Citrus Sinensis ID: 001365


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090--
MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVEGSQSSGFHPNSYQMPSQTADTSLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRVQSFQKKQLKEYGNDTFGISDERALSLVAVKTQKPGHHDEPVHAAATRIQNKFRSWKGRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGLRGFKSETLTASSSMVATSAKEDDYDFLKEGRKQKEERLQKALARVKSMVQYPEARDQYRRLLNVVNEIQETKAMALSNAEETADFDDDLVDIEALLDDTLMPNAS
ccccccccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccEEEEEcHHHHHHcccccccEEccccccHHHHHHHcccccEEEEEEEEEcccccccHHHHHccccccccccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEEEccccccccccccccEEEEEccccccEEEEccccEEEEccccccccccEEEEEcccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHccHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHcccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccccHHHHHHHHccccccccc
cccHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccEEEEEccEEEEEEEccccccEEcccccccHHHHHHHccccEEEEEEEEEcccccccHHHHHHHHHccccccEEEEEEEEccccccccccccccccccccccccHccccHHHHHHHccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEccccccccccccccEEEEEcccEccHHEEcccEEEEEccccccccEEEEEEEcccEEcccEEEEEEccccccccccccccccccHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccEEEccEEEccEEEccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccHHHHHHHcccccccccc
madsrrfaLGNQLDIEQILIEAQHRWLRPAEICEILRNYtkfriapesphtppsgslflfdRKVLRYFRkdghnwrkkkdgktVKEAHERLKAGSVDVLHCYYahgeenenfQRRSYWMLEEELSHIVLVHYRevkgnrtnfnrakvaegatpysqeneetipnsevegsqssgfhpnsyqmpsqtadtslnsaqaseyedaesvynnqassrfhsfldlQQPVAEKidagladpyypssltnnyqgkfsvvpgadfispaqtdksrnsndtgltyepqknldfpswEDVLQNcsqgvgsqpealgdipnqgydilgepftnsfgerkefgshlqtrgewqasrndsshlsnwpmdqkvyldsahdltsqsceqgaahdglldslrpphahpnmendvheqlpnaehghllksdpessltidgksfYSSAIKQHLIDGSTEGLKKLDSFNRWMSKElgdvkesnmqsssgaywetvesengvddsgvspqarldtymmspslsqdqlysiidfspnwayvSSEVKVLITGRFLMSQqeaenckwscmfgeievpaeIVAGGVlrchtssqkvgrvpfyvtcsnrlscsevrefeyrashipdvdvadncgditsenLRMQFGKLLCltsvstpnydpsnlsdisQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKaaeggkgpcvldhcgqGVLHFAAALgydwalepttvagvninfrdvngwTALHWAAYCGRERTVASLIALgaapgalsdptpkypsgrtpadlassighkgiAGYLAESDLSSALSAISlnkkdgdvaevtgatavqtvpqrcptpvsdgdlpyglsmKDSLAAVRNATQAAARIHQVFRVQSFQKKQLKeygndtfgisDERALSLVAvktqkpghhdepvHAAATRIQNKFRSWKGRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRrrgsglrgfksetltASSSMVatsakeddydFLKEGRKQKEERLQKALARVKSMVQYPEARDQYRRLLNVVNEIQETKAMALSnaeetadfdddLVDIEALLddtlmpnas
madsrrfalgnqLDIEQILIEaqhrwlrpAEICEILRNYTKFRiapesphtppsgslflfDRKVLRYfrkdghnwrkkkdgktvkeaherlkagsvdvLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYrevkgnrtnfnrakvaegatpysqeneeTIPNSEVEGSQSSGFHPNSYQMPSQTADTSLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFIspaqtdksrnsndTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKElgdvkesnmqSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTssqkvgrvpfyvTCSNRLSCSEVREFEYrashipdvdvaDNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAeekfsseeVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTGatavqtvpqrcptpvsDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRVQSFQKKQLKEYGNDTFGISDERALSLVAVKTqkpghhdepvhAAATriqnkfrswkgrkdFLIIRKQIIKiqayvrghqvrknykkiiwsvgimekIILRwrrrgsglrgfksetltasssmvatsakeddydFLKEGRKQKEERLQKALARVKsmvqypeardQYRRLLNVVNEIQETKAMALSNAEETADFDDDLVDIEALlddtlmpnas
MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVEGSQSSGFHPNSYQMPSQTADTSLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAeekfsseevkeklvqkllkeklqvwlvqkAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYlaesdlssalsaislNKKDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLaavrnatqaaaRIHQVFRVQSFQKKQLKEYGNDTFGISDERALSLVAVKTQKPGHHDEPVHAAATRIQNKFRSWKGRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIIlrwrrrgsglrgFKSETLTASSSMVATSAKEDDYDFLKEGRKQKEERLQKALARVKSMVQYPEARDQYRRLLNVVNEIQETKAMALSNAEETADFDDDLVDIEALLDDTLMPNAS
******FALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIA**********SLFLFDRKVLRYFRKDGHNWRK***********ERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNF*************************************************************************SFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADF****************************SWEDVLQNC****************QGYDILGE************************************************************************************************************Y**AIKQHLI********************************************************************DQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVST***************************DWDLMLKLT***********EKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAA***************************GIAGYLA**********************VTGATAVQ***************PYGLSMKDSLAAVRNATQAAARIHQVFRVQSFQKKQLKEYGNDTFGISDERALSLVAVK***********HAAATRIQNKFRSWKGRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGLR*************************************************Y***RDQYRRLLNVVNEIQET*************FDDDLVDIEALL*********
*********GNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAP****TPPSGSLFLFDRKVLRYFRKDGHNWRKKK*****KEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGN************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************IDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNY**S**SDISQLNSKISSLLKDENDDWDLMLK**A***FSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESD********************TGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRVQSFQKKQLKEYGNDTFGISDERALSLVAVK********EPVHAAATRIQNKFRSWKGRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRG*****************************LKEGRKQKEERLQKALARVKSMVQYPEARDQYRRLLNV***********************DLVDIEALLDDTLMPN**
MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHN*************HERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGA***********************FHPNSY***********************SVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKE*******************HLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKELGDV*************************GVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRVQSFQKKQLKEYGNDTFGISDERALSLVAVK**********VHAAATRIQNKFRSWKGRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGLRGFKSETLTASSSMVATSAKEDDYDFLKEGRKQKEERLQKALARVKSMVQYPEARDQYRRLLNVVNEIQETKAMALSNAEETADFDDDLVDIEALLDDTLMPNAS
*****RFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGN***FNRAKVAE**********ETIP*SEVEGSQSSGFHPN***M*******SLNSAQ*SE*EDAESVYNNQASSRFHSFLDL******************************************************************************************************************************************************************************************************************************LKKLDSFNRWMSKELGDVKE**********************************MMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAIS*******************************DLPYGLSMKDSLAAVRNATQAAARIHQVFRVQSFQKKQLKEYGNDTFGISDERALSLVAVKTQKPGHHDEPVHAAATRIQNKFRSWKGRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGL********************EDDYDFLKEGRKQKEERLQKALARVKSMVQYPEARDQYRRLLNVVNEIQETKA*************DDLVDI***LDDTL*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVEGSQSSGFHPNSYQMPSQTADTSLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRVQSFQKKQLKEYGNDTFGISDERALSLVAVKTQKPGHHDEPVHAAATRIQNKFRSWKGRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGLRGFKSETLTASSSMVATSAKEDDxxxxxxxxxxxxxxxxxxxxxVKSMVQYPEARDQYRRLLNVVNEIQETKAMALSNAEETADFDDDLVDIEALLDDTLMPNAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1092 2.2.26 [Sep-21-2011]
Q8GSA71032 Calmodulin-binding transc yes no 0.912 0.965 0.534 0.0
Q6NPP41050 Calmodulin-binding transc no no 0.925 0.962 0.481 0.0
Q9FY741007 Calmodulin-binding transc no no 0.588 0.638 0.514 0.0
Q9FYG21016 Calmodulin-binding transc no no 0.515 0.554 0.386 1e-100
Q9LSP8838 Calmodulin-binding transc no no 0.543 0.708 0.334 3e-83
O23463923 Calmodulin-binding transc no no 0.523 0.619 0.331 1e-79
Q9Y6Y1 1673 Calmodulin-binding transc yes no 0.104 0.068 0.420 2e-16
A2A891 1682 Calmodulin-binding transc yes no 0.104 0.067 0.420 2e-16
O949831202 Calmodulin-binding transc no no 0.103 0.094 0.385 1e-14
Q80Y501208 Calmodulin-binding transc no no 0.103 0.093 0.370 1e-12
>sp|Q8GSA7|CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana GN=CMTA3 PE=1 SV=1 Back     alignment and function desciption
 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1114 (53%), Positives = 750/1114 (67%), Gaps = 118/1114 (10%)

