Citrus Sinensis ID: 001365
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1092 | ||||||
| 297742873 | 1243 | unnamed protein product [Vitis vinifera] | 0.913 | 0.802 | 0.685 | 0.0 | |
| 224096175 | 1007 | predicted protein [Populus trichocarpa] | 0.898 | 0.974 | 0.649 | 0.0 | |
| 356511089 | 1107 | PREDICTED: calmodulin-binding transcript | 0.990 | 0.977 | 0.605 | 0.0 | |
| 301030829 | 1097 | calmodulin-binding protein [Solanum lyco | 0.969 | 0.965 | 0.623 | 0.0 | |
| 356528461 | 1115 | PREDICTED: calmodulin-binding transcript | 0.987 | 0.966 | 0.593 | 0.0 | |
| 297821451 | 1031 | hypothetical protein ARALYDRAFT_481093 [ | 0.914 | 0.968 | 0.536 | 0.0 | |
| 30681670 | 1032 | calmodulin-binding transcription activat | 0.912 | 0.965 | 0.534 | 0.0 | |
| 110741068 | 1032 | Calmodulin-binding transcription activat | 0.912 | 0.965 | 0.533 | 0.0 | |
| 359494747 | 1702 | PREDICTED: calmodulin-binding transcript | 0.680 | 0.436 | 0.693 | 0.0 | |
| 255580898 | 845 | calmodulin-binding transcription activat | 0.759 | 0.981 | 0.563 | 0.0 |
| >gi|297742873|emb|CBI35638.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1382 bits (3576), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 727/1061 (68%), Positives = 834/1061 (78%), Gaps = 64/1061 (6%)
Query: 54 SGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQ 113
SGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGS+DVLHCYYAHGE+NENFQ
Sbjct: 225 SGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEDNENFQ 284
Query: 114 RRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVEGSQSS 173
RRSYWMLEEELSHIVLVHYREVKGNRT+FNR K EGA SQE EE +PNSE + S SS
Sbjct: 285 RRSYWMLEEELSHIVLVHYREVKGNRTSFNRIKETEGALINSQETEEVVPNSETDCSVSS 344
Query: 174 GFHPNSYQMPSQTADT-SLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGL 232
F NSYQM SQT DT SLNSAQASEYEDAES YN+QASSR HSFL +PV EK DA L
Sbjct: 345 SFPMNSYQMASQTTDTTSLNSAQASEYEDAESAYNHQASSRLHSFL---EPVMEKGDA-L 400
Query: 233 ADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQ 292
PYYP+ +N+YQGK + PGADF S AQ S++SN G++YE KNLDFPSWEDVL+
Sbjct: 401 TAPYYPAPFSNDYQGKLDI-PGADFTSLAQESSSKDSNSVGISYELPKNLDFPSWEDVLE 459
Query: 293 NCSQGVGSQP----------EALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQA 342
NC+ GV S P + +G IP Q +IL + T+SF ++EFGS Q + EWQ
Sbjct: 460 NCNAGVQSMPSQTPFSSTRADTMGIIPKQENEILMQLLTDSFSRKQEFGSDPQGQDEWQT 519
Query: 343 SRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQL 402
S S+HLS WP DQK++ DSA+ L+++ Q A LL+SL P HA+P+ +
Sbjct: 520 SEGYSAHLSKWPGDQKLHSDSAYGLSTRFDIQEANCVDLLNSLEPGHAYPDGQ------- 572
Query: 403 PNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGST--EGLKKLDSFNRWMSKELGDV 460
K+ YSSA+KQ L+D S EGLKK+DSFNRWMSKELGDV
Sbjct: 573 ---------------------KANYSSALKQPLLDSSLTEEGLKKVDSFNRWMSKELGDV 611
Query: 461 KESNMQS---SSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNW 517
ES+MQS SS AYW+TVESENGVD+S +SPQ LDTYM+ PSLSQDQL+SIIDFSPNW
Sbjct: 612 NESHMQSRLSSSAAYWDTVESENGVDESSISPQGHLDTYMLGPSLSQDQLFSIIDFSPNW 671
Query: 518 AYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPF 577
AY SEVKVLI G+FL QQ+AE CKWSCMFGE+EVPAE+++ GVLRCHT K RVPF
Sbjct: 672 AYAGSEVKVLIMGKFLKGQQDAEKCKWSCMFGEVEVPAEVISDGVLRCHTPIHKAERVPF 731
Query: 578 YVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENL-RMQFGKLLCLTSVSTPNYD 636
YVTCSNRL+CSEVREFEYR +HI DVD AD TSE L M+F KLL L S N
Sbjct: 732 YVTCSNRLACSEVREFEYRVNHIRDVDTADVSSGSTSEILLHMRFVKLLSLAPSS--NSG 789
Query: 637 PSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLV 696
SN D LNSKI+SL++++ND+W+ ML LT+EE FS E+ KE+L+QKLLKEKL VWL+
Sbjct: 790 LSNEGDRFPLNSKINSLMEEDNDEWEQMLMLTSEE-FSPEKAKEQLLQKLLKEKLHVWLL 848
Query: 697 QKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYC 756
QKAAEGGKGP VLD GQGVLHFAAALGYDWA+ PTT AGV++NFRDVNGWTALHWAA+C
Sbjct: 849 QKAAEGGKGPNVLDEDGQGVLHFAAALGYDWAIPPTTAAGVSVNFRDVNGWTALHWAAFC 908
Query: 757 GRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAI 816
GRERTV LI+ GAAPGAL+DPTPKYP+GRTPADLASS GHKGIAGYLAES LS+ L ++
Sbjct: 909 GRERTVPFLISQGAAPGALTDPTPKYPAGRTPADLASSNGHKGIAGYLAESALSAHLQSL 968
Query: 817 SLNK-KDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQ 875
L + K+ D AE++G AVQT+ +R PTP+S GDLP +KDSLAAV NATQAAARIHQ
Sbjct: 969 HLKETKEADAAEISGIKAVQTISERSPTPISTGDLP----LKDSLAAVCNATQAAARIHQ 1024
Query: 876 VFRVQSFQKKQLKEYGNDTFGISDERALSLVAVKTQKPGHHDEPVHAAATRIQNKFRSWK 935
VFRVQSFQKKQ KEY + FG+SDE ALSL+AVK+ + G HDEPVHAAATRIQNKFRSWK
Sbjct: 1025 VFRVQSFQKKQQKEYDDGKFGMSDEHALSLIAVKS-RLGQHDEPVHAAATRIQNKFRSWK 1083
Query: 936 GRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGLRGFKSETL 995
GRKDFLIIR++I+KIQA+VRGHQVRKNY+KIIWSVGI+EK+ILRWRR+GSGLRGFK ET
Sbjct: 1084 GRKDFLIIRQRIVKIQAHVRGHQVRKNYRKIIWSVGILEKVILRWRRKGSGLRGFKPETH 1143
Query: 996 TASSSMVATSAKEDDYDFLKEGRKQKEERLQKALARVKSMVQYPEARDQYRRLLNVVNEI 1055
T +SM S+KEDDYDFLKEGRKQ EERLQKALARVKSMVQYPEARDQYRRLLNVV EI
Sbjct: 1144 TEGTSMRDISSKEDDYDFLKEGRKQTEERLQKALARVKSMVQYPEARDQYRRLLNVVTEI 1203
Query: 1056 QETKAM---ALSNAEETADFDDDLVDIEALL-DDTLMPNAS 1092
QETK + AL+++EE ADF DDL+D++ALL DDT MP AS
Sbjct: 1204 QETKVVYDRALNSSEEAADF-DDLIDLQALLDDDTFMPTAS 1243
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224096175|ref|XP_002310562.1| predicted protein [Populus trichocarpa] gi|222853465|gb|EEE91012.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356511089|ref|XP_003524262.1| PREDICTED: calmodulin-binding transcription activator 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|301030829|gb|ADK47999.1| calmodulin-binding protein [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|356528461|ref|XP_003532821.1| PREDICTED: calmodulin-binding transcription activator 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297821451|ref|XP_002878608.1| hypothetical protein ARALYDRAFT_481093 [Arabidopsis lyrata subsp. lyrata] gi|297324447|gb|EFH54867.1| hypothetical protein ARALYDRAFT_481093 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30681670|ref|NP_850023.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] gi|186502240|ref|NP_001118361.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] gi|75328728|sp|Q8GSA7.1|CMTA3_ARATH RecName: Full=Calmodulin-binding transcription activator 3; AltName: Full=Ethylene-induced calmodulin-binding protein 1; Short=EICBP1; AltName: Full=Ethylene-induced calmodulin-binding protein a; Short=EICBP.a; AltName: Full=Signal-responsive protein 1 gi|25229116|gb|AAN74651.1| calmodulin-binding transcription factor SR1 [Arabidopsis thaliana] gi|27311707|gb|AAO00819.1| Unknown protein [Arabidopsis thaliana] gi|41056727|gb|AAR98746.1| ethylene-induced calmodulin-binding protein 1 [Arabidopsis thaliana] gi|330252195|gb|AEC07289.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] gi|330252196|gb|AEC07290.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|110741068|dbj|BAE98628.1| Calmodulin-binding transcription activator 3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|359494747|ref|XP_002269599.2| PREDICTED: calmodulin-binding transcription activator 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255580898|ref|XP_002531268.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223529153|gb|EEF31132.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1092 | |||
