHHHhcccccceehhhhhcCCHHHHhHHhhhcccceEEEEecccHH
Confidence 99999999999999999988899999999999999988888899999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhcCCCeeEEEeCCCCCCCCCCCCCcccccccccccccCcchHHHHHHhccCeEEecChHHHHHHHHhcCCc
Q 001328 561 STKIIRHLNSLKGGRVTFIPLNRVKAPRVTYPKSNDVIPLLDRLEFSPNFKPAFAQVFARTVICRDLDVCTRVARTDGLD 640 (1099)
Q Consensus 561 a~~~~~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~l~~~~~~~~~~~a~~~~~~~~~~ 640 (1099)
|..++..+.+.+.|++||+|+++++++.+.+|..+.+.|+++.+.|+|.|.+++.+++|+++||.+++.|.+.++.+...
T Consensus 561 ATkIl~~~n~m~~GrVTF~PLNrl~~r~v~yp~~sdaiPli~kl~y~p~fdka~k~Vfgktivcrdl~qa~~~ak~~~ln 640 (1200)
T KOG0964|consen 561 ATKILRKLNKMKGGRVTFMPLNRLKARDVEYPKDSDAIPLISKLRYEPQFDKALKHVFGKTIVCRDLEQALRLAKKHELN 640 (1200)
T ss_pred HHHHHHHHHhccCCeeEEeecccCchhhccCCCCCCccchHHHhCcchhhHHHHHHHhCceEEeccHHHHHHHHHhcCCC
Confidence 99999999999999999999999999888899999999999999999999999999999999999999999999999999
Q ss_pred EEecCCCcccCCcceecccccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHhHHH
Q 001328 641 CITLEGDQVSKKGGMTGGFYDYRRSKLKFMNIIMRNTKTINAREEEVEKLISQ---LDQKITEHVTEQQKTDAKRAHDKS 717 (1099)
Q Consensus 641 ~vt~~g~~~~~~g~~~g~~~~~~~~~~~~~~~l~~l~~~~~~l~~~l~~~~~~---l~~~l~~~~~~~~~l~~~~~~l~~ 717 (1099)
|||++|+.++..|.|+||+.+...+.+.+...+...+.++.++...+..++.. ..+++.++...++.++..+.....
T Consensus 641 ~ITl~GDqvskkG~lTgGy~D~krsrLe~~k~~~~~~~~~~~l~~~L~~~r~~i~~~~~~i~q~~~~~qk~e~~~~~~~~ 720 (1200)
T KOG0964|consen 641 CITLSGDQVSKKGVLTGGYEDQKRSRLELLKNVNESRSELKELQESLDEVRNEIEDIDQKIDQLNNNMQKVENDRNAFKR 720 (1200)
T ss_pred eEEeccceecccCCccccchhhhhhHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Confidence 99999999999999999999888888988888888888888888888883333 334444555555555555555555
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhhhhhCCHHHHHHHhhhhHHHHHHHHH
Q 001328 718 ELEQLKQDIANANKQKQIISKALENKEKSLADVRTQLDQLEASMAMKQAEMNTDLIDHLSLDEKNLLSRLNPEITELKEK 797 (1099)
Q Consensus 718 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~ 797 (1099)
....+..++..+..+...++..+......+..+...+..+.+....+++++.......+.......+..+..++..+..+
T Consensus 721 ~~~~l~~e~~~~k~e~~~v~~s~~~k~~~Le~i~~~l~~~~~~~~~~e~el~sel~sqLt~ee~e~l~kLn~eI~~l~~k 800 (1200)
T KOG0964|consen 721 EHEKLKRELNTIKGEKSRVQESLEPKGKELEEIKTSLHKLESQSNYFESELGSELFSQLTPEELERLSKLNKEINKLSVK 800 (1200)
T ss_pred HHHHHHHHHHHhhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHhHHHHHhHHHHhhcCHHHHHHHHHhhHHHHHHHHH
Confidence 55555556666666666666666667777777777788888888888888887777788888888999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001328 798 LITCRTDRIEYETRKAELETNLTTNLMRRKQELEALISSAENDVMLSEAESKKQELADAKSFVEDARQELKRVSDSIVQL 877 (1099)
Q Consensus 798 l~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ 877 (1099)
+..+..+...+...+..++..+..++..+...+++.+.++........+.....++......+.....++..++..++..