Query: 1    MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLF 60
            MA++RRF+  ++LD+ QIL EA+HRWLRP EICEIL+NY +F+I+ E P TP SGS+F+F
Sbjct: 1    MAEARRFSPVHELDVGQILSEARHRWLRPPEICEILQNYQRFQISTEPPTTPSSGSVFMF 60

Query: 61   DRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWML 120
            DRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHG++NENFQRRSYW+L
Sbjct: 61   DRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQRRSYWLL 120

Query: 121  EEELSHIVLVHYREVKGNR--TNFNRAKVAEGATPYSQENEETIPNSEVEGSQSSGFHPN 178
            +EELSHIV VHY EVKG+R  T+FNR +  E A    QE  + +  SE +G  S  F+ N
Sbjct: 121  QEELSHIVFVHYLEVKGSRVSTSFNRMQRTEDAARSPQETGDAL-TSEHDGYASCSFNQN 179

Query: 179  SYQMPSQTADT-SLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYY 237
             +   SQT D+ S+N   + E EDAES YN   SS  +S  +LQQP       G  DPYY
Sbjct: 180  DHSNHSQTTDSASVNGFHSPELEDAESAYNQHGSSTAYSHQELQQPATGGNLTGF-DPYY 238

Query: 238  PSSLT--NNYQGKFSVVPGADFISPAQTDKSRNSNDTGLT--YEPQKNLDFPSWEDVLQN 293
              SLT  ++YQ +   +P  D  S    DKS+  N  G+T   + +K++D  +WE++L N
Sbjct: 239  QISLTPRDSYQKELRTIPVTD--SSIMVDKSKTINSPGVTNGLKNRKSIDSQTWEEILGN 296

Query: 294  CSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSN- 352
            C  GV    EAL   PN  +++L +   +SF   ++F S  ++  + Q    +S   S+ 
Sbjct: 297  CGSGV----EALPLQPNSEHEVLDQILESSF-TMQDFASLQESMVKSQNQELNSGLTSDR 351

Query: 353  --WPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHL 410
              W   Q + L++  +L S                             +E+ P       
Sbjct: 352  TVWFQGQDMELNAISNLAS-----------------------------NEKAP------- 375

Query: 411  LKSDPESSLTIDGKSFYSSAIKQHLIDGST--EGLKKLDSFNRWMSKELGDV------KE 462
                            Y S +KQHL+ G+   EGLKK+DSFNRWMSKELGDV       E
Sbjct: 376  ----------------YLSTMKQHLLHGALGEEGLKKMDSFNRWMSKELGDVGVIADANE 419

Query: 463  SNMQSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSS 522
            S  QSSS  YWE VESE+G   +G + +  +D Y+MSPSLS++QL+SI DFSP+WAYV  
Sbjct: 420  SFTQSSSRTYWEEVESEDG--SNGHNSRRDMDGYVMSPSLSKEQLFSINDFSPSWAYVGC 477

Query: 523  EVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCS 582
            EV V +TG+FL +++E E  +WSCMFG+ EVPA++++ G+L+C     + GRVPFYVTCS
Sbjct: 478  EVVVFVTGKFLKTREETEIGEWSCMFGQTEVPADVISNGILQCVAPMHEAGRVPFYVTCS 537

Query: 583  NRLSCSEVREFEYRA--SHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNL 640
            NRL+CSEVREFEY+   S + D +  D     T + L  +F KLLC  S +T      N 
Sbjct: 538  NRLACSEVREFEYKVAESQVFDREADDES---TIDILEARFVKLLCSKSENTSPVS-GND 593

Query: 641  SDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAA 700
            SD+SQL+ KIS LL + +D  D ML      + S E +K  L+Q+ LKE L  WL+QK A
Sbjct: 594  SDLSQLSEKISLLLFENDDQLDQMLM----NEISQENMKNNLLQEFLKESLHSWLLQKIA 649

Query: 701  EGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRER 760
            EGGKGP VLD  GQGVLHFAA+LGY+WALEPT +AGV+++FRDVNGWTALHWAA+ GRER
Sbjct: 650  EGGKGPSVLDEGGQGVLHFAASLGYNWALEPTIIAGVSVDFRDVNGWTALHWAAFFGRER 709

Query: 761  TVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNK 820
             + SLIALGAAPG L+DP P +PSG TP+DLA + GHKGIAGYL+E  L + +S +SLN 
Sbjct: 710  IIGSLIALGAAPGTLTDPNPDFPSGSTPSDLAYANGHKGIAGYLSEYALRAHVSLLSLND 769

Query: 821  KDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRVQ 880
            K+ +  E+  + +  +                   + DSL AVRNATQAAARIHQVFR Q
Sbjct: 770  KNAETVEMAPSPSSSS-------------------LTDSLTAVRNATQAAARIHQVFRAQ 810

Query: 881  SFQKKQLKEYGNDTFGISDERALSLVAVKTQKPG--HHDEPVHAAATRIQNKFRSWKGRK 938
            SFQKKQLKE+G+   G+S+ERALS++A KT K G  H D+ V AAA RIQNKFR +KGRK
Sbjct: 811  SFQKKQLKEFGDKKLGMSEERALSMLAPKTHKSGRAHSDDSVQAAAIRIQNKFRGYKGRK 870

Query: 939  DFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGLRGFKSETLTAS 998
            D+LI R++IIKIQA+VRG+Q RKNY+KIIWSVG++EK+ILRWRR+G+GLRGFKSE L   
Sbjct: 871  DYLITRQRIIKIQAHVRGYQFRKNYRKIIWSVGVLEKVILRWRRKGAGLRGFKSEALV-- 928

Query: 999  SSMVATSAKEDDYDFLKEGRKQKEERLQKALARVKSMVQYPEARDQYRRLLNVVNEIQET 1058
              M   + KE+D DF K+GRKQ E+RLQKALARVKSMVQYPEARDQYRRLLNVVN+IQE+
Sbjct: 929  EKMQDGTEKEEDDDFFKQGRKQTEDRLQKALARVKSMVQYPEARDQYRRLLNVVNDIQES 988

Query: 1059 KA-MALSNAEETA-DFDDDLVDIEALL--DDTLM 1088
            K   AL N+E T  D DDDL+DIEALL  DDTLM
Sbjct: 989  KVEKALENSEATCFDDDDDLIDIEALLEDDDTLM 1022




Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6NPP4|CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana GN=CMTA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FY74|CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana GN=CMTA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FYG2|CMTA4_ARATH Calmodulin-binding transcription activator 4 OS=Arabidopsis thaliana GN=CMTA4 PE=1 SV=1 Back     alignment and function description
>sp|Q9LSP8|CMTA6_ARATH Calmodulin-binding transcription activator 6 OS=Arabidopsis thaliana GN=CMTA6 PE=2 SV=1 Back     alignment and function description
>sp|O23463|CMTA5_ARATH Calmodulin-binding transcription activator 5 OS=Arabidopsis thaliana GN=CMTA5 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens GN=CAMTA1 PE=1 SV=4 Back     alignment and function description
>sp|A2A891|CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus GN=Camta1 PE=2 SV=1 Back     alignment and function description
>sp|O94983|CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens GN=CAMTA2 PE=1 SV=3 Back     alignment and function description
>sp|Q80Y50|CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus GN=Camta2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1092
297742873 1243 unnamed protein product [Vitis vinifera] 0.913 0.802 0.685 0.0
2240961751007 predicted protein [Populus trichocarpa] 0.898 0.974 0.649 0.0
3565110891107 PREDICTED: calmodulin-binding transcript 0.990 0.977 0.605 0.0
3010308291097 calmodulin-binding protein [Solanum lyco 0.969 0.965 0.623 0.0
3565284611115 PREDICTED: calmodulin-binding transcript 0.987 0.966 0.593 0.0
2978214511031 hypothetical protein ARALYDRAFT_481093 [ 0.914 0.968 0.536 0.0
306816701032 calmodulin-binding transcription activat 0.912 0.965 0.534 0.0
1107410681032 Calmodulin-binding transcription activat 0.912 0.965 0.533 0.0
359494747 1702 PREDICTED: calmodulin-binding transcript 0.680 0.436 0.693 0.0
255580898845 calmodulin-binding transcription activat 0.759 0.981 0.563 0.0
>gi|297742873|emb|CBI35638.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1382 bits (3576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/1061 (68%), Positives = 834/1061 (78%), Gaps = 64/1061 (6%)

