Citrus Sinensis ID: 001381

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------109
MEEVIFSQEEDELDCKEIVLQKYFLQEWKIVKSLLDEIVSYGRVPDTSSVHKIRSIMDKYQEQGQLVEPYLENIVSPLMSIIRSKTIELGADSDEILKIIKPICIIIYTLVTVCGYKAVIKFFPHQVSDLELAVSLLEKCHDTASVTSLRQESTGEMEAKCVILLWLSILVLVPFDISSVDTSIANNENLGQNEPAPLVMRILGFCKDYLSNAGPMRTIAGLLLAKLLTRPDMPTAFASFVEWTHEVLSSVTDDVMNHFRLLGVVEALAAIFKAGGRKVLLDVIPVVWNDASTMLKSGSAARSPLLRKYLMKLTQRLGLTCLPRCTSAWRYVIRTSSLGENMSSRAAFREIDQCDHSVVDSLKSEQNRNCPEDEGMDVPDILEEIIEILLSGLRDTDTVVRWSAAKGIGRITSCLTSSLSEEVFSSVLELFSPGEGDGSWHGGCLALAELARRGLLLPSSLPKVVPVIVKALHYDIRRGSHSVGSHVRDAAAYVCWAFGRAYCHTDMRNILEQIAPHLLTVACYDREVNCRRAAAAAFQENVGRQGNYPHGIDIVNTADYFSLSSRVYSYLHVAVFIAQYEGYLYPFVDELLYNKICHWDKVLRELAAEALSALVKYDPEYFANFILEKLTPFTLSTDLCTRHGATLAAGEVVLALCKYDYALPADKQKIVAGIVPGIEKARLYRGKGGEIMRSAVSRFIECISLSFVSLPEKTKRSLLDTLNENLRHPNSQIQNAAVKALKPFVQTYMVAADSGVVGGISLKYMEQLTDPNPAIRRGSALALGVLPYELLANSWRDVLLKLCSCCLIEENPEDRDTEARVNAVRGLVSVCETLTQSQENSLIHSGEDEISLFHLIKNEVMTSLFKALDDYSVDNRGDVGSWVREAAVDGLEICTYILCKRDFVPSPEKPQEVKSELPGNVTAEKTLFDANLATNLVAGIVKQAVEKMDKLREAAAKVLRRILYNKTIFVPIPHREKLEEIVPNEADLNWGVPAFSYPRFVHLLRFSCYSRVLLSGLVISIGGLQESLRKASISALLEYLQAGETEDLDARSSREYMLYNDILWVLQHYRRCDRVIVPTLKVHKLLLKD
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHcccHHHcccHHHHHHHccccccccccHHHHccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEccHHHHHHHHHcc
**********DELDCKEIVLQKYFLQEWKIVKSLLDEIVSYGRVPDTSSVHKIRSIMDKYQEQGQLVEPYLENIVSPLMSIIRSKTIELGADSDEILKIIKPICIIIYTLVTVCGYKAVIKFFPHQVSDLELAVSLLEKCHDTA********STGEMEAKCVILLWLSILVLVPFDISSVDTSIAN*******EPAPLVMRILGFCKDYLSNAGPMRTIAGLLLAKLLTRPDMPTAFASFVEWTHEVLSSVTDDVMNHFRLLGVVEALAAIFKAGGRKVLLDVIPVVWNDASTMLKSGSAARSPLLRKYLMKLTQRLGLTCLPRCTSAWRYVIRTSSLGENMSSRA************************PEDEGMDVPDILEEIIEILLSGLRDTDTVVRWSAAKGIGRITSCLTSSLSEEVFSSVLELFSPGEGDGSWHGGCLALAELARRGLLLPSSLPKVVPVIVKALHYDIRRGSHSVGSHVRDAAAYVCWAFGRAYCHTDMRNILEQIAPHLLTVACYDREVNCRRAAAAAFQENVGRQGNYPHGIDIVNTADYFSLSSRVYSYLHVAVFIAQYEGYLYPFVDELLYNKICHWDKVLRELAAEALSALVKYDPEYFANFILEKLTPFTLSTDLCTRHGATLAAGEVVLALCKYDYALPADKQKIVAGIVPGIEKARLYRGKGGEIMRSAVSRFIECISLSFVSLPEKTKRSLLDTLNENLRHPNSQIQNAAVKALKPFVQTYMVAADSGVVGGISLKYMEQLTDPNPAIRRGSALALGVLPYELLANSWRDVLLKLCSCCLIEENPEDRDTEARVNAVRGLVSVCETLTQSQENSLIHSGEDEISLFHLIKNEVMTSLFKALDDYSVDNRGDVGSWVREAAVDGLEICTYILCKRDFV************LPGNVTAEKTLFDANLATNLVAGIVKQAVEKMDKLREAAAKVLRRILYNKTIFVPIPHREKLEEIVPNEADLNWGVPAFSYPRFVHLLRFSCYSRVLLSGLVISIGGLQESLRKASISALLEYLQAGETEDLDARSSREYMLYNDILWVLQHYRRCDRVIVPTLKVHKLLLKD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEVIFSQEEDELDCKEIVLQKYFLQEWKIVKSLLDEIVSYGRVPDTSSVHKIRSIMDKYQEQGQLVEPYLENIVSPLMSIIRSKTIELGADSDEILKIIKPICIIIYTLVTVCGYKAVIKFFPHQVSDLELAVSLLEKCHDTASVTSLRQESTGEMEAKCVILLWLSILVLVPFDISSVDTSIANNENLGQNEPAPLVMRILGFCKDYLSNAGPMRTIAGLLLAKLLTRPDMPTAFASFVEWTHEVLSSVTDDVMNHFRLLGVVEALAAIFKAGGRKVLLDVIPVVWNDASTMLKSGSAARSPLLRKYLMKLTQRLGLTCLPRCTSAWRYVIRTSSLGENMSSRAAFREIDQCDHSVVDSLKSEQNRNCPEDEGMDVPDILEEIIEILLSGLRDTDTVVRWSAAKGIGRITSCLTSSLSEEVFSSVLELFSPGEGDGSWHGGCLALAELARRGLLLPSSLPKVVPVIVKALHYDIRRGSHSVGSHVRDAAAYVCWAFGRAYCHTDMRNILEQIAPHLLTVACYDREVNCRRAAAAAFQENVGRQGNYPHGIDIVNTADYFSLSSRVYSYLHVAVFIAQYEGYLYPFVDELLYNKICHWDKVLRELAAEALSALVKYDPEYFANFILEKLTPFTLSTDLCTRHGATLAAGEVVLALCKYDYALPADKQKIVAGIVPGIEKARLYRGKGGEIMRSAVSRFIECISLSFVSLPEKTKRSLLDTLNENLRHPNSQIQNAAVKALKPFVQTYMVAADSGVVGGISLKYMEQLTDPNPAIRRGSALALGVLPYELLANSWRDVLLKLCSCCLIEENPEDRDTEARVNAVRGLVSVCETLTQSQENSLIHSGEDEISLFHLIKNEVMTSLFKALDDYSVDNRGDVGSWVREAAVDGLEICTYILCKRDFVPSPEKPQEVKSELPGNVTAEKTLFDANLATNLVAGIxxxxxxxxxxxxxxxxxxxxxILYNKTIFVPIPHREKLEEIVPNEADLNWGVPAFSYPRFVHLLRFSCYSRVLLSGLVISIGGLQESLRKASISALLEYLQAGETEDLDARSSREYMLYNDILWVLQHYRRCDRVIVPTLKVHKLLLKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tubulin-specific chaperone D Tubulin-folding protein; involved in the first step of the tubulin folding pathway. Modulates microtubule dynamics by capturing GTP-bound beta-tubulin (TUBB). Increases degradation of beta tubulin, when overexpressed in polarized cells. Induces tight adherens and tight junctions disassembly at the lateral cell membrane.probableQ5ZI87
Tubulin-specific chaperone D Tubulin-folding protein; involved in the first step of the tubulin folding pathway. Modulates microtubule dynamics by capturing GTP-bound beta-tubulin (TUBB). Acts as a GTPase-activating protein (GAP) for ARL2. Its ability to interact with beta tubulin is regulated via its interaction with ARL2. Induces microtubule disruption in absence of ARL2. Increases degradation of beta tubulin, when overexpressed in polarized cells. Promotes epithelial cell detachment, a process antagonized by ARL2. Induces tight adherens and tight junctions disassembly at the lateral cell membrane.probableQ8BYA0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U6G, chain C
Confidence level:very confident
Coverage over the Query: 380-837,853-871,882-900,923-966
View the alignment between query and template
View the model in PyMOL
Template: 1QGR, chain A
Confidence level:very confident
Coverage over the Query: 62-141,155-184,195-322,337-349,363-562,575-899,922-964
View the alignment between query and template
View the model in PyMOL
Template: 2Z6H, chain A
Confidence level:probable
Coverage over the Query: 385-778,809-836,849-902,922-991
View the alignment between query and template
View the model in PyMOL