T Consensus 801 l~~~~~er~~~~~rk~~le~~l~~kL~~r~~~l~~ei~~~~d~~~~~el~~~~~el~~~~~~~e~~~~el~~l~~~i~~~ 880 (1200)
T KOG0964|consen 801 LRALREERIDIETRKTALEANLNTKLYKRVNELEQEIGDLNDSSRRSELELEKSELESEEKRVEAAILELKTLQDSIDKK 880 (1200)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHhhhcccccchhhhhHHHHHHHHHHHHHHHHHHHHhhHHHHHHHH
Confidence 99999999999999999999999999999999999999988776667777778888888888888888888888888888
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCChhhhhhhccCCHHHHHHHHH
Q 001328 878 TKELNKIKDEKTKLKTLEDNYERKLQDDARELEQLLSRRNILLAKQEEYSKKIRELGPLSSDAFDTYKRKGVKELLKMLH 957 (1099)
Q Consensus 878 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~l~ 957 (1099)
...+.+....++.+..-....... ......++.+...+..+..+.+++...|..+|.+|.++|..|......++..+|.
T Consensus 881 ~a~~~~~~~~lE~~~~lek~~~~~-~~~dKe~Ek~~~rk~~Ll~KreE~~ekIr~lG~Lp~daf~ky~~~~~~el~kkL~ 959 (1200)
T KOG0964|consen 881 KAEIKEIKKELEKAKNLEKEKKDN-INFDKELEKLVRRKHMLLKKREECCEKIRELGVLPEDAFEKYQDKKSKELMKKLH 959 (1200)
T ss_pred HHHHHHHHHHHHHHHHHHHHHhhh-hhhhHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCchHHHHHhccCCHHHHHHHHH
Confidence 887777777776665544433333 2233566666667777777888899999999999999999999989999999999
Q ss_pred HHHHHhccCccCcHHHHHHHHhHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCC
Q 001328 958 RCNEQLQQFSHVNKKALDQYVNFTEQREELQRRQAELDAGDEKIKELISVLDQRKDESIERTFKGVARHFREVFSELVQG 1037 (1099)
Q Consensus 958 ~l~~~l~~l~~vn~~a~ee~~~~~~~~~~l~~q~~dl~~~~~~l~~~i~~l~~~~~~~~~~~f~~in~~f~~~f~~lf~g 1037 (1099)
.+..+|..|++||.+|+++|..+.++.+.|..+.++|..+.+.|.+.|..|+.+..+.+..||.+|.++|.++|.+|+||
T Consensus 960 ~~neelk~ys~VNKkAldQf~nfseQre~L~~R~eELd~s~~sI~eLi~vLdqrK~eai~~TFkqV~knFsevF~~LVp~ 1039 (1200)
T KOG0964|consen 960 RCNEELKGYSNVNKKALDQFVNFSEQRESLKKRQEELDRSKDSILELITVLDQRKYEAIDLTFKQVKKNFSEVFSRLVPG 1039 (1200)
T ss_pred HHHHHHhhcchhhHHHHHHHHHHHHHHHHHHHHHHHhccchhHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHhCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceEEEEEeeccCCCCCC-CCCCC-CCCCCccCCccccccceEEEEecCCCcc
Q 001328 1038 GHGHLVMMKKKDGDHGD-DDDDD-GPRESDVEGRVEKYIGVKVKACTSVKMN 1087 (1099)
Q Consensus 1038 G~a~L~l~~~~~~~~~~-~~~~~-~~~~~~~~~~~~~~~Gi~i~~~ppgk~~ 1087 (1099)
|.|.|+| ++.|.+..+ +|+.+ +..++.....+++|+||.|.|+|.||-+
T Consensus 1040 G~a~iim-~k~d~~~d~~e~d~~~~~~s~~~~~sv~~ytGIsI~VSFnskq~ 1090 (1200)
T KOG0964|consen 1040 GTALIIM-RKRDNANDHDEDDGDMDGESNEGKDSVEMYTGISIKVSFNSKQG 1090 (1200)
T ss_pred Cceeehh-hccccccccccccccccccccccccchhhccceeEEEEeecCcc
Confidence 9997777 555432211 12222 2222346778999999999999999876
|
|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >PF06470 SMC_hinge: SMC proteins Flexible Hinge Domain; InterPro: IPR010935 This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF11398 DUF2813: Protein of unknown function (DUF2813); InterPro: IPR022602 This entry contains YbjD from Escherichia coli (strain K12), which is a conserved protein with a nucleotide triphosphate binding domain | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1106 Predicted ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF04310 MukB: MukB N-terminal; InterPro: IPR007406 This is the N-terminal region of MukB | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF13175 AAA_15: AAA ATPase domain | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4938 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1099 | ||||
| 2wd5_B | 213 | Smc Hinge Heterodimer (Mouse) Length = 213 | 9e-43 | ||
| 1xew_X | 182 | Structural Biochemistry Of Atp-Driven Dimerization | 5e-19 | ||
| 3kta_A | 182 | Structural Basis For Adenylate Kinase Activity In A | 6e-18 | ||
| 4i99_A | 354 | Crystal Structure Of The Smchead Bound To The C-win | 2e-16 | ||
| 3zgx_A | 426 | Crystal Structure Of The Kleisin-n Smc Interface In | 3e-13 | ||
| 3nwc_A | 189 | Crystal Structure Of The Pyrococcus Furiosus Smc Pr | 1e-12 | ||
| 1e69_A | 322 | Smc Head Domain From Thermotoga Maritima Length = 3 | 2e-09 | ||
| 1gxl_A | 213 | Smc Hinge Domain From T. Maritima With Coiled Coil | 3e-08 | ||
| 1gxj_A | 186 | Smc Hinge Domain From T. Maritima WO COILED COIL Le | 2e-07 | ||
| 3l51_B | 166 | Crystal Structure Of The Mouse Condensin Hinge Doma | 5e-05 | ||
| 1w1w_A | 430 | Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 | 3e-04 |
| >pdb|2WD5|B Chain B, Smc Hinge Heterodimer (Mouse) Length = 213 | Back alignment and structure |
|
| >pdb|1XEW|X Chain X, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases. Length = 182 | Back alignment and structure |
| >pdb|3KTA|A Chain A, Structural Basis For Adenylate Kinase Activity In Abc Atpases Length = 182 | Back alignment and structure |
| >pdb|4I99|A Chain A, Crystal Structure Of The Smchead Bound To The C-winged Helix Domain Of Scpa Length = 354 | Back alignment and structure |
| >pdb|3ZGX|A Chain A, Crystal Structure Of The Kleisin-n Smc Interface In Prokaryotic Condensin Length = 426 | Back alignment and structure |
| >pdb|3NWC|A Chain A, Crystal Structure Of The Pyrococcus Furiosus Smc Protein Hinge Domain Length = 189 | Back alignment and structure |
| >pdb|1E69|A Chain A, Smc Head Domain From Thermotoga Maritima Length = 322 | Back alignment and structure |
| >pdb|1GXL|A Chain A, Smc Hinge Domain From T. Maritima With Coiled Coil Length = 213 | Back alignment and structure |
| >pdb|1GXJ|A Chain A, Smc Hinge Domain From T. Maritima WO COILED COIL Length = 186 | Back alignment and structure |
| >pdb|3L51|B Chain B, Crystal Structure Of The Mouse Condensin Hinge Domain Length = 166 | Back alignment and structure |
| >pdb|1W1W|A Chain A, Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2wd5_B Structural maintenance of chromosomes protein 3; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} Length = 213 | Back alignment and structure |
|---|
Score = 202 bits (517), Expect = 9e-60
Identities = 79/211 (37%), Positives = 130/211 (61%), Gaps = 9/211 (4%)
Query: 485 KLKAEVEKAEKSLDHATPGDVRRGLNSIRRICREYK--------IDGVYGPIIELLDCDE 536
+ ++EK ++ L AT + G++SI ++ ++ +G +G ++ +C+
Sbjct: 2 AKREDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRKGINQHVQNGYHGIVMNNFECEP 61
Query: 537 KFFTAVEVTAGNSLFHVVVDNDETSTKIIRH-LNSLKGGRVTFIPLNRVKAPRVTYPKSN 595
F+T VEVTAGN LF+ +VD+DE STKI+ G VTF+PLN++ YP++N
Sbjct: 62 AFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETN 121
Query: 596 DVIPLLDRLEFSPNFKPAFAQVFARTVICRDLDVCTRVARTDGLDCITLEGDQVSKKGGM 655
D IP++ +L ++P F AF VF +T+ICR ++V T++AR +DCITLEGDQVS +G +
Sbjct: 122 DAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGAL 181
Query: 656 TGGFYDYRRSKLKFMNIIMRNTKTINAREEE 686
TGG+YD R+S+L+ + + + + E +
Sbjct: 182 TGGYYDTRKSRLELQKDVRKAEEELGELEAK 212
|
| >3nwc_A SMC protein; structural maintenance of chromosomes (SMC), SMC hinge domai dimerization, DNA binding, cell cycle; 1.70A {Pyrococcus furiosus} Length = 189 | Back alignment and structure |
|---|
| >3l51_A Structural maintenance of chromosomes protein 2; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} Length = 161 | Back alignment and structure |
|---|
| >1gxj_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 2.0A {Thermotoga maritima} SCOP: d.215.1.1 PDB: 1gxk_A Length = 186 | Back alignment and structure |
|---|
| >3l51_B Structural maintenance of chromosomes protein 4; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} Length = 166 | Back alignment and structure |
|---|
| >1gxl_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 3.0A {Thermotoga maritima} SCOP: d.215.1.1 Length = 213 | Back alignment and structure |
|---|
| >2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} Length = 233 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Length = 182 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Length = 322 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Length = 149 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Length = 359 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Length = 1038 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1099 | |||
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 99.94 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.93 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 99.89 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 99.88 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 99.87 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.87 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 99.83 | |
| 3l51_B | 166 | Structural maintenance of chromosomes protein 4; s | 99.83 | |
| 2wd5_B | 213 | Structural maintenance of chromosomes protein 3; D | 99.81 | |