Query: 54   SGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQ 113
            SGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGS+DVLHCYYAHGE+NENFQ
Sbjct: 225  SGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEDNENFQ 284

Query: 114  RRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVEGSQSS 173
            RRSYWMLEEELSHIVLVHYREVKGNRT+FNR K  EGA   SQE EE +PNSE + S SS
Sbjct: 285  RRSYWMLEEELSHIVLVHYREVKGNRTSFNRIKETEGALINSQETEEVVPNSETDCSVSS 344

Query: 174  GFHPNSYQMPSQTADT-SLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGL 232
             F  NSYQM SQT DT SLNSAQASEYEDAES YN+QASSR HSFL   +PV EK DA L
Sbjct: 345  SFPMNSYQMASQTTDTTSLNSAQASEYEDAESAYNHQASSRLHSFL---EPVMEKGDA-L 400

Query: 233  ADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQ 292
              PYYP+  +N+YQGK  + PGADF S AQ   S++SN  G++YE  KNLDFPSWEDVL+
Sbjct: 401  TAPYYPAPFSNDYQGKLDI-PGADFTSLAQESSSKDSNSVGISYELPKNLDFPSWEDVLE 459

Query: 293  NCSQGVGSQP----------EALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQA 342
            NC+ GV S P          + +G IP Q  +IL +  T+SF  ++EFGS  Q + EWQ 
Sbjct: 460  NCNAGVQSMPSQTPFSSTRADTMGIIPKQENEILMQLLTDSFSRKQEFGSDPQGQDEWQT 519

Query: 343  SRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQL 402
            S   S+HLS WP DQK++ DSA+ L+++   Q A    LL+SL P HA+P+ +       
Sbjct: 520  SEGYSAHLSKWPGDQKLHSDSAYGLSTRFDIQEANCVDLLNSLEPGHAYPDGQ------- 572

Query: 403  PNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGST--EGLKKLDSFNRWMSKELGDV 460
                                 K+ YSSA+KQ L+D S   EGLKK+DSFNRWMSKELGDV
Sbjct: 573  ---------------------KANYSSALKQPLLDSSLTEEGLKKVDSFNRWMSKELGDV 611

Query: 461  KESNMQS---SSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNW 517
             ES+MQS   SS AYW+TVESENGVD+S +SPQ  LDTYM+ PSLSQDQL+SIIDFSPNW
Sbjct: 612  NESHMQSRLSSSAAYWDTVESENGVDESSISPQGHLDTYMLGPSLSQDQLFSIIDFSPNW 671

Query: 518  AYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPF 577
            AY  SEVKVLI G+FL  QQ+AE CKWSCMFGE+EVPAE+++ GVLRCHT   K  RVPF
Sbjct: 672  AYAGSEVKVLIMGKFLKGQQDAEKCKWSCMFGEVEVPAEVISDGVLRCHTPIHKAERVPF 731

Query: 578  YVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENL-RMQFGKLLCLTSVSTPNYD 636
            YVTCSNRL+CSEVREFEYR +HI DVD AD     TSE L  M+F KLL L   S  N  
Sbjct: 732  YVTCSNRLACSEVREFEYRVNHIRDVDTADVSSGSTSEILLHMRFVKLLSLAPSS--NSG 789

Query: 637  PSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLV 696
             SN  D   LNSKI+SL++++ND+W+ ML LT+EE FS E+ KE+L+QKLLKEKL VWL+
Sbjct: 790  LSNEGDRFPLNSKINSLMEEDNDEWEQMLMLTSEE-FSPEKAKEQLLQKLLKEKLHVWLL 848

Query: 697  QKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYC 756
            QKAAEGGKGP VLD  GQGVLHFAAALGYDWA+ PTT AGV++NFRDVNGWTALHWAA+C
Sbjct: 849  QKAAEGGKGPNVLDEDGQGVLHFAAALGYDWAIPPTTAAGVSVNFRDVNGWTALHWAAFC 908

Query: 757  GRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAI 816
            GRERTV  LI+ GAAPGAL+DPTPKYP+GRTPADLASS GHKGIAGYLAES LS+ L ++
Sbjct: 909  GRERTVPFLISQGAAPGALTDPTPKYPAGRTPADLASSNGHKGIAGYLAESALSAHLQSL 968

Query: 817  SLNK-KDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQ 875
             L + K+ D AE++G  AVQT+ +R PTP+S GDLP    +KDSLAAV NATQAAARIHQ
Sbjct: 969  HLKETKEADAAEISGIKAVQTISERSPTPISTGDLP----LKDSLAAVCNATQAAARIHQ 1024

Query: 876  VFRVQSFQKKQLKEYGNDTFGISDERALSLVAVKTQKPGHHDEPVHAAATRIQNKFRSWK 935
            VFRVQSFQKKQ KEY +  FG+SDE ALSL+AVK+ + G HDEPVHAAATRIQNKFRSWK
Sbjct: 1025 VFRVQSFQKKQQKEYDDGKFGMSDEHALSLIAVKS-RLGQHDEPVHAAATRIQNKFRSWK 1083

Query: 936  GRKDFLIIRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGLRGFKSETL 995
            GRKDFLIIR++I+KIQA+VRGHQVRKNY+KIIWSVGI+EK+ILRWRR+GSGLRGFK ET 
Sbjct: 1084 GRKDFLIIRQRIVKIQAHVRGHQVRKNYRKIIWSVGILEKVILRWRRKGSGLRGFKPETH 1143

Query: 996  TASSSMVATSAKEDDYDFLKEGRKQKEERLQKALARVKSMVQYPEARDQYRRLLNVVNEI 1055
            T  +SM   S+KEDDYDFLKEGRKQ EERLQKALARVKSMVQYPEARDQYRRLLNVV EI
Sbjct: 1144 TEGTSMRDISSKEDDYDFLKEGRKQTEERLQKALARVKSMVQYPEARDQYRRLLNVVTEI 1203

Query: 1056 QETKAM---ALSNAEETADFDDDLVDIEALL-DDTLMPNAS 1092
            QETK +   AL+++EE ADF DDL+D++ALL DDT MP AS
Sbjct: 1204 QETKVVYDRALNSSEEAADF-DDLIDLQALLDDDTFMPTAS 1243




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224096175|ref|XP_002310562.1| predicted protein [Populus trichocarpa] gi|222853465|gb|EEE91012.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356511089|ref|XP_003524262.1| PREDICTED: calmodulin-binding transcription activator 3-like [Glycine max] Back     alignment and taxonomy information
>gi|301030829|gb|ADK47999.1| calmodulin-binding protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356528461|ref|XP_003532821.1| PREDICTED: calmodulin-binding transcription activator 3-like [Glycine max] Back     alignment and taxonomy information
>gi|297821451|ref|XP_002878608.1| hypothetical protein ARALYDRAFT_481093 [Arabidopsis lyrata subsp. lyrata] gi|297324447|gb|EFH54867.1| hypothetical protein ARALYDRAFT_481093 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30681670|ref|NP_850023.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] gi|186502240|ref|NP_001118361.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] gi|75328728|sp|Q8GSA7.1|CMTA3_ARATH RecName: Full=Calmodulin-binding transcription activator 3; AltName: Full=Ethylene-induced calmodulin-binding protein 1; Short=EICBP1; AltName: Full=Ethylene-induced calmodulin-binding protein a; Short=EICBP.a; AltName: Full=Signal-responsive protein 1 gi|25229116|gb|AAN74651.1| calmodulin-binding transcription factor SR1 [Arabidopsis thaliana] gi|27311707|gb|AAO00819.1| Unknown protein [Arabidopsis thaliana] gi|41056727|gb|AAR98746.1| ethylene-induced calmodulin-binding protein 1 [Arabidopsis thaliana] gi|330252195|gb|AEC07289.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] gi|330252196|gb|AEC07290.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110741068|dbj|BAE98628.1| Calmodulin-binding transcription activator 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359494747|ref|XP_002269599.2| PREDICTED: calmodulin-binding transcription activator 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255580898|ref|XP_002531268.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223529153|gb|EEF31132.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GSA7CMTA3_ARATHNo assigned EC number0.53410.91200.9651yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1092
pfam03859119 pfam03859, CG-1, CG-1 domain 8e-69
smart01076118 smart01076, CG-1, CG-1 domains are highly conserve 2e-59
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-08
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
pfam0061221 pfam00612, IQ, IQ calmodulin-binding motif 2e-04
smart0001523 smart00015, IQ, Calmodulin-binding motif 4e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.004
>gnl|CDD|217766 pfam03859, CG-1, CG-1 domain Back     alignment and domain information
 Score =  225 bits (575), Expect = 8e-69
 Identities = 80/119 (67%), Positives = 97/119 (81%)