| pfam03859 | 119 | pfam03859, CG-1, CG-1 domain | 8e-69 | |
| smart01076 | 118 | smart01076, CG-1, CG-1 domains are highly conserve | 2e-59 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-11 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 3e-10 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 4e-08 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 8e-08 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-07 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 4e-06 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 1e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 2e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 3e-05 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-05 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 1e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 2e-04 | |
| pfam00612 | 21 | pfam00612, IQ, IQ calmodulin-binding motif | 2e-04 | |
| smart00015 | 23 | smart00015, IQ, Calmodulin-binding motif | 4e-04 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 0.004 |
| >gnl|CDD|217766 pfam03859, CG-1, CG-1 domain | Back alignment and domain information |
|---|
Score = 225 bits (575), Expect = 8e-69
Identities = 80/119 (67%), Positives = 97/119 (81%)
Query: 18 ILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRK 77
+L EA+ RWLRP EI IL+N+ K I E P PPSGSLFL++RKV+RYFRKDG+NW+K
Sbjct: 1 LLPEAKSRWLRPEEIYAILQNFEKHFITLEPPTRPPSGSLFLYNRKVVRYFRKDGYNWKK 60
Query: 78 KKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVK 136
KKDGKT +EAHE+LK G V+VL+CYYAHGE+N FQRR YW+L+E+L HIVLVHY VK
Sbjct: 61 KKDGKTTREAHEKLKVGGVEVLNCYYAHGEDNPTFQRRCYWLLDEDLEHIVLVHYLNVK 119
|
CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs. Length = 119 |
| >gnl|CDD|198144 smart01076, CG-1, CG-1 domains are highly conserved domains of about 130 amino-acid residues | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201341 pfam00612, IQ, IQ calmodulin-binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|197470 smart00015, IQ, Calmodulin-binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1092 | |||
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| PF03859 | 118 | CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domain | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.97 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.97 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.97 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.96 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.96 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.96 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.96 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.96 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.95 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.95 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.95 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.95 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.94 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.94 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.94 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.94 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.93 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.93 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.93 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.93 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.92 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.92 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.92 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.91 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.91 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.9 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.9 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.89 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.89 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.87 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.84 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.84 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.84 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.84 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.83 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.81 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.81 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.8 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.79 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.78 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.74 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.74 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.74 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.72 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.72 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.72 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.72 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.71 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.71 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.71 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.7 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.7 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.7 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.69 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.68 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.66 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.64 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.61 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.55 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.51 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.5 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.46 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.45 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.43 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.4 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.36 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.34 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.33 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.3 