| 3nwc_A | 189 | SMC protein; structural maintenance of chromosomes | 99.79 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.79 | |
| 1gxl_A | 213 | SMC, chromosome segregation SMC protein; SMC dimer | 99.75 | |
| 2wd5_A | 233 | Structural maintenance of chromosomes protein 1A; | 99.74 | |
| 3l51_A | 161 | Structural maintenance of chromosomes protein 2; s | 99.74 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 99.7 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 99.69 | |
| 1gxj_A | 186 | SMC, chromosome segregation SMC protein; SMC dimer | 99.68 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 99.66 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 99.55 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.97 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.95 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 98.71 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.87 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 97.8 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 97.68 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 97.67 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 97.65 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 97.64 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.63 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 97.62 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 97.61 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 97.61 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.6 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 97.58 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 97.57 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 97.56 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 97.56 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 97.54 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 97.53 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 97.5 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 97.49 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 97.48 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 97.48 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 97.47 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 97.46 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 97.45 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 97.44 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 97.43 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 97.43 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 97.42 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 97.42 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 97.41 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 97.39 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 97.39 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 97.39 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.37 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 97.36 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.36 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 97.35 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 97.34 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 97.33 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 97.32 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 97.27 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 97.24 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.24 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.24 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.23 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 97.22 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.21 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.2 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.16 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.15 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 97.13 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 97.11 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 97.09 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.09 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 97.08 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 97.08 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 97.06 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.04 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 97.02 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.97 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 96.92 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 96.92 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 96.92 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.89 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 96.84 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.84 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.8 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.79 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 96.78 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.76 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 96.76 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.72 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 96.71 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.69 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.67 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.66 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 96.65 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.64 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.61 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 96.59 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.56 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 96.56 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 96.55 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.52 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.51 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 96.51 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.47 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.47 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 96.47 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 96.46 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 96.44 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 96.43 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 96.42 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 96.39 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.36 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 96.35 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 96.34 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.31 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 96.3 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.29 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.29 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.27 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 96.22 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 96.21 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 96.18 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.15 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 96.14 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 96.12 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.11 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.1 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.06 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 96.0 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.98 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 95.96 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.96 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 95.95 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 95.94 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 95.93 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 95.92 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 95.92 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 95.89 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 95.89 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 95.88 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 95.88 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 95.87 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 95.84 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 95.84 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.82 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 