Query: 18  ILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRK 77
           +L EA+ RWLRP EI  IL+N+ K  I  E P  PPSGSLFL++RKV+RYFRKDG+NW+K
Sbjct: 1   LLPEAKSRWLRPEEIYAILQNFEKHFITLEPPTRPPSGSLFLYNRKVVRYFRKDGYNWKK 60

Query: 78  KKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVK 136
           KKDGKT +EAHE+LK G V+VL+CYYAHGE+N  FQRR YW+L+E+L HIVLVHY  VK
Sbjct: 61  KKDGKTTREAHEKLKVGGVEVLNCYYAHGEDNPTFQRRCYWLLDEDLEHIVLVHYLNVK 119


CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs. Length = 119

>gnl|CDD|198144 smart01076, CG-1, CG-1 domains are highly conserved domains of about 130 amino-acid residues Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|201341 pfam00612, IQ, IQ calmodulin-binding motif Back     alignment and domain information
>gnl|CDD|197470 smart00015, IQ, Calmodulin-binding motif Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1092
KOG0520975 consensus Uncharacterized conserved protein, conta 100.0
PF03859118 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domain 100.0
PHA03095471 ankyrin-like protein; Provisional 99.97
PHA02946446 ankyin-like protein; Provisional 99.97
PHA02875413 ankyrin repeat protein; Provisional 99.97
PHA03100480 ankyrin repeat protein; Provisional 99.97
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA02878477 ankyrin repeat protein; Provisional 99.96
PHA02876682 ankyrin repeat protein; Provisional 99.96
PHA02874434 ankyrin repeat protein; Provisional 99.96
PHA03095471 ankyrin-like protein; Provisional 99.96
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.96
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.96
PHA02791284 ankyrin-like protein; Provisional 99.96
PHA03100480 ankyrin repeat protein; Provisional 99.96
PHA02946446 ankyin-like protein; Provisional 99.96
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.95
PHA02989494 ankyrin repeat protein; Provisional 99.95
PHA02876682 ankyrin repeat protein; Provisional 99.95
PHA02874434 ankyrin repeat protein; Provisional 99.95
PHA02730672 ankyrin-like protein; Provisional 99.95
KOG0510 929 consensus Ankyrin repeat protein [General function 99.95
PHA02798489 ankyrin-like protein; Provisional 99.95
PHA02989494 ankyrin repeat protein; Provisional 99.94
PHA02878477 ankyrin repeat protein; Provisional 99.94
PHA02791284 ankyrin-like protein; Provisional 99.94
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
PHA02875413 ankyrin repeat protein; Provisional 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.93
PHA02798489 ankyrin-like protein; Provisional 99.93
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.93
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.92
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.92
PHA02917661 ankyrin-like protein; Provisional 99.92
PHA02859209 ankyrin repeat protein; Provisional 99.91
PHA02917 661 ankyrin-like protein; Provisional 99.91
PHA02730672 ankyrin-like protein; Provisional 99.9
PHA02792631 ankyrin-like protein; Provisional 99.9
KOG0508615 consensus Ankyrin repeat protein [General function 99.89
PHA02795437 ankyrin-like protein; Provisional 99.89
PHA02859209 ankyrin repeat protein; Provisional 99.87
PHA02792631 ankyrin-like protein; Provisional 99.84
PLN03192823 Voltage-dependent potassium channel; Provisional 99.84
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.84
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.84
PLN03192823 Voltage-dependent potassium channel; Provisional 99.83
KOG0514452 consensus Ankyrin repeat protein [General function 99.81
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.81
PHA02795437 ankyrin-like protein; Provisional 99.8
KOG0508 615 consensus Ankyrin repeat protein [General function 99.79
PHA02743166 Viral ankyrin protein; Provisional 99.78
PHA02743166 Viral ankyrin protein; Provisional 99.74
PHA02741169 hypothetical protein; Provisional 99.74
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.74
PHA02736154 Viral ankyrin protein; Provisional 99.72
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.72
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.72
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.72
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.71
PHA02884300 ankyrin repeat protein; Provisional 99.71
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.71
PHA02736154 Viral ankyrin protein; Provisional 99.7
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.7
PHA02884300 ankyrin repeat protein; Provisional 99.7
KOG0514452 consensus Ankyrin repeat protein [General function 99.69
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.68
PHA02741169 hypothetical protein; Provisional 99.66
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.64
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.61
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.55
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.51
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.5
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.46
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.45
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.43
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.4
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.36
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.34
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.33
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.3
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.28
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.27
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.26
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.25
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.25
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.23
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.22
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.2
KOG0520975 consensus Uncharacterized conserved protein, conta 99.11
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.1
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 98.99
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.69
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.65
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.58
KOG0160862 consensus Myosin class V heavy chain [Cytoskeleton 98.53
PF1360630 Ank_3: Ankyrin repeat 98.5
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.42
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.37
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.34
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.3
PF1360630 Ank_3: Ankyrin repeat 98.22
KOG0522 560 consensus Ankyrin repeat protein [General function 98.21
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.2
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.2
KOG2384223 consensus Major histocompatibility complex protein 98.1
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.1
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.09
KOG0522 560 consensus Ankyrin repeat protein [General function 98.09
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.03
KOG2384223 consensus Major histocompatibility complex protein 97.75
KOG0511 516 consensus Ankyrin repeat protein [General function 97.75
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.72
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.68
KOG0164 1001 consensus Myosin class I heavy chain [Cytoskeleton 97.63
KOG0160862 consensus Myosin class V heavy chain [Cytoskeleton 97.47
PF0061221 IQ: IQ calmodulin-binding motif; InterPro: IPR0000 97.4
KOG0511 516 consensus Ankyrin repeat protein [General function 97.28
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.12
COG5022 1463 Myosin heavy chain [Cytoskeleton] 97.09
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.66
PF0061221 IQ: IQ calmodulin-binding motif; InterPro: IPR0000 96.57
PTZ00014821 myosin-A; Provisional 96.57
KOG0164 1001 consensus Myosin class I heavy chain [Cytoskeleton 96.35
smart0001526 IQ Short calmodulin-binding motif containing conse 96.26
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.23
KOG2505591 consensus Ankyrin repeat protein [General function 96.15
KOG2505591 consensus Ankyrin repeat protein [General function 95.54
PTZ00014821 myosin-A; Provisional 95.53
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.39
smart0001526 IQ Short calmodulin-binding motif containing conse 94.73
KOG2128 1401 consensus Ras GTPase-activating protein family - I 94.22
COG5022 1463 Myosin heavy chain [Cytoskeleton] 93.2
cd0117585 IPT_COE IPT domain of the COE family (Col/Olf-1/EB 92.82
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 84.12
KOG0162 1106 consensus Myosin class I heavy chain [Cytoskeleton 80.23
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=8.9e-129  Score=1164.01  Aligned_cols=932  Identities=43%  Similarity=0.660  Sum_probs=660.4