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.28 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.27 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.26 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.25 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.25 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.23 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.22 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.2 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 99.11 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.1 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.99 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.69 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.65 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.58 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 98.53 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.5 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.42 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.37 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.34 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.3 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.22 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.21 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.2 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.2 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.1 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.1 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.09 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.09 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.03 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.75 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.75 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.72 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 97.68 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 97.63 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 97.47 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 97.4 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.28 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.12 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 97.09 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 96.66 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 96.57 | |
| PTZ00014 | 821 | myosin-A; Provisional | 96.57 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 96.35 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 96.26 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.23 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.15 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 95.54 | |
| PTZ00014 | 821 | myosin-A; Provisional | 95.53 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 95.39 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 94.73 | |
| KOG2128 | 1401 | consensus Ras GTPase-activating protein family - I | 94.22 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 93.2 | |
| cd01175 | 85 | IPT_COE IPT domain of the COE family (Col/Olf-1/EB | 92.82 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 84.12 | |
| KOG0162 | 1106 | consensus Myosin class I heavy chain [Cytoskeleton | 80.23 |
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.9e-129 Score=1164.01 Aligned_cols=932 Identities=43% Similarity=0.660 Sum_probs=660.4
Q ss_pred CCCCChhcHHHHHHHHHHhcCChHHHHHHHHccccceeCcCCCCCCCCCceeeeehhhhhhhcccCccceecCCCcchHH
Q 001365 7 FALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKE 86 (1092)
Q Consensus 7 ~~~~~~~d~~~~~~~~~~rw~~~~e~~~~l~~~~~~~~~~~~~~~p~~g~~~l~~r~~~~~fr~dg~~w~k~~~g~~~~e 86 (1092)
|.....||+..|++|++.|||+|+||+.||+||++|.|+.+||+||.|||+||||||+|||||||||+|||||||||+||
T Consensus 17 ~~sl~~l~~~~ll~~~~~rWl~~~EI~~il~n~~~~~lt~~s~trp~sGS~flfnRk~lr~fRKDGh~WkKkkDGKtirE 96 (975)
T KOG0520|consen 17 FKSLQDLDIQTLLPEAKSRWLTPEEILAILINHEKFTLTVSSPTRPQSGSIFLFNRKVLRYFRKDGHNWKKKKDGKTIRE 96 (975)
T ss_pred hhhhhhhhhhhhhHHHHhccCChHHHHHHHhcccccccccCCCCCCCCCceeeeccHHHHHHhhcchhhhhcCCCCcChH
Confidence 33446799999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhhhhccCCeeeEEEeeccccccccccceeeeccccccccEEEEeeeeccCCccccccccccCCCCCCCCCCccCCCCCC
Q 001365 87 AHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSE 166 (1092)
Q Consensus 87 ~h~~lk~~~~~~~~~~y~~~~~~~~f~rr~y~~~~~~~~~ivlvhy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 166 (1092)
|||||||||+|+||||||||+++|||||||||||++.++||||||||||++.+.. ..+..+..
T Consensus 97 aHe~LKvg~~~~l~~~Y~Hg~~~ptF~RRcYwllq~~~~hIVLVHYl~v~~~~~~-~~~~~~~~---------------- 159 (975)
T KOG0520|consen 97 AHEKLKVGGVEVLHCYYAHGEINPTFQRRCYWLLQQELEHIVLVHYLNVKGNEDA-AKGAGEIF---------------- 159 (975)
T ss_pred HHHhhccCCccceeeeeecccccchHHHHHHHhhccccCceEEEEEeeccccccc-ccCccccc----------------
Confidence 9999999999999999999999999999999999999999999999999987731 11111110
Q ss_pred ccCCCCCCCCCCC-CCCCCccccCCcCcc-cccchhhhhccccCCCCcccccc------ccccchhhhhcccCCCCCCCC
Q 001365 167 VEGSQSSGFHPNS-YQMPSQTADTSLNSA-QASEYEDAESVYNNQASSRFHSF------LDLQQPVAEKIDAGLADPYYP 238 (1092)
Q Consensus 167 ~~~~~~~~~~~~~-~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~ 238 (1092)
.+++++.- ++ ++...| .+|.-. +.+..++++++++.+....+-.. ..-+++.++.. .
T Consensus 160 -~s~~sd~~--~S~~~~~~q---~~~~~~~~~s~~~~v~~i~s~~~~~~~g~~~~~s~~h~i~~~~~~s~--------~- 224 (975)
T KOG0520|consen 160 -SSIISDKA--WSLNQLAGQ---LSPIFHNHSSVNEDVAEINSNQTGNALGSVFGNSRNHRIRLHEVNSL--------D- 224 (975)
T ss_pred -cccccccc--ccHHHhhcc---cCcchhcccchHHHHHHHhhhccccccccccCcchhhhhcccccCCc--------c-
Confidence 11222211 00 011110 112111 33555666665433222222111 00111111100 0
Q ss_pred CCcccCccCccccCCCCCCc---CCcCccCCCCCCCCCCcCCCCCCCCCCChHHHhhhcCCCCCCCCCccCCCCCCCCcc
Q 001365 239 SSLTNNYQGKFSVVPGADFI---SPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDI 315 (1092)
Q Consensus 239 ~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 315 (1092)
.+.......+..... +..++... .... ..+.+...|.+.++++....-....++...
T Consensus 225 -----~~~~~p~s~~s~~~~~~~~~~~~~~~---~~~~-----~rs~~~s~~te~l~n~~~~~~~~g~s~s~~------- 284 (975)
T KOG0520|consen 225 -----PLYKLPVSDDSLNLSAPKPIDLPKGP---TSVK-----QRSSSPSYFTEILGNAPSGLVSQGNSLSSS------- 284 (975)
T ss_pred -----ccccccccCCccccccCCCcccccCC---cchh-----hcCCCCcchhhhcccCCCcccccccccccc-------
Confidence 011111111000000 00000000 0000 011233456776666652111111110000
Q ss_pred CCCCccCCccccccccCcccccccccccccCCcCCCCCCcccccccccccccccccccccccccCccCCCCCCCCCCCCC
Q 001365 316 LGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNME 395 (1092)
Q Consensus 316 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 395 (1092)
+ + .-..|+. + +.+. .+..+ ..+|+|....+.
T Consensus 285 --------l--~--------~i~~~~~--------~----------~~~~-------~~~p~----~~nf~~~ss~~s-- 315 (975)
T KOG0520|consen 285 --------L--Q--------RISSFTG--------L----------DNAA-------YEQPN----SQNFEPNSSLNS-- 315 (975)
T ss_pred --------h--h--------hcccccc--------c----------cccc-------ccCCc----cccccccccCCC--
Confidence 0 0 0001110 0 0000 00000 001100000000
Q ss_pred CcccccCCccccccCCCCCCCcccccccccccchhhhccccc--ccccccccccchhhHHhhhcCccccccccCCCCccc
Q 001365 396 NDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLID--GSTEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYW 473 (1092)
Q Consensus 396 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~dsf~rw~~~~~~~~~~~~~~~s~~~~~ 473 (1092)
.... ...+.+ .....+...+-.-|. ....+ ...+||++.|||+|||+ .|++..|+.-.++-+.+|
T Consensus 316 -~~~~----~~~g~g--~~~~~~sa~~~~~P~-----~~~~~~~~~~~~l~sgdsf~~~~~-t~~e~~d~~q~~s~~~~~ 382 (975)
T KOG0520|consen 316 -HVTG----QSYGQG--LQARSPSATSESRPI-----TSAADAALSELGLKSGDSFSRWAS-TFGEISDLGQDPSGEAVW 382 (975)
T ss_pred -Cccc----cccCcc--ccCCCcccccccCCc-----chhhccccccccccccccccchhh-hhcccccCCCCCcccccc
Confidence 0000 000001 011111111122231 11122 12789999999999996 898888777334445678
Q ss_pred ccccccCCCCCCCCCcccccccccCCCccccCCceEEEeeccccccCCCCeeEEEEecCcCCcccChHHHHHHHcCCcHH
Q 001365 474 ETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEV 553 (1092)
Q Consensus 474 ~~~~~~~~~~~~~~~~~~~l~~~~~~~s~s~~q~fsI~dfSP~wa~s~~~tKVlI~G~fl~~~~~~TpLH~A~~fG~veV 553 (1092)
.+.. +.+.+.+ ..+++| +++|+|+|+||||+|+|.++++||+|+|.+ ...+.-+|.|+||..+|
T Consensus 383 ~p~~--~~~~~~~---------s~~~~S-~p~qlf~I~DfSP~Wsy~~ggvKVlV~G~~----~~~~~~~ysc~Fg~~~V 446 (975)
T KOG0520|consen 383 TPEN--DPMGPPG---------SFLSPS-SPEQLFTITDFSPEWSYLDGGVKVLVTGFP----QDETRSNYSCMFGEQRV 446 (975)
T ss_pred ccCC--CcCCCcc---------cccCCC-CCcceeeeeccCcccccCCCCcEEEEecCc----cccCCCceEEEeCCccc
Confidence 7653 2222221 136677 449999999999999999999999999962 22335679999999999
Q ss_pred HHHHHHCCCCCCCCCCCCCCchHHHHHHH-cCCCchhHHHHHHHHhCCCCcccccCCCCcHHhhhHHHHHHHHhcCCCCC
Q 001365 554 PAEIVAGGVLRCHTSSQKVGRVPFYVTCS-NRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVST 632 (1092)
Q Consensus 554 v~~LL~~Gadin~~~~d~~G~TPLHlAa~-ng~~~seVv~fe~Ll~~Gadvna~D~~G~TpL~~~~~~lvkLLl~gadv~ 632 (1092)
++.||+.||.+|++|++.+|.++|++||. ++..|+++.+|+|+......+|..+.+..+--+....++..++..+..+.
T Consensus 447 PAeliq~GVLrC~~P~h~~G~V~l~V~c~~~~~~~se~ref~~~~~~~~~~d~~s~~d~~~~~sl~~rl~~~~~r~~~~~ 526 (975)
T KOG0520|consen 447 PAELIQEGVLRCYAPPHEPGVVNLQVTCRISGLACSEVREFAYLVQPSQQIDKLSWEDFLFQMSLLHRLETMLNRKQSIL 526 (975)
T ss_pred cHHHhhcceeeeecCccCCCeEEEEEEecccceeeeeehheeecccCcccccccccccchhhhHHHHHHHHHHHHhHhHh
Confidence 99999999999999999999999999999 78889999999999998888888874444444545555555554322221
Q ss_pred C-CCCCCCchhhHH--HHHHHhhhhccCCCcchH-HHHhhhhcCCChHHHHHHHHHHHHHhhhHHHHHHHHHhC-CCCCC
Q 001365 633 P-NYDPSNLSDISQ--LNSKISSLLKDENDDWDL-MLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEG-GKGPC 707 (1092)
Q Consensus 633 ~-~~~~~~~~~~~~--ll~~I~~Ll~~d~~g~t~-L~~a~~~~~~s~~~~~~~lL~~a~k~~l~~~LvklLle~-GadvN 707 (1092)
. ............ +..++..+ .+.|.. ++.....+.....+.++.+|..++++.++.||++.+++. |...+
T Consensus 527 ~s~~~~~n~~~~~~~~l~skv~~l----~~~~~~r~~~~~~~~~~~~~~~r~~lllhL~a~~lyawLie~~~e~~~~~~~ 602 (975)
T KOG0520|consen 527 SSKPSTENTSDAESGNLASKVVHL----LNEWAYRLLKSISENLSSSVNFRDMLLLHLLAELLYAWLIEKVIEWAGSGDL 602 (975)
T ss_pred hccCCccccccccchhHHHHHHHH----HHHHHHHHHhhHhhhccccCCCcchHHHHHHHHHhHHHHHHHHhcccccCch
Confidence 1 111222222223 66666666 466666 777777777777788899999999999999999999996 88888
Q ss_pred cccCCCCcHHHHHHHcCCHhHHHHHHHCCCCccccCCCCccHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCCCCCCC
Q 001365 708 VLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRT 787 (1092)
Q Consensus 708 ~~D~~G~TpLH~AA~~G~~~iVk~LL~~Gadin~~D~~G~TpLH~Aa~~G~~eiV~~LLe~GAdin~~~D~n~~D~~G~T 787 (1092)
..|.+|...+|++|..|+.+.+.+.+..|..++++|..||||||||+..|+..+|..|++.|++.++++||+..+..|.|
T Consensus 603 eld~d~qgV~hfca~lg~ewA~ll~~~~~~ai~i~D~~G~tpL~wAa~~G~e~l~a~l~~lga~~~~~tdps~~~p~g~t 682 (975)
T KOG0520|consen 603 ELDRDGQGVIHFCAALGYEWAFLPISADGVAIDIRDRNGWTPLHWAAFRGREKLVASLIELGADPGAVTDPSPETPGGKT 682 (975)
T ss_pred hhcccCCChhhHhhhcCCceeEEEEeecccccccccCCCCcccchHhhcCHHHHHHHHHHhccccccccCCCCCCCCCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHcCcHHHHHHHHHcCCCCCcccCcccC-CCC-CcHHHHhhhhhccccccCCCCCCCCCCCCCcchhhHHHHHHH
Q 001365 788 PADLASSIGHKGIAGYLAESDLSSALSAISLNK-KDG-DVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRN 865 (1092)
Q Consensus 788 PLhlAa~~G~~eiv~~LLe~Ga~~h~adlnlkD-~~G-~ta~iaa~~~v~~l~~~~as~~s~~~~~~~~sLkdSL~Avrn 865 (1092)
+..+|..+|+.++..+|.++.+..+..++...+ +.| .++...+.. ...+.++.+. ++..+|+|+|+|||+
T Consensus 683 a~~la~s~g~~gia~~lse~~L~~~~~~~~~~~~~~s~~~~~~~~~~---t~~e~s~~~~-----~~~~sl~Dtl~avrd 754 (975)
T KOG0520|consen 683 AADLARANGHKGIAGYLSEKALSAHLSNLELADPNLSADSEEDKAEK---TSSEGSPNPD-----EDSDSLKDTLAAVRD 754 (975)
T ss_pred hhhhhhcccccchHHHHhhhHHHHHHhhccccccccCCCchhhhhhh---ccCCCCCCCC-----ccccccccccccccc
Confidence 999999999999999999999888888888777 443 333332222 2233333333 455569999999999
Q ss_pred HHHHHHHHHHHhhhhhhhHHHHhhhcCCCC-CCchHHHhHHHHHHhcCCC--CCchhHHHHHHHHHHHhhhHHHHHHHHH
Q 001365 866 ATQAAARIHQVFRVQSFQKKQLKEYGNDTF-GISDERALSLVAVKTQKPG--HHDEPVHAAATRIQNKFRSWKGRKDFLI 942 (1092)
Q Consensus 866 A~qAAarIQqafR~~S~rrkq~~~~~~d~~-~~~~e~a~sl~a~k~~~~~--r~~~~l~~AA~~IQ~~~Rg~~~Rk~fl~ 942 (1092)
|+++|++||++||+.+|+++++.+..++.. .+.++.+. +++...++ ...+....||..||++||||+.|++|+.
T Consensus 755 Aa~aa~r~q~vfr~~~~~~~~a~~i~~~~~~~i~~~~~~---~m~~~~a~~~~~~r~~~~aa~~iq~~f~~yk~r~~~l~ 831 (975)
T KOG0520|consen 755 AAQAAARIQAVFRAQSFQKKQAREIMDATKEQISEELAV---SMKASSAFSMCDDRSDPAAASRIQKKFRGYKQRKEFLS 831 (975)
T ss_pred hHHHHHhhhhhhhhhhhhhhhHHHHHhhcchhhhhhhhh---hhhcccchhcCccccchhHHHHhhhhhhhHHhhhhhcc
Confidence 999999999999999999999988776422 33333333 44444433 3355678899999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccccccccccccccCCccchHHHHHHHHHHHH
Q 001365 943 IRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGLRGFKSETLTASSSMVATSAKEDDYDFLKEGRKQKE 1022 (1092)
Q Consensus 943 ~r~~av~IQa~~Rg~~aRk~y~~~~~a~~~iqk~irr~r~kr~glrg~~~~~~~~~~~~~~~~~~~~~~~~~~~~rkq~~ 1022 (1092)
+|+.+|+||+++|||+.||+|+++.|++++++|.|.|||++++|+|||+.+...+..+. +-...++.|||+|++|||.|
T Consensus 832 tr~p~v~iqa~~rg~q~r~dy~ki~wSv~~lek~~lrwR~k~~g~Rgfk~~~~~e~~~~-a~t~~e~~yd~yKq~~~~~~ 910 (975)
T KOG0520|consen 832 TRQPIVKIQAAVRGYQVRKDYRKITWSVGVLEKLILRWRRKGKGFRGFKGRALFEEQET-AATVIEDCYDFYKQLRKQTE 910 (975)
T ss_pred cCCccccchhhhhchhHhhhhheechhhhHHHHHHHHHHHhhhhhcccccccchhcccc-ccchHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999986543221 23355899999999999999
Q ss_pred HHHHHHHHHHHHhhccHHHHHHHHHHHHHHHHHHHHHHhhccccccccCCCCchhhhHHhhcCC-CC
Q 001365 1023 ERLQKALARVKSMVQYPEARDQYRRLLNVVNEIQETKAMALSNAEETADFDDDLVDIEALLDDT-LM 1088 (1092)
Q Consensus 1023 ~~~~~A~~~vQs~~R~~~AR~~yrrl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~-~~ 1088 (1092)
.|+.+|+++||+|+|+++||+|||||+.++.++++.+ ..+.-...+.+.++||+.|+.|+ +|
T Consensus 911 ~r~~~A~~~VQsm~rs~~a~qqyrR~~~~~~~~~~~~----~~~~~~~~~~~~~~~i~~~~~~~~~~ 973 (975)
T KOG0520|consen 911 ERLTRAVVRVQSMFRSPKAQQQYRRLLLVYEQYQESY----KEEALVGLLDDSLFDIEQLQADRKIM 973 (975)
T ss_pred HHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhhh----hhhccccccccchhhhHhhhhhhhhh
Confidence 9999999999999999999999999999999988876 12222234567899999999777 55
|
|
| >PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [] | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >KOG0162 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1092 | ||||
| 2cxk_A | 95 | Crystal Structure Of The Tig Domain Of Human Calmod | 1e-10 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 1e-07 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-06 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 7e-06 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-05 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-05 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 3e-05 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 5e-05 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 7e-05 | ||
| 2dfs_A | 1080 | 3-D Structure Of Myosin-V Inhibited State Length = | 9e-05 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 2e-04 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 3e-04 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 5e-04 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 6e-04 | ||
| 3uxg_A | 172 | Crystal Structure Of Rfxank Length = 172 | 9e-04 |
| >pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95 | Back alignment and structure |
|
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1092 | |||
| 2cxk_A | 95 | Camta1, calmodulin binding transcription activator | 6e-35 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 1e-16 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 9e-04 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 9e-15 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 4e-12 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 9e-09 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 1e-05 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-14 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 5e-12 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 8e-11 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 7e-08 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-07 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-13 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 6e-12 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-10 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 5e-06 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 2e-13 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 4e-11 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 5e-11 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 6e-08 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 4e-07 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-13 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-13 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 3e-11 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-08 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 3e-07 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-13 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 3e-12 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-09 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-09 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-08 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 3e-07 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 7e-06 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-13 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-11 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-10 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 5e-07 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-06 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-13 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-12 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-10 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-10 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-10 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-10 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 5e-09 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-08 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 5e-08 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 5e-13 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 8e-12 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 5e-10 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 3e-06 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 4e-06 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 6e-13 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 3e-12 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 3e-12 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-11 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 7e-07 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 6e-13 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 2e-12 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 9e-11 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 2e-10 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 6e-08 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 6e-05 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 8e-13 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-12 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 7e-11 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-09 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-07 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 3e-06 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 9e-13 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 7e-12 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 8e-12 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 9e-12 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 9e-11 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-10 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 3e-06 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-12 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 4e-12 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-11 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 4e-08 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-05 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-12 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-12 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-11 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 6e-07 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-04 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-12 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-12 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-10 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-07 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 5e-05 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-12 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 5e-12 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 4e-08 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-05 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-12 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 6e-10 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-09 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-07 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-12 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 2e-11 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 6e-07 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 6e-06 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-12 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 7e-12 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-05 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-12 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 7e-11 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 1e-06 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 1e-06 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-12 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 7e-11 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-07 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-12 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-08 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 8e-08 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 4e-12 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 9e-12 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-11 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-10 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-09 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 3e-06 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 4e-12 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 7e-12 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 5e-09 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-08 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-07 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-05 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-05 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 5e-12 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 5e-11 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 6e-11 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 4e-07 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 5e-12 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 5e-09 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 5e-12 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 6e-09 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 1e-08 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 7e-04 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 6e-12 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-11 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 9e-11 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 4e-10 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 4e-07 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 7e-12 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-11 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-11 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-11 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-11 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-10 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-10 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-10 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-05 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 7e-12 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 6e-09 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-08 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 7e-12 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 8e-12 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 8e-09 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 1e-07 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-11 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-11 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-11 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-08 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-08 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 5e-08 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 4e-04 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-11 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-09 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 8e-05 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-11 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-09 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 7e-09 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-08 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-05 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 3e-11 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 5e-10 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 8e-08 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 3e-11 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 6e-11 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-05 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-05 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-11 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 8e-11 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 5e-09 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-08 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 5e-04 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-11 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-10 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-10 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-07 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 7e-05 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 5e-11 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 5e-10 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 6e-10 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 8e-05 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 6e-11 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 8e-11 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 3e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 3e-07 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 7e-11 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-10 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 3e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-05 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 4e-10 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 3e-08 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 1e-07 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 4e-10 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-09 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-08 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-10 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-09 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-06 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 2e-06 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 6e-06 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 5e-05 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 2e-09 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 3e-09 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 5e-06 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-04 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 3e-04 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 7e-09 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 9e-08 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-07 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 6e-07 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-06 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-08 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-08 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 5e-08 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-07 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-05 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 1e-08 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 3e-08 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 5e-08 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 5e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 4e-07 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-05 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 2e-06 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 6e-06 | |
| 3muj_A | 138 | Transcription factor COE3; immunoglobulin like fol | 7e-06 |
| >2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95 | Back alignment and structure |
|---|
Score = 127 bits (320), Expect = 6e-35
Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
Query: 503 SQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGV 562
S + D+SP W+Y VKVLITG + + + +SC+F +I VPA ++ GV
Sbjct: 2 SSGSSGMVTDYSPEWSYPEGGVKVLITGPWQEA-----SNNYSCLFDQISVPASLIQPGV 56
Query: 563 LRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRAS 598
LRC+ + G V V +N++ + V FEY++
Sbjct: 57 LRCYCPAHDTGLVTLQVAFNNQIISNSV-VFEYKSG 91
|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1092 | |||
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.98 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.98 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.98 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.97 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.97 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.97 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.97 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.97 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.97 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.97 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.96 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.96 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.96 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.96 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.96 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.96 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.96 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.96 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.96 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.96 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.96 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.95 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.95 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.95 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.95 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.95 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.95 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.95 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.95 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.95 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.94 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.94 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.94 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.94 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.94 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.94 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.93 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.93 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.93 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.93 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.92 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.92 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.92 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.92 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.92 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.92 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.92 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.91 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.91 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.9 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.9 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.89 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.89 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.88 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.88 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.88 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.88 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.88 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.88 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.88 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.87 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.87 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.87 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.87 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.87 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.86 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.86 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.85 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.85 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.84 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.84 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.83 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.83 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.83 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.83 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.82 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.82 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.82 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.81 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.81 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.81 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.8 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.8 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.79 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.79 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.79 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.79 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.78 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.76 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.76 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.76 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.76 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.75 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.74 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.72 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.72 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.72 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.71 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.68 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.53 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.5 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.44 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 99.08 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.82 | |
| 2cxk_A | 95 | Camta1, calmodulin binding transcription activator | 98.61 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.59 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.34 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 97.58 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 97.39 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 97.36 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 97.25 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 97.24 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.21 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 96.56 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.08 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 94.8 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 94.75 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 89.06 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 86.04 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 85.64 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 84.65 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 83.82 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 83.13 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 82.28 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 80.7 |
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-33 Score=304.76 Aligned_cols=254 Identities=13% Similarity=0.013 Sum_probs=186.3
Q ss_pred CCcccChHHHHHHHcCCcHHHHHHHHCCCCCC-CCCCCCCCchHHHHHHHcCCCchhHHHHHHHHhCCCCcccccCCCCc
Q 001365 534 MSQQEAENCKWSCMFGEIEVPAEIVAGGVLRC-HTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDI 612 (1092)
Q Consensus 534 ~~~~~~TpLH~A~~fG~veVv~~LL~~Gadin-~~~~d~~G~TPLHlAa~ng~~~seVv~fe~Ll~~Gadvna~D~~G~T 612 (1092)
.+..+.||||+||..|+.+++++|++.|++.+ ....+..|.||||+||..|+ +..+++|+..|++++.+|..|.|
T Consensus 5 ~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~~g~t~L~~A~~~g~----~~~v~~Ll~~ga~~~~~~~~g~t 80 (282)
T 1oy3_D 5 VTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGE----ASTVEKLYAAGAGVLVAERGGHT 80 (282)
T ss_dssp CCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTC----HHHHHHHHHTTCCSSCCCTTSCC
T ss_pred cCCCCCcHHHHHHHcCCHHHHHHHHhcCCCcccccccCCCCCCHHHHHHHcCC----HHHHHHHHHcCCCCCCCCCCCCC
Confidence 45678999999999999999999999998833 23567789999999999986 55567899999999999999999
Q ss_pred HHhh----hHHHHHHHHhc-CCCCCCCCCCCCchhhHHHHHHHhhhhccCCCcchHHHHhhhhcCCChHHHHHHHHHHHH
Q 001365 613 TSEN----LRMQFGKLLCL-TSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLL 687 (1092)
Q Consensus 613 pL~~----~~~~lvkLLl~-gadv~~~~~~~~~~~~~~ll~~I~~Ll~~d~~g~t~L~~a~~~~~~s~~~~~~~lL~~a~ 687 (1092)
|||+ ++.+++++|+. ++........ . ...... ......+.++++.+...
T Consensus 81 pL~~A~~~~~~~~v~~Ll~~~~~~~~~~~~-~------~~~~~~--~~~~~~~~~~~~~~~~~----------------- 134 (282)
T 1oy3_D 81 ALHLACRVRAHTCACVLLQPRPSHPRDASD-T------YLTQSQ--DCTPDTSHAPAAVDSQP----------------- 134 (282)
T ss_dssp HHHHHTTTTCHHHHHHHSSSCCSSCCCC----------------------------------------------------
T ss_pred HHHHHHHcCCcchhHhhhccCCCCchhhHH-H------Hhhccc--ccCcchhcchhhhcccc-----------------
Confidence 9995 77889988865 4443322110 0 000000 00001222333322221
Q ss_pred HhhhHHHHHHHHHhCCCCCCcccCCCCcHHHHHHHcCCHhHHHHHHHCCCCccccCCC-CccHHHHHHHcCCHHHHHHHH
Q 001365 688 KEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVN-GWTALHWAAYCGRERTVASLI 766 (1092)
Q Consensus 688 k~~l~~~LvklLle~GadvN~~D~~G~TpLH~AA~~G~~~iVk~LL~~Gadin~~D~~-G~TpLH~Aa~~G~~eiV~~LL 766 (1092)
.....+...+...+++++.+|..|.||||+|+..|+.++|++|+++|++++.++.. |+||||+||..|+.++|++||
T Consensus 135 --~~~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~tpL~~A~~~~~~~~v~~Ll 212 (282)
T 1oy3_D 135 --NPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLL 212 (282)
T ss_dssp -----------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHH
T ss_pred --ccchhhhhhhhhhhhcCCCcCCCCcCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcCHHHHHHHcCCHHHHHHHH
Confidence 11112444556678899999999999999999999999999999999999999865 999999999999999999999
Q ss_pred HcCCCCCCCCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHHcCCCCCcccCcccCCCCCcHHHHh
Q 001365 767 ALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTG 830 (1092)
Q Consensus 767 e~GAdin~~~D~n~~D~~G~TPLhlAa~~G~~eiv~~LLe~Ga~~h~adlnlkD~~G~ta~iaa 830 (1092)
++|++++. +|..|+||||+|+..|+.+++++|+++| ++++.+|..|.+|...+
T Consensus 213 ~~gad~~~------~d~~g~tpL~~A~~~~~~~~v~~Ll~~g-----a~~~~~~~~g~tpl~~a 265 (282)
T 1oy3_D 213 KAGADPTA------RMYGGRTPLGSALLRPNPILARLLRAHG-----APEPEDGGDKLSPCSSS 265 (282)
T ss_dssp HTTCCTTC------CCTTSCCHHHHHHTSSCHHHHHHHHHTT-----CCCCCCC----------
T ss_pred HcCCCCcc------cccCCCCHHHHHHHcCCcHHHHHHHHcC-----CCcCcCCCccccccccc
Confidence 99999888 7899999999999999999999999999 78999999997764433
|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1092 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-10 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-06 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 0.004 | |
| d2cxka1 | 82 | b.1.18.1 (A:872-953) Calmodulin binding transcript | 2e-11 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 3e-10 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-05 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 7e-04 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 3e-09 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 0.001 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 0.002 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 0.003 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 3e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 8e-07 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-06 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-08 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 3e-08 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 0.001 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 0.003 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 3e-08 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-06 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 5e-04 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 6e-04 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 8e-08 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 1e-07 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 4e-07 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 7e-04 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 5e-07 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 5e-04 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 7e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 4e-04 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.002 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 3e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 6e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 4e-04 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 2e-05 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 5e-05 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 3e-04 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.002 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.004 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 8e-05 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 0.003 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-04 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 0.002 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 0.001 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 0.001 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 65.4 bits (158), Expect = 1e-11
Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 6/90 (6%)
Query: 717 LHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALS 776
LH A+ +G+ ++ G + N +V T LH AA G L+ A
Sbjct: 4 LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA------ 57
Query: 777 DPTPKYPSGRTPADLASSIGHKGIAGYLAE 806
K +TP A+ IGH + L E
Sbjct: 58 KVNAKAKDDQTPLHCAARIGHTNMVKLLLE 87
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1092 | |||
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.98 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.96 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.96 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.96 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.95 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.95 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.94 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.94 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.93 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.91 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.91 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.9 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.89 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.89 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.88 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.87 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.87 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.87 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.86 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.84 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.84 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.83 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.82 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.82 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.8 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.77 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.77 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.76 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.76 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.75 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.74 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.72 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.7 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 97.67 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 97.67 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 96.81 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 96.75 | |
| d2cxka1 | 82 | Calmodulin binding transcription activator 1 {Huma | 96.37 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 89.61 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 85.18 |
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Transcription factor inhibitor I-kappa-B-beta, IKBB species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.98 E-value=3.6e-32 Score=288.20 Aligned_cols=238 Identities=14% Similarity=0.018 Sum_probs=176.4
Q ss_pred CcccChHHHHHHHcCCcHHHHHHHHCCCCCC-CCCCCCCCchHHHHHHHcCCCchhHHHHHHHHhCCCCcccccCCCCcH
Q 001365 535 SQQEAENCKWSCMFGEIEVPAEIVAGGVLRC-HTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDIT 613 (1092)
Q Consensus 535 ~~~~~TpLH~A~~fG~veVv~~LL~~Gadin-~~~~d~~G~TPLHlAa~ng~~~seVv~fe~Ll~~Gadvna~D~~G~Tp 613 (1092)
+..|.||||+||..|+.+++++||+.|++.+ ....+..|+||||+||.+|+ ...+++|++.|++++.+|..|.||
T Consensus 6 ~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~----~~iv~~Ll~~ga~i~~~d~~g~tp 81 (255)
T d1oy3d_ 6 TEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGE----ASTVEKLYAAGAGVLVAERGGHTA 81 (255)
T ss_dssp CTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTC----HHHHHHHHHTTCCSSCCCTTSCCH
T ss_pred CcCCCCHHHHHHHcCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhcc----cccccccccccccccccccccchh
Confidence 4568999999999999999999999998855 33567889999999999986 445578999999999999999999
Q ss_pred Hhh----hHHHHHHHHhcCCCCCCCCCCCCchhhHHHHHHHhhhhccCCCcchHHHHhhhhcCCChHHHHHHHHHHHHHh
Q 001365 614 SEN----LRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKE 689 (1092)
Q Consensus 614 L~~----~~~~lvkLLl~gadv~~~~~~~~~~~~~~ll~~I~~Ll~~d~~g~t~L~~a~~~~~~s~~~~~~~lL~~a~k~ 689 (1092)
||. ++.+++++|+............. ....... ......+.... .....
T Consensus 82 L~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~------~~~~~~~-----~~~~~~~~~~~----------------~~~~~ 134 (255)
T d1oy3d_ 82 LHLACRVRAHTCACVLLQPRPSHPRDASDT------YLTQSQD-----CTPDTSHAPAA----------------VDSQP 134 (255)
T ss_dssp HHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------------------------
T ss_pred hhhhhccCchHHHHHHHhhccchhcccchh------hhhHHhh-----hcccchHHHHH----------------HHhhc
Confidence 985 66778877765332222111000 0000000 00000000000 00000
Q ss_pred hhHHHHHHHHHhCCCCCCcccCCCCcHHHHHHHcCCHhHHHHHHHCCCCcccc-CCCCccHHHHHHHcCCHHHHHHHHHc
Q 001365 690 KLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFR-DVNGWTALHWAAYCGRERTVASLIAL 768 (1092)
Q Consensus 690 ~l~~~LvklLle~GadvN~~D~~G~TpLH~AA~~G~~~iVk~LL~~Gadin~~-D~~G~TpLH~Aa~~G~~eiV~~LLe~ 768 (1092)
.........+...+.+++.+|..|.||||+||..|+.++|++|+++|++++.. +..|.||||+||..|+.++|++|+++
T Consensus 135 ~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~ 214 (255)
T d1oy3d_ 135 NPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKA 214 (255)
T ss_dssp ---------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHT
T ss_pred chhHHHHHHhhhcCcccccccccCcccccccccccccccccchhcccccccccccccccccccccccccHHHHHHHHHHC
Confidence 01111333344567788999999999999999999999999999999998865 67899999999999999999999999
Q ss_pred CCCCCCCCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHHcCC
Q 001365 769 GAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDL 809 (1092)
Q Consensus 769 GAdin~~~D~n~~D~~G~TPLhlAa~~G~~eiv~~LLe~Ga 809 (1092)
|++++. +|..|.||||+|+.+|+.+++++|+++|+
T Consensus 215 gadin~------~d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga 249 (255)
T d1oy3d_ 215 GADPTA------RMYGGRTPLGSALLRPNPILARLLRAHGA 249 (255)
T ss_dssp TCCTTC------CCTTSCCHHHHHHTSSCHHHHHHHHHTTC
T ss_pred CCCCCC------CCCCCCCHHHHHHHCCCHHHHHHHHHcCC
Confidence 999887 78999999999999999999999999994
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|