95.82 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 95.81 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 95.8 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 95.79 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 95.79 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 95.77 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 95.77 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 95.77 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 95.74 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 95.7 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.69 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 95.69 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 95.67 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 95.66 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 95.61 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 95.6 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 95.59 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 95.54 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 95.54 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 95.54 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 95.52 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 95.46 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 95.46 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 95.45 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 95.42 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 95.4 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 95.35 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 95.25 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 95.24 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.23 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 95.22 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 95.21 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 95.13 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 95.12 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 95.09 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.09 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.02 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 95.02 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 94.98 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 94.97 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 94.93 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.92 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 94.86 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 94.82 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 94.77 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 94.69 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 94.65 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 94.63 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 94.58 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 94.58 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 94.57 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 94.57 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 94.56 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 94.55 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 94.43 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 94.42 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 94.42 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 94.38 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 94.36 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 94.34 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 94.32 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 94.23 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 94.13 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 94.12 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 94.09 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 94.07 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 94.03 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 94.0 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 93.99 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 93.97 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 93.96 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 93.96 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 93.91 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 93.91 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 93.89 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 93.88 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 93.72 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 93.71 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 93.69 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 93.62 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.59 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 93.59 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 93.58 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 93.58 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 93.52 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 93.51 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 93.45 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 93.39 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 93.37 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 93.3 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 93.27 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 93.23 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 93.21 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 93.2 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 93.16 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 93.11 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 93.08 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 93.05 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.05 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.98 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 92.95 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 92.94 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 92.93 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 92.9 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 92.85 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 92.81 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 92.8 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 92.78 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 92.75 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 92.75 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 92.74 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 92.71 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 92.61 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 92.59 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 92.51 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 92.47 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 92.45 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.35 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 92.33 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 92.3 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 92.29 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 92.27 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 92.24 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 92.22 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.21 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 92.15 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 92.13 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 92.09 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 92.08 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 92.05 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 92.01 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 91.99 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 91.97 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 91.95 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 91.89 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 91.88 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 91.82 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 91.82 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 91.76 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 91.76 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 91.74 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 91.73 