Q ss_pred             CCCCChhcHHHHHHHHHHhcCChHHHHHHHHccccceeCcCCCCCCCCCceeeeehhhhhhhcccCccceecCCCcchHH
Q 001365            7 FALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKE   86 (1092)
Q Consensus         7 ~~~~~~~d~~~~~~~~~~rw~~~~e~~~~l~~~~~~~~~~~~~~~p~~g~~~l~~r~~~~~fr~dg~~w~k~~~g~~~~e   86 (1092)
                      |.....||+..|++|++.|||+|+||+.||+||++|.|+.+||+||.|||+||||||+|||||||||+|||||||||+||
T Consensus        17 ~~sl~~l~~~~ll~~~~~rWl~~~EI~~il~n~~~~~lt~~s~trp~sGS~flfnRk~lr~fRKDGh~WkKkkDGKtirE   96 (975)
T KOG0520|consen   17 FKSLQDLDIQTLLPEAKSRWLTPEEILAILINHEKFTLTVSSPTRPQSGSIFLFNRKVLRYFRKDGHNWKKKKDGKTIRE   96 (975)
T ss_pred             hhhhhhhhhhhhhHHHHhccCChHHHHHHHhcccccccccCCCCCCCCCceeeeccHHHHHHhhcchhhhhcCCCCcChH
Confidence            33446799999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhccCCeeeEEEeeccccccccccceeeeccccccccEEEEeeeeccCCccccccccccCCCCCCCCCCccCCCCCC
Q 001365           87 AHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSE  166 (1092)
Q Consensus        87 ~h~~lk~~~~~~~~~~y~~~~~~~~f~rr~y~~~~~~~~~ivlvhy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  166 (1092)
                      |||||||||+|+||||||||+++|||||||||||++.++||||||||||++.+.. ..+..+..                
T Consensus        97 aHe~LKvg~~~~l~~~Y~Hg~~~ptF~RRcYwllq~~~~hIVLVHYl~v~~~~~~-~~~~~~~~----------------  159 (975)
T KOG0520|consen   97 AHEKLKVGGVEVLHCYYAHGEINPTFQRRCYWLLQQELEHIVLVHYLNVKGNEDA-AKGAGEIF----------------  159 (975)
T ss_pred             HHHhhccCCccceeeeeecccccchHHHHHHHhhccccCceEEEEEeeccccccc-ccCccccc----------------
Confidence            9999999999999999999999999999999999999999999999999987731 11111110                


Q ss_pred             ccCCCCCCCCCCC-CCCCCccccCCcCcc-cccchhhhhccccCCCCcccccc------ccccchhhhhcccCCCCCCCC
Q 001365          167 VEGSQSSGFHPNS-YQMPSQTADTSLNSA-QASEYEDAESVYNNQASSRFHSF------LDLQQPVAEKIDAGLADPYYP  238 (1092)
Q Consensus       167 ~~~~~~~~~~~~~-~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~  238 (1092)
                       .+++++.-  ++ ++...|   .+|.-. +.+..++++++++.+....+-..      ..-+++.++..        . 
T Consensus       160 -~s~~sd~~--~S~~~~~~q---~~~~~~~~~s~~~~v~~i~s~~~~~~~g~~~~~s~~h~i~~~~~~s~--------~-  224 (975)
T KOG0520|consen  160 -SSIISDKA--WSLNQLAGQ---LSPIFHNHSSVNEDVAEINSNQTGNALGSVFGNSRNHRIRLHEVNSL--------D-  224 (975)
T ss_pred             -cccccccc--ccHHHhhcc---cCcchhcccchHHHHHHHhhhccccccccccCcchhhhhcccccCCc--------c-
Confidence             11222211  00 011110   112111 33555666665433222222111      00111111100        0 


Q ss_pred             CCcccCccCccccCCCCCCc---CCcCccCCCCCCCCCCcCCCCCCCCCCChHHHhhhcCCCCCCCCCccCCCCCCCCcc
Q 001365          239 SSLTNNYQGKFSVVPGADFI---SPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDI  315 (1092)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  315 (1092)
                           .+.......+.....   +..++...   ....     ..+.+...|.+.++++....-....++...       
T Consensus       225 -----~~~~~p~s~~s~~~~~~~~~~~~~~~---~~~~-----~rs~~~s~~te~l~n~~~~~~~~g~s~s~~-------  284 (975)
T KOG0520|consen  225 -----PLYKLPVSDDSLNLSAPKPIDLPKGP---TSVK-----QRSSSPSYFTEILGNAPSGLVSQGNSLSSS-------  284 (975)
T ss_pred             -----ccccccccCCccccccCCCcccccCC---cchh-----hcCCCCcchhhhcccCCCcccccccccccc-------
Confidence                 011111111000000   00000000   0000     011233456776666652111111110000       


Q ss_pred             CCCCccCCccccccccCcccccccccccccCCcCCCCCCcccccccccccccccccccccccccCccCCCCCCCCCCCCC
Q 001365          316 LGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNME  395 (1092)
Q Consensus       316 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  395 (1092)
                              +  +        .-..|+.        +          +.+.       .+..+    ..+|+|....+.  
T Consensus       285 --------l--~--------~i~~~~~--------~----------~~~~-------~~~p~----~~nf~~~ss~~s--  315 (975)
T KOG0520|consen  285 --------L--Q--------RISSFTG--------L----------DNAA-------YEQPN----SQNFEPNSSLNS--  315 (975)
T ss_pred             --------h--h--------hcccccc--------c----------cccc-------ccCCc----cccccccccCCC--
Confidence                    0  0        0001110        0          0000       00000    001100000000  


Q ss_pred             CcccccCCccccccCCCCCCCcccccccccccchhhhccccc--ccccccccccchhhHHhhhcCccccccccCCCCccc
Q 001365          396 NDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLID--GSTEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYW  473 (1092)
Q Consensus       396 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~dsf~rw~~~~~~~~~~~~~~~s~~~~~  473 (1092)
                       ....    ...+.+  .....+...+-.-|.     ....+  ...+||++.|||+|||+ .|++..|+.-.++-+.+|
T Consensus       316 -~~~~----~~~g~g--~~~~~~sa~~~~~P~-----~~~~~~~~~~~~l~sgdsf~~~~~-t~~e~~d~~q~~s~~~~~  382 (975)
T KOG0520|consen  316 -HVTG----QSYGQG--LQARSPSATSESRPI-----TSAADAALSELGLKSGDSFSRWAS-TFGEISDLGQDPSGEAVW  382 (975)
T ss_pred             -Cccc----cccCcc--ccCCCcccccccCCc-----chhhccccccccccccccccchhh-hhcccccCCCCCcccccc
Confidence             0000    000001  011111111122231     11122  12789999999999996 898888777334445678


Q ss_pred             ccccccCCCCCCCCCcccccccccCCCccccCCceEEEeeccccccCCCCeeEEEEecCcCCcccChHHHHHHHcCCcHH
Q 001365          474 ETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEV  553 (1092)
Q Consensus       474 ~~~~~~~~~~~~~~~~~~~l~~~~~~~s~s~~q~fsI~dfSP~wa~s~~~tKVlI~G~fl~~~~~~TpLH~A~~fG~veV  553 (1092)
                      .+..  +.+.+.+         ..+++| +++|+|+|+||||+|+|.++++||+|+|.+    ...+.-+|.|+||..+|
T Consensus       383 ~p~~--~~~~~~~---------s~~~~S-~p~qlf~I~DfSP~Wsy~~ggvKVlV~G~~----~~~~~~~ysc~Fg~~~V  446 (975)
T KOG0520|consen  383 TPEN--DPMGPPG---------SFLSPS-SPEQLFTITDFSPEWSYLDGGVKVLVTGFP----QDETRSNYSCMFGEQRV  446 (975)
T ss_pred             ccCC--CcCCCcc---------cccCCC-CCcceeeeeccCcccccCCCCcEEEEecCc----cccCCCceEEEeCCccc
Confidence            7653  2222221         136677 449999999999999999999999999962    22335679999999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCchHHHHHHH-cCCCchhHHHHHHHHhCCCCcccccCCCCcHHhhhHHHHHHHHhcCCCCC
Q 001365          554 PAEIVAGGVLRCHTSSQKVGRVPFYVTCS-NRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVST  632 (1092)
Q Consensus       554 v~~LL~~Gadin~~~~d~~G~TPLHlAa~-ng~~~seVv~fe~Ll~~Gadvna~D~~G~TpL~~~~~~lvkLLl~gadv~  632 (1092)
                      ++.||+.||.+|++|++.+|.++|++||. ++..|+++.+|+|+......+|..+.+..+--+....++..++..+..+.
T Consensus       447 PAeliq~GVLrC~~P~h~~G~V~l~V~c~~~~~~~se~ref~~~~~~~~~~d~~s~~d~~~~~sl~~rl~~~~~r~~~~~  526 (975)
T KOG0520|consen  447 PAELIQEGVLRCYAPPHEPGVVNLQVTCRISGLACSEVREFAYLVQPSQQIDKLSWEDFLFQMSLLHRLETMLNRKQSIL  526 (975)
T ss_pred             cHHHhhcceeeeecCccCCCeEEEEEEecccceeeeeehheeecccCcccccccccccchhhhHHHHHHHHHHHHhHhHh
Confidence            99999999999999999999999999999 78889999999999998888888874444444545555555554322221


Q ss_pred             C-CCCCCCchhhHH--HHHHHhhhhccCCCcchH-HHHhhhhcCCChHHHHHHHHHHHHHhhhHHHHHHHHHhC-CCCCC
Q 001365          633 P-NYDPSNLSDISQ--LNSKISSLLKDENDDWDL-MLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEG-GKGPC  707 (1092)
Q Consensus       633 ~-~~~~~~~~~~~~--ll~~I~~Ll~~d~~g~t~-L~~a~~~~~~s~~~~~~~lL~~a~k~~l~~~LvklLle~-GadvN  707 (1092)
                      . ............  +..++..+    .+.|.. ++.....+.....+.++.+|..++++.++.||++.+++. |...+
T Consensus       527 ~s~~~~~n~~~~~~~~l~skv~~l----~~~~~~r~~~~~~~~~~~~~~~r~~lllhL~a~~lyawLie~~~e~~~~~~~  602 (975)
T KOG0520|consen  527 SSKPSTENTSDAESGNLASKVVHL----LNEWAYRLLKSISENLSSSVNFRDMLLLHLLAELLYAWLIEKVIEWAGSGDL  602 (975)
T ss_pred             hccCCccccccccchhHHHHHHHH----HHHHHHHHHhhHhhhccccCCCcchHHHHHHHHHhHHHHHHHHhcccccCch
Confidence            1 111222222223  66666666    466666 777777777777788899999999999999999999996 88888


Q ss_pred             cccCCCCcHHHHHHHcCCHhHHHHHHHCCCCccccCCCCccHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCCCCCCC
Q 001365          708 VLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRT  787 (1092)
Q Consensus       708 ~~D~~G~TpLH~AA~~G~~~iVk~LL~~Gadin~~D~~G~TpLH~Aa~~G~~eiV~~LLe~GAdin~~~D~n~~D~~G~T  787 (1092)
                      ..|.+|...+|++|..|+.+.+.+.+..|..++++|..||||||||+..|+..+|..|++.|++.++++||+..+..|.|
T Consensus       603 eld~d~qgV~hfca~lg~ewA~ll~~~~~~ai~i~D~~G~tpL~wAa~~G~e~l~a~l~~lga~~~~~tdps~~~p~g~t  682 (975)
T KOG0520|consen  603 ELDRDGQGVIHFCAALGYEWAFLPISADGVAIDIRDRNGWTPLHWAAFRGREKLVASLIELGADPGAVTDPSPETPGGKT  682 (975)
T ss_pred             hhcccCCChhhHhhhcCCceeEEEEeecccccccccCCCCcccchHhhcCHHHHHHHHHHhccccccccCCCCCCCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCcHHHHHHHHHcCCCCCcccCcccC-CCC-CcHHHHhhhhhccccccCCCCCCCCCCCCCcchhhHHHHHHH
Q 001365          788 PADLASSIGHKGIAGYLAESDLSSALSAISLNK-KDG-DVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRN  865 (1092)
Q Consensus       788 PLhlAa~~G~~eiv~~LLe~Ga~~h~adlnlkD-~~G-~ta~iaa~~~v~~l~~~~as~~s~~~~~~~~sLkdSL~Avrn  865 (1092)
                      +..+|..+|+.++..+|.++.+..+..++...+ +.| .++...+..   ...+.++.+.     ++..+|+|+|+|||+
T Consensus       683 a~~la~s~g~~gia~~lse~~L~~~~~~~~~~~~~~s~~~~~~~~~~---t~~e~s~~~~-----~~~~sl~Dtl~avrd  754 (975)
T KOG0520|consen  683 AADLARANGHKGIAGYLSEKALSAHLSNLELADPNLSADSEEDKAEK---TSSEGSPNPD-----EDSDSLKDTLAAVRD  754 (975)
T ss_pred             hhhhhhcccccchHHHHhhhHHHHHHhhccccccccCCCchhhhhhh---ccCCCCCCCC-----ccccccccccccccc
Confidence            999999999999999999999888888888777 443 333332222   2233333333     455569999999999


Q ss_pred             HHHHHHHHHHHhhhhhhhHHHHhhhcCCCC-CCchHHHhHHHHHHhcCCC--CCchhHHHHHHHHHHHhhhHHHHHHHHH
Q 001365          866 ATQAAARIHQVFRVQSFQKKQLKEYGNDTF-GISDERALSLVAVKTQKPG--HHDEPVHAAATRIQNKFRSWKGRKDFLI  942 (1092)
Q Consensus       866 A~qAAarIQqafR~~S~rrkq~~~~~~d~~-~~~~e~a~sl~a~k~~~~~--r~~~~l~~AA~~IQ~~~Rg~~~Rk~fl~  942 (1092)
                      |+++|++||++||+.+|+++++.+..++.. .+.++.+.   +++...++  ...+....||..||++||||+.|++|+.
T Consensus       755 Aa~aa~r~q~vfr~~~~~~~~a~~i~~~~~~~i~~~~~~---~m~~~~a~~~~~~r~~~~aa~~iq~~f~~yk~r~~~l~  831 (975)
T KOG0520|consen  755 AAQAAARIQAVFRAQSFQKKQAREIMDATKEQISEELAV---SMKASSAFSMCDDRSDPAAASRIQKKFRGYKQRKEFLS  831 (975)
T ss_pred             hHHHHHhhhhhhhhhhhhhhhHHHHHhhcchhhhhhhhh---hhhcccchhcCccccchhHHHHhhhhhhhHHhhhhhcc
Confidence            999999999999999999999988776422 33333333   44444433  3355678899999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccccccccccccccCCccchHHHHHHHHHHHH
Q 001365          943 IRKQIIKIQAYVRGHQVRKNYKKIIWSVGIMEKIILRWRRRGSGLRGFKSETLTASSSMVATSAKEDDYDFLKEGRKQKE 1022 (1092)
Q Consensus       943 ~r~~av~IQa~~Rg~~aRk~y~~~~~a~~~iqk~irr~r~kr~glrg~~~~~~~~~~~~~~~~~~~~~~~~~~~~rkq~~ 1022 (1092)
                      +|+.+|+||+++|||+.||+|+++.|++++++|.|.|||++++|+|||+.+...+..+. +-...++.|||+|++|||.|
T Consensus       832 tr~p~v~iqa~~rg~q~r~dy~ki~wSv~~lek~~lrwR~k~~g~Rgfk~~~~~e~~~~-a~t~~e~~yd~yKq~~~~~~  910 (975)
T KOG0520|consen  832 TRQPIVKIQAAVRGYQVRKDYRKITWSVGVLEKLILRWRRKGKGFRGFKGRALFEEQET-AATVIEDCYDFYKQLRKQTE  910 (975)
T ss_pred             cCCccccchhhhhchhHhhhhheechhhhHHHHHHHHHHHhhhhhcccccccchhcccc-ccchHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999986543221 23355899999999999999