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 91.71 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 91.63 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 91.62 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 91.61 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 91.61 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 91.55 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 91.55 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 91.54 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 91.44 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.4 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 91.4 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 91.39 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 91.36 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 91.34 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 91.33 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 91.3 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 91.29 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 91.23 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 91.23 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 91.19 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 91.17 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 91.13 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 91.11 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 91.09 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 91.09 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 91.08 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 91.02 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 91.0 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 90.99 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 90.98 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 90.98 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 90.97 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 90.88 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 90.81 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 90.66 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 90.65 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 90.64 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 90.57 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 90.55 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 90.48 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 90.46 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 90.41 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 90.39 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 90.36 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 90.3 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 90.14 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 90.09 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 90.04 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 90.04 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 89.93 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 89.92 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 89.89 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 89.88 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 89.87 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 89.85 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 89.82 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 89.81 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 89.8 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 89.77 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 89.74 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 89.73 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 89.71 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 89.7 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 89.65 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 89.64 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 89.63 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 89.61 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 89.59 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 89.54 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 89.5 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 89.5 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 89.45 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 89.38 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 89.29 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 89.25 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 89.23 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 89.19 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 89.19 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 89.16 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 89.14 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 89.07 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 89.04 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 88.99 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 88.99 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 88.97 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 88.96 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 88.94 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 88.93 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 88.92 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 88.88 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 88.87 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 88.83 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 88.8 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 88.73 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 88.7 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 88.68 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 88.64 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 88.64 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 88.62 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 88.62 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 88.6 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 88.58 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 88.57 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 88.56 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 88.55 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 88.53 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 88.53 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 88.52 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 88.5 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 88.49 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 88.39 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 88.36 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 88.35 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 88.35 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 88.32 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 88.32 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 88.28 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 88.28 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 88.19 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 88.14 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 88.12 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 88.12 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 88.1 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 88.05 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 88.04 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 88.04 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 88.02 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 88.02 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 88.01 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 88.01 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 88.0 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 87.99 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 87.97 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 87.95 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 87.95 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 87.92 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 87.91 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 87.89 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 87.89 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 87.83 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 87.68 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 