Q ss_pred             HHHHHHHHHHHHhhccHHHHHHHHHHHHHHHHHHHHHHhhccccccccCCCCchhhhHHhhcCC-CC
Q 001365         1023 ERLQKALARVKSMVQYPEARDQYRRLLNVVNEIQETKAMALSNAEETADFDDDLVDIEALLDDT-LM 1088 (1092)
Q Consensus      1023 ~~~~~A~~~vQs~~R~~~AR~~yrrl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~-~~ 1088 (1092)
                      .|+.+|+++||+|+|+++||+|||||+.++.++++.+    ..+.-...+.+.++||+.|+.|+ +|
T Consensus       911 ~r~~~A~~~VQsm~rs~~a~qqyrR~~~~~~~~~~~~----~~~~~~~~~~~~~~~i~~~~~~~~~~  973 (975)
T KOG0520|consen  911 ERLTRAVVRVQSMFRSPKAQQQYRRLLLVYEQYQESY----KEEALVGLLDDSLFDIEQLQADRKIM  973 (975)
T ss_pred             HHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhhh----hhhccccccccchhhhHhhhhhhhhh
Confidence            9999999999999999999999999999999988876    12222234567899999999777 55



>PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] Back     alignment and domain information
>PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues Back     alignment and domain information
>KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG0162 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1092
2cxk_A95 Crystal Structure Of The Tig Domain Of Human Calmod 1e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-07
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-06
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 5e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-05
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 9e-05
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 9e-04
>pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95 Back     alignment and structure

Iteration: 1

Score = 66.2 bits (160), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 36/88 (40%), Positives = 53/88 (60%), Gaps = 6/88 (6%) Query: 510 IIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSS 569 + D+SP W+Y VKVLITG + QEA N +SC+F +I VPA ++ GVLRC+ + Sbjct: 9 VTDYSPEWSYPEGGVKVLITGPW----QEASN-NYSCLFDQISVPASLIQPGVLRCYCPA 63 Query: 570 QKVGRVPFYVTCSNRLSCSEVREFEYRA 597 G V V +N++ + V FEY++ Sbjct: 64 HDTGLVTLQVAFNNQIISNSVV-FEYKS 90
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1092
2cxk_A95 Camta1, calmodulin binding transcription activator 6e-35
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 1e-16
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 9e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-04
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-09
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-05
2rfa_A232 Transient receptor potential cation channel subfa 2e-11
2rfa_A232 Transient receptor potential cation channel subfa 1e-09
2rfa_A232 Transient receptor potential cation channel subfa 7e-09
2rfa_A232 Transient receptor potential cation channel subfa 2e-08
2rfa_A232 Transient receptor potential cation channel subfa 2e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-08
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-11
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 8e-10
2etb_A256 Transient receptor potential cation channel subfam 1e-09
2etb_A256 Transient receptor potential cation channel subfam 1e-06
2etb_A256 Transient receptor potential cation channel subfam 2e-06
2etb_A256 Transient receptor potential cation channel subfam 6e-06
2etb_A256 Transient receptor potential cation channel subfam 5e-05
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 2e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-04
2pnn_A273 Transient receptor potential cation channel subfa 7e-09
2pnn_A273 Transient receptor potential cation channel subfa 9e-08
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
2pnn_A273 Transient receptor potential cation channel subfa 6e-07
2pnn_A273 Transient receptor potential cation channel subfa 1e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-08
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 5e-08
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 5e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-06
3muj_A138 Transcription factor COE3; immunoglobulin like fol 7e-06
>2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95 Back     alignment and structure
 Score =  127 bits (320), Expect = 6e-35
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 6/96 (6%)

Query: 503 SQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGV 562
           S      + D+SP W+Y    VKVLITG +  +     +  +SC+F +I VPA ++  GV
Sbjct: 2   SSGSSGMVTDYSPEWSYPEGGVKVLITGPWQEA-----SNNYSCLFDQISVPASLIQPGV 56

Query: 563 LRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRAS 598
           LRC+  +   G V   V  +N++  + V  FEY++ 
Sbjct: 57  LRCYCPAHDTGLVTLQVAFNNQIISNSV-VFEYKSG 91


>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1092
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.98
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.98
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.98
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.96
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.96
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.95
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.95
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.95
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.95
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.95
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.95
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.92
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.92
2etb_A256 Transient receptor potential cation channel subfam 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.92
3hra_A201 Ankyrin repeat family protein; structural protein; 99.91
2pnn_A273 Transient receptor potential cation channel subfa 99.91
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.9
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.9
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.88
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.88
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.88
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.88
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.88
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.88
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.88
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.87
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.87
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.87
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.87
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.87
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.86
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.86
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.85
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.85
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.84
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.84
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.83
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.83
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.82
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.81
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.81
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.8
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.8
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.79
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.79
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.79
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.79
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.78
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.76
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.76
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.76
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.76
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.75
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.74
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.72
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.72
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.71
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.68
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.53
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.5
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.44
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 99.08
1n2d_C48 IQ2 and IQ3 motifs from MYO2P, A class V myosin; p 98.82
2cxk_A95 Camta1, calmodulin binding transcription activator 98.61
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 98.59
1n2d_C48 IQ2 and IQ3 motifs from MYO2P, A class V myosin; p 98.34
1wdc_A64 Scallop myosin; calcium binding protein, muscle pr 97.58
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 97.39
2bl0_A63 Major plasmodial myosin heavy chain; muscle protei 97.36
2bl0_A63 Major plasmodial myosin heavy chain; muscle protei 97.25
1wdc_A64 Scallop myosin; calcium binding protein, muscle pr 97.24
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 97.21
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 96.56
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 96.08
3gn4_A148 Myosin-VI; unconventional myosin, motility, lever 94.8
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 94.75
1w7j_A795 Myosin VA; motor protein, unconventional myosin, m 89.06
1w7j_A795 Myosin VA; motor protein, unconventional myosin, m 86.04
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 85.64
2l53_B31 CAM, voltage-gated sodium channel type V alpha iso 84.65
2kxw_B27 Sodium channel protein type 2 subunit alpha; actio 83.82
2l53_B31 CAM, voltage-gated sodium channel type V alpha iso 83.13
2kxw_B27 Sodium channel protein type 2 subunit alpha; actio 82.28
3gn4_A148 Myosin-VI; unconventional myosin, motility, lever 80.7
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
Probab=100.00  E-value=1.4e-33  Score=304.76  Aligned_cols=254  Identities=13%  Similarity=0.013  Sum_probs=186.3

Q ss_pred             CCcccChHHHHHHHcCCcHHHHHHHHCCCCCC-CCCCCCCCchHHHHHHHcCCCchhHHHHHHHHhCCCCcccccCCCCc
Q 001365          534 MSQQEAENCKWSCMFGEIEVPAEIVAGGVLRC-HTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDI  612 (1092)
Q Consensus       534 ~~~~~~TpLH~A~~fG~veVv~~LL~~Gadin-~~~~d~~G~TPLHlAa~ng~~~seVv~fe~Ll~~Gadvna~D~~G~T  612 (1092)
                      .+..+.||||+||..|+.+++++|++.|++.+ ....+..|.||||+||..|+    +..+++|+..|++++.+|..|.|
T Consensus         5 ~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~~g~t~L~~A~~~g~----~~~v~~Ll~~ga~~~~~~~~g~t   80 (282)
T 1oy3_D            5 VTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGE----ASTVEKLYAAGAGVLVAERGGHT   80 (282)
T ss_dssp             CCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTC----HHHHHHHHHTTCCSSCCCTTSCC
T ss_pred             cCCCCCcHHHHHHHcCCHHHHHHHHhcCCCcccccccCCCCCCHHHHHHHcCC----HHHHHHHHHcCCCCCCCCCCCCC
Confidence            45678999999999999999999999998833 23567789999999999986    55567899999999999999999


Q ss_pred             HHhh----hHHHHHHHHhc-CCCCCCCCCCCCchhhHHHHHHHhhhhccCCCcchHHHHhhhhcCCChHHHHHHHHHHHH
Q 001365          613 TSEN----LRMQFGKLLCL-TSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLL  687 (1092)
Q Consensus       613 pL~~----~~~~lvkLLl~-gadv~~~~~~~~~~~~~~ll~~I~~Ll~~d~~g~t~L~~a~~~~~~s~~~~~~~lL~~a~  687 (1092)
                      |||+    ++.+++++|+. ++........ .      ......  ......+.++++.+...                 
T Consensus        81 pL~~A~~~~~~~~v~~Ll~~~~~~~~~~~~-~------~~~~~~--~~~~~~~~~~~~~~~~~-----------------  134 (282)
T 1oy3_D           81 ALHLACRVRAHTCACVLLQPRPSHPRDASD-T------YLTQSQ--DCTPDTSHAPAAVDSQP-----------------  134 (282)
T ss_dssp             HHHHHTTTTCHHHHHHHSSSCCSSCCCC----------------------------------------------------
T ss_pred             HHHHHHHcCCcchhHhhhccCCCCchhhHH-H------Hhhccc--ccCcchhcchhhhcccc-----------------
Confidence            9995    77889988865 4443322110 0      000000  00001222333322221                 