87.66 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 87.61 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 87.54 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 87.53 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 87.52 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 87.48 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 87.46 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 87.44 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 87.43 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 87.34 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 87.32 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 87.3 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 87.22 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 87.2 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 87.17 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 87.15 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 87.15 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 87.12 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 87.08 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 87.06 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 87.03 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 87.03 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 87.02 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 87.0 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 86.96 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 86.93 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 86.92 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 86.92 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 86.88 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 86.76 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 86.71 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 86.65 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 86.64 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 86.64 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 86.62 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 86.61 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 86.59 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 86.56 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 86.55 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 86.52 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 86.51 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 86.51 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 86.47 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 86.46 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 86.42 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 86.38 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 86.34 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 86.28 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 86.27 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 86.22 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 86.2 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 86.19 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 86.13 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 86.12 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 85.94 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 85.91 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 85.88 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 85.85 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 85.8 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 85.7 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 85.69 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 85.67 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 85.61 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 85.57 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 85.57 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 85.54 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 85.49 |
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
Probab=99.94 E-value=1.8e-26 Score=224.56 Aligned_cols=174 Identities=34% Similarity=0.585 Sum_probs=139.8
Q ss_pred CeeeEEEEecccccc-cccccccCCCCcEEEEcCCCCChhHHHHHHHHHhcc-cccccchhhhhhhhccCCCC--cceEE
Q 001328 1 MHIKQVIIEGFKSYR-EQIATEPFSPQVNCVVGANGSGKTNFFHAIRFVLSD-IFQNLRSEDRHALLHEGAGH--QVLSA 76 (1099)
Q Consensus 1 M~i~~l~l~~f~sf~-~~~~~~~f~~~~~~I~G~NGsGKS~i~~ai~~~Lg~-~~~~~~~~~~~~~i~~g~~~--~~~~a 76 (1099)
|+|++|+|.||++|. +...+ .|+||+|+|+||||||||||++||.|+||+ .....++....++++.|... +...+
T Consensus 2 M~i~~l~i~nf~~~~~~~~~~-~~~~g~~~i~G~NGsGKStll~ai~~~l~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~ 80 (182)
T 3kta_A 2 PYIEKLELKGFKSYGNKKVVI-PFSKGFTAIVGANGSGKSNIGDAILFVLGGLSAKAMRASRISDLIFAGSKNEPPAKYA 80 (182)
T ss_dssp CEEEEEEEESBGGGCSSCEEE-ECCSSEEEEEECTTSSHHHHHHHHHHHTTCCCTGGGTCSSGGGGBCCCC----CCSCE
T ss_pred ceEEEEEEeCeEeecCccEEE-ecCCCcEEEECCCCCCHHHHHHHHHHHHcCCcccccccccchheeecccccCCCCceE
Confidence 899999999999995 33344 499999999999999999999999999998 44456666777889887642 23578
Q ss_pred EEEEEEeCCCCCCCCCCccEEEEEEeec-CCCeEEeCCeecCHHHHHHHHHHcCCCCCCCceeecCchHhHhhcCCHHHH
Q 001328 77 FVEIVFDNSDNRIPVDKEEVRLRRTIGL-KKDEYFLDGKHITKTEVMNLLESAGFSRSNPYYVVQQGKIASLTLMKDSER 155 (1099)
Q Consensus 77 ~v~~~f~~~~~~~~~~~~~~~i~R~~~~-~~~~~~in~~~~~~~~~~~l~~~~g~~~~~~~~~i~qg~i~~~~~~~~~~~ 155 (1099)
.|.++|.+.+..+++.+..++|.|.+.. +.+.|++||.+++..++.+++..+|++.. .+.+++||++..|+.++|.+|
T Consensus 81 ~v~~~f~~~~~~~~~~~~~~~i~r~~~~~~~~~~~i~g~~~~~~~~~~~l~~~~l~~~-~~~~~~qg~~~~l~~~~~~~r 159 (182)
T 3kta_A 81 EVAIYFNNEDRGFPIDEDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPD-GYNIVLQGDITKFIKMSPLER 159 (182)
T ss_dssp EEEEEEECTTCCSSSSSSEEEEEEEECTTSCEEEEETTEEECHHHHHHHHHHTTCCTT-CTTEECTTCTTHHHHSCHHHH
T ss_pred EEEEEEeCCCcccccCCcEEEEEEEEEeCCcEEEEECCeEcCHHHHHHHHHHcCCCCC-CCEEEEcccHHHHHhCCHHHH
Confidence 9999999988877777788999999854 56789999999999999999999999874 456899999999999999999
Q ss_pred HHHHHHhcChHHHHHHHHHHH
Q 001328 156 LDLLKEIGGTRVYEERRRESL 176 (1099)
Q Consensus 156 ~~~lee~~g~~~~~~~~~e~~ 176 (1099)
+.+|+.++|+..|..+++++.
T Consensus 160 ~~~ld~~~g~~~~~~~~~~~~ 180 (182)
T 3kta_A 160 RLLIDDISGIAEYDSKKEKAL 180 (182)
T ss_dssp HHHHHHHHTC-----------
T ss_pred HHHHHHHHChHHHHHHHHHHh
Confidence 999999999999998777654
|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3l51_B Structural maintenance of chromosomes protein 4; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} SCOP: d.215.1.0 | Back alignment and structure |
|---|
| >2wd5_B Structural maintenance of chromosomes protein 3; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >3nwc_A SMC protein; structural maintenance of chromosomes (SMC), SMC hinge domai dimerization, DNA binding, cell cycle; 1.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >1gxl_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 3.0A {Thermotoga maritima} SCOP: d.215.1.1 | Back alignment and structure |
|---|
| >2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >3l51_A Structural maintenance of chromosomes protein 2; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1gxj_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 2.0A {Thermotoga maritima} SCOP: d.215.1.1 PDB: 1gxk_A | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1099 | ||||
| d1gxja_ | 161 | d.215.1.1 (A:) Smc hinge domain {Thermotoga mariti | 5e-37 | |
| d1e69a_ | 308 | c.37.1.12 (A:) Smc head domain {Thermotoga maritim | 3e-22 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 1e-21 | |
| g1xew.1 | 329 | c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi | 1e-20 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 6e-16 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-10 | |
| d1qhla_ | 222 | c.37.1.12 (A:) Cell division protein MukB {Escheri | 3e-07 |
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} Length = 161 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Smc hinge domain superfamily: Smc hinge domain family: Smc hinge domain domain: Smc hinge domain species: Thermotoga maritima [TaxId: 2336]
Score = 134 bits (339), Expect = 5e-37
Identities = 40/156 (25%), Positives = 75/156 (48%), Gaps = 7/156 (4%)
Query: 510 NSIRRICRE-YKIDGVYGPIIELLDCDEKFFTAVEVTAGNSLFHVVVDNDETSTKIIRHL 568
++R + E + G+ + L++ DEK+ AV V G + ++VV N +T+ I+ L
Sbjct: 4 RAVRAVFEEKERFPGLVDVVSNLIEVDEKYSLAVSVLLGGTAQNIVVRNVDTAKAIVEFL 63
Query: 569 NSLKGGRVTFIPLNRVKAPRVTYPK----SNDVIPLLDRLEFSPNFKPAFAQVFARTVIC 624
+ GRVT +PL+ + V +D ++F + + +F +V+
Sbjct: 64 KQNEAGRVTILPLDLIDGSFNRISGLENERGFVGYAVDLVKFPSDLEVLGGFLFGNSVVV 123
Query: 625 RDLDVCTRVARTDGLDC--ITLEGDQVSKKGGMTGG 658
LD R+ + L+ TL+G+ +S +G +TGG
Sbjct: 124 ETLDDAIRMKKKYRLNTRIATLDGELISGRGAITGG 159
|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308 | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Length = 222 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1099 | |||
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 99.94 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 99.9 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 99.88 | |
| d1gxja_ | 161 | Smc hinge domain {Thermotoga maritima [TaxId: 2336 | 99.77 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.68 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.59 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 99.45 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 98.25 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.99 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 97.91 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 97.8 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 97.79 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 97.76 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 97.69 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.69 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 97.67 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.57 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 97.55 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 97.52 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.43 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 97.4 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 97.32 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 97.29 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.2 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 97.16 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.15 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 97.1 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 96.97 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.24 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 96.17 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 96.04 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.97 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.84 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.76 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.66 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.38 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 95.32 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 95.29 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.26 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.24 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.24 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.15 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.14 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.12 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 94.98 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 94.93 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.92 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.92 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 94.91 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.76 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.74 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.64 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 94.63 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.61 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 94.57 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 94.56 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.54 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 94.52 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 94.5 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 94.47 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 94.43 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 94.25 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.14 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 94.13 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 94.03 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.96 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.91 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 93.85 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 93.54 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.53 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 93.52 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 93.42 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 93.42 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 93.41 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.37 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 93.28 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.21 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 93.18 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 93.14 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 92.93 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 92.91 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 92.88 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 92.81 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 92.79 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 92.79 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 92.76 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.66 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 92.61 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 92.59 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 92.59 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 92.53 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 92.48 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 92.39 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 92.39 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 92.28 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 92.26 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 92.25 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 92.23 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.06 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 92.05 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 91.98 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 91.93 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 91.71 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 91.7 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 91.69 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 91.62 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 91.61 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 91.52 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 91.48 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 91.43 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 91.31 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 91.25 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.22 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 91.2 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 91.04 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 91.01 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 91.0 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 90.94 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 90.92 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 90.91 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 90.76 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 90.75 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.74 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 90.72 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 90.4 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.27 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 90.25 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 90.22 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 90.21 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 90.21 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.05 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 89.86 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 89.76 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 89.74 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 89.72 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 89.57 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 89.51 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 89.48 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 89.32 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 89.3 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 88.99 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 88.78 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 88.75 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 88.74 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 88.65 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 88.47 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 88.35 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 88.35 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 88.33 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 88.28 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 88.26 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 88.24 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 88.22 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 88.14 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 87.97 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 87.87 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 87.87 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 87.81 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 87.8 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 87.8 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 87.73 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 87.57 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 87.56 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 87.55 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 87.55 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 87.47 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 87.41 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 87.38 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 87.36 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 87.34 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 87.27 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 87.25 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 87.22 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 87.21 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 87.17 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 87.15 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 87.08 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 87.01 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 86.89 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 86.8 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 86.79 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 86.71 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 86.71 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 86.26 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 86.22 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 86.19 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 86.18 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 85.82 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 85.72 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 85.67 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 85.65 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 85.65 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 85.63 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 85.52 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 85.52 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 85.48 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 85.4 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 85.31 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 85.24 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 85.06 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 85.03 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 84.93 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 84.81 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 84.8 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 84.79 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 84.64 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 84.56 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 84.42 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 84.24 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 84.23 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 84.13 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 84.02 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 83.86 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 83.57 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 83.5 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 83.45 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 83.44 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 83.31 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 83.29 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 83.27 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 83.16 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 83.12 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 82.96 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 82.92 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 82.82 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 82.68 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 82.24 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 81.47 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 81.22 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 81.1 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 80.93 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 80.89 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 80.74 |
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Smc head domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94 E-value=3.9e-27 Score=264.17 Aligned_cols=199 Identities=23% Similarity=0.338 Sum_probs=115.8
Q ss_pred eeeEEEEecccccccccccccCC-CCcEEEEcCCCCChhHHHHHHHHHhcccccccchhhhhhhhccCCCCcceEEEEEE
Q 001328 2 HIKQVIIEGFKSYREQIATEPFS-PQVNCVVGANGSGKTNFFHAIRFVLSDIFQNLRSEDRHALLHEGAGHQVLSAFVEI 80 (1099)
Q Consensus 2 ~i~~l~l~~f~sf~~~~~~~~f~-~~~~~I~G~NGsGKS~i~~ai~~~Lg~~~~~~~~~~~~~~i~~g~~~~~~~a~v~~ 80 (1099)
+|++|.|.||+||.+.+.+ +|+ ||+|+|+||||||||||++||.||||..++.+|+..+.|+||+|... +.+..
T Consensus 2 ki~~l~l~NFks~~~~~~i-~f~~~~l~~i~G~NGsGKS~ileAi~~~lg~~~~~~R~~~~~dli~~g~~~----~~~~~ 76 (427)
T d1w1wa_ 2 RLVGLELSNFKSYRGVTKV-GFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRGVLN----DENSD 76 (427)
T ss_dssp CEEEEEEESCSSCCSEEEE-ECTTCSEEEEECSTTSSHHHHHHHHHHHTTC---------CGGGSCCC------------
T ss_pred eEEEEEEeCeeeeCCCEEE-eCCCCCEEEEECCCCCCHHHHHHHHHHHhCCCccccccccchhheecCCcC----CcceE
Confidence 6999999999999998877 465 89999999999999999999999999988889999999999998752 33333
Q ss_pred EEeCCCCC------------CCCCCccEEEEEEe-ecCCCeEEeCCeecCHHHHHHHHHHcCCCCCCCceeecCchHhHh
Q 001328 81 VFDNSDNR------------IPVDKEEVRLRRTI-GLKKDEYFLDGKHITKTEVMNLLESAGFSRSNPYYVVQQGKIASL 147 (1099)
Q Consensus 81 ~f~~~~~~------------~~~~~~~~~i~R~~-~~~~~~~~in~~~~~~~~~~~l~~~~g~~~~~~~~~i~qg~i~~~ 147 (1099)
.|++.+.. +...+..+.|.|.+ ..+.+.|++||++++.+++..++...|+...++++++.||++..+
T Consensus 77 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~r~i~~~~~~~~~in~~~~~~~~i~~~~~~~~~~~~~~~~~i~q~~~~~~ 156 (427)
T d1w1wa_ 77 DYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQI 156 (427)
T ss_dssp -----------CCEEEEEEEEEETTEEEEEEEEEETTSCEEEEETTEEECHHHHHHHHHHTTCCTTTCTTEECTTCTTHH
T ss_pred EEEeeccccccccccceeeeeccCCcEEEEEEEEccCCceeEecCcccccHHHHHHHHHHcCCCCCCccceechhhhhhh
Confidence 33332211 01245677889988 556789999999999999999999999998888999999999999
Q ss_pred hcCCHHHHHHHHHHhcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001328 148 TLMKDSERLDLLKEIGGTRVYEERRRESLKIMQDTGNKRQQIIQVVKYLDERLKELDE 205 (1099)
Q Consensus 148 ~~~~~~~~~~~lee~~g~~~~~~~~~e~~~~l~~~~~~~~~~~~~~~~l~~~~~~l~~ 205 (1099)
+.++|..++.+++.++|+..|..........+......+.+....+..+..++..+..
T Consensus 157 ~~~~~~~~~~~le~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~i~~e~~~~~~ 214 (427)
T d1w1wa_ 157 AAQSPVELSRMFEEVSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKS 214 (427)
T ss_dssp HHSCHHHHHHTC----------------------------------------------
T ss_pred hhcccccccccccccccccccccccccccccccccccccccccccccccccchhhhhh
Confidence 9999999999999999999998887777777766666666655555555555444443
|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|