Q ss_pred             HhhhHHHHHHHHHhCCCCCCcccCCCCcHHHHHHHcCCHhHHHHHHHCCCCccccCCC-CccHHHHHHHcCCHHHHHHHH
Q 001365          688 KEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVN-GWTALHWAAYCGRERTVASLI  766 (1092)
Q Consensus       688 k~~l~~~LvklLle~GadvN~~D~~G~TpLH~AA~~G~~~iVk~LL~~Gadin~~D~~-G~TpLH~Aa~~G~~eiV~~LL  766 (1092)
                        .....+...+...+++++.+|..|.||||+|+..|+.++|++|+++|++++.++.. |+||||+||..|+.++|++||
T Consensus       135 --~~~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~tpL~~A~~~~~~~~v~~Ll  212 (282)
T 1oy3_D          135 --NPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLL  212 (282)
T ss_dssp             -----------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHH
T ss_pred             --ccchhhhhhhhhhhhcCCCcCCCCcCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcCHHHHHHHcCCHHHHHHHH
Confidence              11112444556678899999999999999999999999999999999999999865 999999999999999999999


Q ss_pred             HcCCCCCCCCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHHcCCCCCcccCcccCCCCCcHHHHh
Q 001365          767 ALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTG  830 (1092)
Q Consensus       767 e~GAdin~~~D~n~~D~~G~TPLhlAa~~G~~eiv~~LLe~Ga~~h~adlnlkD~~G~ta~iaa  830 (1092)
                      ++|++++.      +|..|+||||+|+..|+.+++++|+++|     ++++.+|..|.+|...+
T Consensus       213 ~~gad~~~------~d~~g~tpL~~A~~~~~~~~v~~Ll~~g-----a~~~~~~~~g~tpl~~a  265 (282)
T 1oy3_D          213 KAGADPTA------RMYGGRTPLGSALLRPNPILARLLRAHG-----APEPEDGGDKLSPCSSS  265 (282)
T ss_dssp             HTTCCTTC------CCTTSCCHHHHHHTSSCHHHHHHHHHTT-----CCCCCCC----------
T ss_pred             HcCCCCcc------cccCCCCHHHHHHHcCCcHHHHHHHHcC-----CCcCcCCCccccccccc
Confidence            99999888      7899999999999999999999999999     78999999997764433



>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Back     alignment and structure
>1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Back     alignment and structure
>1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} Back     alignment and structure
>2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} Back     alignment and structure
>3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1092
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-11
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.004
d2cxka182 b.1.18.1 (A:872-953) Calmodulin binding transcript 2e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.001
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.002
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.003
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.003
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-04
d1kk8a2789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 8e-08
d2mysa2794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 1e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.004
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 8e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.003
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.001
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 65.4 bits (158), Expect = 1e-11
 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 6/90 (6%)

Query: 717 LHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALS 776
           LH A+ +G+   ++     G + N  +V   T LH AA  G       L+   A      
Sbjct: 4   LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA------ 57

Query: 777 DPTPKYPSGRTPADLASSIGHKGIAGYLAE 806
               K    +TP   A+ IGH  +   L E
Sbjct: 58  KVNAKAKDDQTPLHCAARIGHTNMVKLLLE 87


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1092
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.98
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.93
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.91
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.9
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.87
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.87
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.87
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.86
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.84
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.84
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.82
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.82
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.77
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.76
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.76
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.75
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.74
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.72
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.7
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 97.67
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 97.67
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 96.81
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 96.75
d2cxka182 Calmodulin binding transcription activator 1 {Huma 96.37
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 89.61
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 85.18
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.98  E-value=3.6e-32  Score=288.20  Aligned_cols=238  Identities=14%  Similarity=0.018  Sum_probs=176.4

Q ss_pred             CcccChHHHHHHHcCCcHHHHHHHHCCCCCC-CCCCCCCCchHHHHHHHcCCCchhHHHHHHHHhCCCCcccccCCCCcH
Q 001365          535 SQQEAENCKWSCMFGEIEVPAEIVAGGVLRC-HTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDIT  613 (1092)
Q Consensus       535 ~~~~~TpLH~A~~fG~veVv~~LL~~Gadin-~~~~d~~G~TPLHlAa~ng~~~seVv~fe~Ll~~Gadvna~D~~G~Tp  613 (1092)
                      +..|.||||+||..|+.+++++||+.|++.+ ....+..|+||||+||.+|+    ...+++|++.|++++.+|..|.||
T Consensus         6 ~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~----~~iv~~Ll~~ga~i~~~d~~g~tp   81 (255)
T d1oy3d_           6 TEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGE----ASTVEKLYAAGAGVLVAERGGHTA   81 (255)
T ss_dssp             CTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTC----HHHHHHHHHTTCCSSCCCTTSCCH
T ss_pred             CcCCCCHHHHHHHcCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhcc----cccccccccccccccccccccchh
Confidence            4568999999999999999999999998855 33567889999999999986    445578999999999999999999


Q ss_pred             Hhh----hHHHHHHHHhcCCCCCCCCCCCCchhhHHHHHHHhhhhccCCCcchHHHHhhhhcCCChHHHHHHHHHHHHHh
Q 001365          614 SEN----LRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKE  689 (1092)
Q Consensus       614 L~~----~~~~lvkLLl~gadv~~~~~~~~~~~~~~ll~~I~~Ll~~d~~g~t~L~~a~~~~~~s~~~~~~~lL~~a~k~  689 (1092)
                      ||.    ++.+++++|+.............      .......     ......+....                .....
T Consensus        82 L~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~------~~~~~~~-----~~~~~~~~~~~----------------~~~~~  134 (255)
T d1oy3d_          82 LHLACRVRAHTCACVLLQPRPSHPRDASDT------YLTQSQD-----CTPDTSHAPAA----------------VDSQP  134 (255)
T ss_dssp             HHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------------------------
T ss_pred             hhhhhccCchHHHHHHHhhccchhcccchh------hhhHHhh-----hcccchHHHHH----------------HHhhc
Confidence            985    66778877765332222111000      0000000     00000000000                00000


Q ss_pred             hhHHHHHHHHHhCCCCCCcccCCCCcHHHHHHHcCCHhHHHHHHHCCCCcccc-CCCCccHHHHHHHcCCHHHHHHHHHc
Q 001365          690 KLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFR-DVNGWTALHWAAYCGRERTVASLIAL  768 (1092)
Q Consensus       690 ~l~~~LvklLle~GadvN~~D~~G~TpLH~AA~~G~~~iVk~LL~~Gadin~~-D~~G~TpLH~Aa~~G~~eiV~~LLe~  768 (1092)
                      .........+...+.+++.+|..|.||||+||..|+.++|++|+++|++++.. +..|.||||+||..|+.++|++|+++
T Consensus       135 ~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~  214 (255)
T d1oy3d_         135 NPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKA  214 (255)
T ss_dssp             ---------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHT
T ss_pred             chhHHHHHHhhhcCcccccccccCcccccccccccccccccchhcccccccccccccccccccccccccHHHHHHHHHHC
Confidence            01111333344567788999999999999999999999999999999998865 67899999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHHcCC
Q 001365          769 GAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDL  809 (1092)
Q Consensus       769 GAdin~~~D~n~~D~~G~TPLhlAa~~G~~eiv~~LLe~Ga  809 (1092)
                      |++++.      +|..|.||||+|+.+|+.+++++|+++|+
T Consensus       215 gadin~------~d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga  249 (255)
T d1oy3d_         215 GADPTA------RMYGGRTPLGSALLRPNPILARLLRAHGA  249 (255)
T ss_dssp             TCCTTC------CCTTSCCHHHHHHTSSCHHHHHHHHHTTC
T ss_pred             CCCCCC------CCCCCCCHHHHHHHCCCHHHHHHHHHcCC
Confidence            999887      78999999999999999999999999994



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure