Citrus Sinensis ID: 001383
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1088 | 2.2.26 [Sep-21-2011] | |||||||
| O43918 | 545 | Autoimmune regulator OS=H | no | no | 0.048 | 0.097 | 0.527 | 9e-12 | |
| Q56R14 | 1091 | E3 ubiquitin-protein liga | N/A | no | 0.093 | 0.093 | 0.314 | 2e-11 | |
| Q6PDQ2 | 1915 | Chromodomain-helicase-DNA | yes | no | 0.122 | 0.069 | 0.277 | 2e-11 | |
| Q6E2N3 | 1163 | E3 ubiquitin-protein liga | no | no | 0.050 | 0.047 | 0.491 | 4e-11 | |
| Q9Z0E3 | 552 | Autoimmune regulator OS=M | no | no | 0.045 | 0.088 | 0.529 | 8e-11 | |
| Q14839 | 1912 | Chromodomain-helicase-DNA | no | no | 0.122 | 0.069 | 0.271 | 1e-10 | |
| O15016 | 1216 | Tripartite motif-containi | no | no | 0.056 | 0.050 | 0.430 | 3e-10 | |
| Q04779 | 684 | Transcriptional regulator | yes | no | 0.192 | 0.305 | 0.205 | 4e-10 | |
| Q9UPN9 | 1127 | E3 ubiquitin-protein liga | no | no | 0.072 | 0.070 | 0.359 | 4e-10 | |
| Q99PP7 | 1142 | E3 ubiquitin-protein liga | no | no | 0.072 | 0.069 | 0.359 | 5e-10 |
| >sp|O43918|AIRE_HUMAN Autoimmune regulator OS=Homo sapiens GN=AIRE PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 73.6 bits (179), Expect = 9e-12, Method: Compositional matrix adjust.
Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 2/55 (3%)
Query: 714 KENDDLCGICMDGGDLLCCDSCPRAFHIDCVSLP--GIPSGTWHCRYCMNTFQKE 766
++N+D C +C DGG+L+CCD CPRAFH+ C+S P IPSGTW C C+ +E
Sbjct: 293 QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQE 347
|
Transcriptional regulator that binds to DNA as a dimer or as a tetramer, but not as a monomer. Binds to G-doublets in an A/T-rich environment; the preferred motif is a tandem repeat of 5'-. ATTGGTTA-3' combined with a 5'-TTATTA-3' box. Binds to nucleosomes (By similarity). Binds to chromatin and interacts selectively with histone H3 that is not methylated at 'Lys-4', not phosphorylated at 'Thr-3' and not methylated at 'Arg-2'. Functions as a sensor of histone H3 modifications that are important for the epigenetic regulation of gene expression. Functions as a transcriptional activator and promotes the expression of otherwise tissue-specific self-antigens in the thymus, which is important for self tolerance and the avoidance of autoimmune reactions. Homo sapiens (taxid: 9606) |
| >sp|Q56R14|TRI33_XENLA E3 ubiquitin-protein ligase TRIM33 OS=Xenopus laevis GN=trim33 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6E2N3|TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Z0E3|AIRE_MOUSE Autoimmune regulator OS=Mus musculus GN=Aire PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O15016|TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens GN=TRIM66 PE=2 SV=4 | Back alignment and function description |
|---|
| >sp|Q04779|RCO1_YEAST Transcriptional regulatory protein RCO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCO1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UPN9|TRI33_HUMAN E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens GN=TRIM33 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q99PP7|TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus GN=Trim33 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1088 | ||||||
| 255565495 | 1042 | protein binding protein, putative [Ricin | 0.926 | 0.967 | 0.478 | 0.0 | |
| 224106864 | 955 | predicted protein [Populus trichocarpa] | 0.769 | 0.876 | 0.526 | 0.0 | |
| 449496288 | 972 | PREDICTED: uncharacterized LOC101214170 | 0.776 | 0.869 | 0.516 | 0.0 | |
| 449456166 | 972 | PREDICTED: uncharacterized protein LOC10 | 0.777 | 0.870 | 0.516 | 0.0 | |
| 224118454 | 973 | predicted protein [Populus trichocarpa] | 0.694 | 0.776 | 0.575 | 0.0 | |
| 356547147 | 1006 | PREDICTED: uncharacterized protein LOC10 | 0.877 | 0.949 | 0.459 | 0.0 | |
| 45935119 | 1047 | putative PHD zinc finger protein [Ipomoe | 0.927 | 0.963 | 0.450 | 0.0 | |
| 334184527 | 1072 | acyl-CoA N-acyltransferase with RING/FYV | 0.724 | 0.735 | 0.529 | 0.0 | |
| 356541962 | 981 | PREDICTED: uncharacterized protein LOC10 | 0.745 | 0.826 | 0.497 | 0.0 | |
| 359481940 | 2411 | PREDICTED: uncharacterized protein LOC10 | 0.641 | 0.289 | 0.523 | 0.0 |
| >gi|255565495|ref|XP_002523738.1| protein binding protein, putative [Ricinus communis] gi|223537042|gb|EEF38678.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 919 bits (2374), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 537/1122 (47%), Positives = 697/1122 (62%), Gaps = 114/1122 (10%)
Query: 1 MANGTDSEEKFVVLSKIRVGLKREFEFALKVQSEICGSLGRTRARKVQSNVDSGCVLGPP 60
MANG D+ + +V +++R GLKREF FA K SEI SLGRTRA + +S GCV P
Sbjct: 1 MANGKDNNKDMLV-AEVRPGLKREFAFAFKALSEISRSLGRTRASRTRSG--GGCV-SPA 56
Query: 61 EVKKLKTYESRKKRKRQEQSVVVKETEDKREEEVKSDVFDVINERERP----IREKESKD 116
K K + +K +K ++ E+K EE V SDV ++ + E + E S
Sbjct: 57 SNNKKKRLKGKKDQK-------ARDLEEKEEENV-SDVVELGSGDEEATIGGLIESVSVS 108
Query: 117 DSENMGVGERGALMNVEEVKVVSERREEGNDEFGKVVIGVEEEKKNECDEVLMNVEENKY 176
D+E G G G ++ V+E S EE EK+NE +EVL N
Sbjct: 109 DTEING-GNNGEIVEVKENGAGSMCLEE-------------TEKRNEHEEVLKN------ 148
Query: 177 GELDGMGGSARTEEEKNECGEPVVGVEEERRNECNQVLTNVEENE---HSEVDREKAEND 233
+ EE ++ + VE+E +NE ++ + E D K E+
Sbjct: 149 ---------DQCEERRSRSLPYSMKVEDESKNESDRTCEEIVSGSVPILMEEDSRKLEDV 199
Query: 234 LIGE---VKNEFEEVVAVVEEEKKDESDRVAMDVEEVKCEEVGLGKEYEPGRV---QMEM 287
I E +NE EEV+ D+ R A ++ CEE G + + +
Sbjct: 200 TIKEEIPKRNEPEEVLG------NDDLKRYADGNDQ--CEERISGSSPNSMNIDNFENQN 251
Query: 288 DEEKKNDIERELVENGVLESSM---------VGKHSSTLCNGESNVAKSVAVDGNDEGKT 338
E KN++E+ N +LES S L N E S+ + ND K
Sbjct: 252 GEHSKNEMEKVTAMNELLESKSDMNNVNEEGTSMSSVILMNSEGGAIDSLPI--NDSTK- 308
Query: 339 VNVVVERPLRRFTRSLLQQKVELAKGSLSKDGGKRSDVTEVANDGVGGPVKQE---TVMK 395
V E+P+RRFTRSLL+ K+E+ + KD + A D G P T++K
Sbjct: 309 --VEKEKPMRRFTRSLLKPKMEIGQEYAVKD-------SSSAADDAGSPSAASNSGTMLK 359
Query: 396 PRK--VMRKFYSKLKNFLESGILEGMSVMYIRGSKVKGPGVSGLRGVVKGSGISCFCDDC 453
K +KF +KLK+ L+SGILEG V Y+RGSK +G G + L+GV+ GS I CFC C
Sbjct: 360 VWKNDTSKKFPTKLKDLLDSGILEGQQVKYMRGSKARGAGETVLQGVISGSAILCFCRSC 419
Query: 454 KGNQVVTPAVFELHAGSSNKRPPEYIYLENGKTLRDIMNVCKDSPLETLEKAVRMVLGSS 513
+GN+VVTP++FE+HAGS+NKRPPEYIYLENG TLRD+MN CK++ LETL++A+ + G S
Sbjct: 420 RGNEVVTPSIFEVHAGSANKRPPEYIYLENGNTLRDVMNACKNASLETLDEALWLSTGCS 479
Query: 514 SMKKANFCLNCRVSFSNAGVEELMLLCKSCVELKESQAGSAEIKEPLSHSSEMEPQPPSV 573
S+K + FCL CR + A M LC C+ LK+SQA P +
Sbjct: 480 SLKNSTFCLKCRGKLAEASTGRSMTLCSQCMVLKDSQASI----------------PATT 523
Query: 574 ELEESPAPSGELTDTSNRSPEPNSAQTSSHSKMK--SSSVKSHGKITRKDLRMHKLVFEE 631
+ ++ A S +P+ + SS S +K +S KS G++T KDLRMHKLVFEE
Sbjct: 524 DTDKGYAESDVCAYRIVLTPKSHPVSKSSDSVLKCSTSRSKSQGRLTVKDLRMHKLVFEE 583
Query: 632 GGLEDGAEVGYFVRGEVKFLVGYKKGFGILCTCCNSEVSPSQFEAHAGWASRRKPFQHIY 691
L DG EV Y+ RG+ K LVGYKKGFGI C+CCN+EVSPSQFEAHAGWASRRKP+ HIY
Sbjct: 584 DVLPDGTEVAYYSRGQ-KLLVGYKKGFGIFCSCCNTEVSPSQFEAHAGWASRRKPYLHIY 642
Query: 692 TSNGVSLHELSIKLSLERPFSSKENDDLCGICMDGGDLLCCDSCPRAFHIDCVSLPGIPS 751
TSNGVSLHEL+I LS R FS+ +NDDLC IC DGGDLLCCD CPRA+H DC++LP IP+
Sbjct: 643 TSNGVSLHELAISLSKSRKFSTHQNDDLCQICRDGGDLLCCDVCPRAYHKDCLALPEIPT 702
Query: 752 GTWHCRYCMNTFQKEKFVEYNANARAAGRIEGVDPFAQMVSRCIRIVQTPDTELGGCVLC 811
G W+C++C+N FQKEKFVE+NANA AAGR+ GVDP Q+ RCIRIV+T D + GGCV C
Sbjct: 703 GRWYCKFCLNNFQKEKFVEHNANAIAAGRVAGVDPIDQITRRCIRIVKTMDADFGGCVFC 762
Query: 812 RGRDFCKSRFGRRTVILCDQCEREYHVGCLKDHGMEDLQELPKGKWLCCADCKRINLALQ 871
RG DF K FG RTV+LCDQCE+E+HVGCLKDH MEDL+ELPKG W CC+DC RI+ AL+
Sbjct: 763 RGHDFDKI-FGPRTVLLCDQCEKEFHVGCLKDHNMEDLKELPKGNWFCCSDCCRIHSALE 821
Query: 872 KLVDRGEEKLPETSLDVIKKK-HEESGSDNAVDFDVRWRVLRGKKVDASDGTRALLSKAV 930
KLV RGEE+L ++SL++I KK E+ + + DVRWR+L K A D T ALLS+A+
Sbjct: 822 KLVLRGEERLLDSSLNLINKKVQEKCAGIDCSNIDVRWRLLNDKINPAGD-TAALLSEAL 880
Query: 931 SIFHDRFDPII----ESASKLDLIPAMVYGRSHRGQDYHGMYCAILTVNQVVVSAGIFRI 986
+I H++F+PI+ S + DLI +MV+G + +GQ++ GMYCA+L +NQ VVS I R
Sbjct: 881 AILHEQFNPILVAGTSSKADRDLITSMVFGDNLKGQEFGGMYCAVLMINQAVVSCAIIRF 940
Query: 987 FGQELAELPLVATSNDCQGQGYFQSLFCCIEKLLGFLNVKTLVLPSASEAQAIWTNKFGF 1046
FG ELAELPLVATS+ QG+GYFQ+LF CIEKLLGFLN+K LVLP+A EA++IW NKFGF
Sbjct: 941 FGLELAELPLVATSSKAQGKGYFQALFTCIEKLLGFLNIKNLVLPAAEEAESIWINKFGF 1000
Query: 1047 SMMTEEEQNKYRNDYPLMIFQGTSMLQKPVPKCRIVGKSVDG 1088
+T EE K+R DY +M+FQGTSML KPVPK RIVG+S G
Sbjct: 1001 RKLTHEEFLKFRKDYQMMVFQGTSMLHKPVPKIRIVGRSEGG 1042
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224106864|ref|XP_002314310.1| predicted protein [Populus trichocarpa] gi|222850718|gb|EEE88265.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449496288|ref|XP_004160094.1| PREDICTED: uncharacterized LOC101214170 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449456166|ref|XP_004145821.1| PREDICTED: uncharacterized protein LOC101214170 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224118454|ref|XP_002331486.1| predicted protein [Populus trichocarpa] gi|222873564|gb|EEF10695.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356547147|ref|XP_003541978.1| PREDICTED: uncharacterized protein LOC100804381 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|45935119|gb|AAS79577.1| putative PHD zinc finger protein [Ipomoea trifida] gi|117165997|dbj|BAF36299.1| hypothetical protein [Ipomoea trifida] | Back alignment and taxonomy information |
|---|
| >gi|334184527|ref|NP_180365.6| acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain-containing protein [Arabidopsis thaliana] gi|330252972|gb|AEC08066.1| acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356541962|ref|XP_003539441.1| PREDICTED: uncharacterized protein LOC100803825 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359481940|ref|XP_002264975.2| PREDICTED: uncharacterized protein LOC100248757 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1088 | ||||||
| TAIR|locus:2040550 | 1007 | AT2G36720 "AT2G36720" [Arabido | 0.430 | 0.464 | 0.563 | 1.2e-173 | |
| TAIR|locus:2201021 | 1138 | AT1G05380 "AT1G05380" [Arabido | 0.124 | 0.118 | 0.375 | 2e-37 | |
| TAIR|locus:2147391 | 1179 | AT5G36740 [Arabidopsis thalian | 0.105 | 0.097 | 0.403 | 2.4e-36 | |
| TAIR|locus:2086395 | 1189 | ROS4 "AT3G14980" [Arabidopsis | 0.212 | 0.194 | 0.274 | 2.2e-34 | |
| TAIR|locus:2832118 | 1193 | AT5G36670 [Arabidopsis thalian | 0.105 | 0.096 | 0.403 | 5.1e-29 | |
| TAIR|locus:2178828 | 1065 | AT5G58610 "AT5G58610" [Arabido | 0.146 | 0.149 | 0.290 | 4.8e-25 | |
| UNIPROTKB|C9JFR1 | 244 | AIRE "Autoimmune regulator" [H | 0.049 | 0.221 | 0.535 | 4.2e-13 | |
| ZFIN|ZDB-GENE-071008-4 | 513 | aire "autoimmune regulator" [D | 0.173 | 0.368 | 0.279 | 4.4e-13 | |
| TAIR|locus:2173179 | 537 | AT5G13660 "AT5G13660" [Arabido | 0.118 | 0.240 | 0.350 | 6.2e-13 | |
| TAIR|locus:2168088 | 425 | AT5G59830 "AT5G59830" [Arabido | 0.136 | 0.348 | 0.331 | 6.2e-13 |
| TAIR|locus:2040550 AT2G36720 "AT2G36720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1450 (515.5 bits), Expect = 1.2e-173, Sum P(2) = 1.2e-173
Identities = 266/472 (56%), Positives = 344/472 (72%)
Query: 617 ITRKDLRMHKLVFEEGGLEDGAEVGYFVRGEVKFLVGYKKGFGILCTCCNSEVSPSQFEA 676
+ RKD +HKLVF+ GGL +G E+GY+ RG+ K L GYK G GI C CC EVSPS FEA
Sbjct: 516 LARKDQGLHKLVFDRGGLPEGTELGYYARGQ-KLLGGYKMGAGIYCYCCKCEVSPSLFEA 574
Query: 677 HAGWASRRKPFQHIYTSNGVSLHELSIKLSLERPFSSKENDDLCGICMDGGDLLCCDSCP 736
HAGWASRRKP+ +IYTSNGVSLHE + S R +S+ +N+DLC IC DGG+LL CDSCP
Sbjct: 575 HAGWASRRKPYFYIYTSNGVSLHEWATTFSHGRKYSANDNNDLCVICADGGNLLLCDSCP 634
Query: 737 RAFHIDCVSLPGIPSGTWHCRYCMNTFQKEKFVEYNANARAAGRIEGVDPFAQMVSRCIR 796
RAFHI+CVSLP IP G WHC+YC N F E EYN N+ A G++EGVDP Q+ RCIR
Sbjct: 635 RAFHIECVSLPSIPRGNWHCKYCENKFTSEIAGEYNVNSSAVGQLEGVDPVDQLAGRCIR 694
Query: 797 IVQTPDTELGGCVLCRGRDFCKSRFGRRTVILCDQCEREYHVGCLKDHGMEDLQELPKGK 856
+V+ + E GCVLC G DFC+S FG RT+I+CDQCE+EYH+GCL + DL+ELPKG
Sbjct: 695 VVKNMEAETNGCVLCSGSDFCRSGFGPRTIIICDQCEKEYHIGCLSSQNIVDLKELPKGN 754
Query: 857 WLCCADCKRINLALQKLVDRGEEKLPETSLDVIKKKHEESGSDNAVDFDVRWRVLRGKKV 916
W C DC RIN LQKL+ G EKL ++SL +I+ K E + + D D+RWR++ GK
Sbjct: 755 WFCSMDCTRINSTLQKLLLGGAEKLSDSSLGIIQTKQERNDVYSISDLDIRWRLISGKVT 814
Query: 917 DASDGTRALLSKAVSIFHDRFDPIIESASKLDLIPAMVYGRSHRGQDYHGMYCAILTVNQ 976
S +R LLS+A++IFHD FDPI++ S +LIP MVYG++ +GQDY G+ CA+LTVN
Sbjct: 815 --SPESRMLLSQALAIFHDCFDPIVDPLSGSNLIPRMVYGKTMQGQDYGGICCAVLTVNA 872
Query: 977 VVVSAGIFRIFGQELAELPLVATSNDCQGQGYFQSLFCCIEKLLGFLNVKTLVLPSASEA 1036
VVSAG+ R+FG+E+AELPLVAT + +GYFQ LF CIEKLL LNV+++V+P+A EA
Sbjct: 873 TVVSAGLLRVFGREVAELPLVATRMCSREKGYFQLLFSCIEKLLSSLNVESIVVPAAEEA 932
Query: 1037 QAIWTNKFGFSMMTEEEQNKY-RNDYPLMIFQGTSMLQKPVPKCRIVGKSVD 1087
+ +W NKFGF + E+ +KY + Y ++ F+G SMLQKPV +I+ K+++
Sbjct: 933 EPLWMNKFGFRKLAPEQLSKYIKICYQMVRFKGASMLQKPVDSHQIIDKTIE 984
|
|
| TAIR|locus:2201021 AT1G05380 "AT1G05380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147391 AT5G36740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086395 ROS4 "AT3G14980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2832118 AT5G36670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2178828 AT5G58610 "AT5G58610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JFR1 AIRE "Autoimmune regulator" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-071008-4 aire "autoimmune regulator" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173179 AT5G13660 "AT5G13660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168088 AT5G59830 "AT5G59830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1088 | |||
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 1e-11 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 3e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-06 | |
| COG5141 | 669 | COG5141, COG5141, PHD zinc finger-containing prote | 8e-06 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-05 | |
| cd11726 | 127 | cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-tha | 3e-04 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 5e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 6e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.003 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Score = 60.2 bits (146), Expect = 1e-11
Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 7/49 (14%)
Query: 720 CGICM---DGGDLLCCDSCPRAFHIDCVSLP----GIPSGTWHCRYCMN 761
C +C D G+LL CD C R FH+ C+ P IP G W+C C
Sbjct: 2 CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKP 50
|
PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51 |
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213034 cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-thalassemia/mental retardation, X-linked) | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1088 | |||
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 99.16 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 99.11 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 99.02 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 99.0 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 98.99 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 98.99 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 98.98 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 98.96 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 98.95 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 98.93 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 98.89 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.88 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 98.86 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 98.73 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 98.73 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.71 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 98.71 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 98.67 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 98.65 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 98.64 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 98.62 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 98.61 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 98.61 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 98.61 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 98.58 | |
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 98.54 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 98.53 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 98.47 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 98.47 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 98.43 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 98.43 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 98.42 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.41 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 98.38 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 98.37 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 98.35 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 98.34 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 98.27 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 98.27 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 98.25 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 98.2 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 98.19 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 98.15 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 98.12 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.08 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 98.05 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 98.05 | |
| smart00258 | 73 | SAND SAND domain. | 98.04 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.03 | |
| KOG3396 | 150 | consensus Glucosamine-phosphate N-acetyltransferas | 98.01 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 97.99 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 97.96 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 97.96 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 97.94 | |
| PHA01807 | 153 | hypothetical protein | 97.93 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 97.92 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 97.91 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 97.89 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.85 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 97.83 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 97.83 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 97.8 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 97.78 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 97.77 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 97.76 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.74 | |
| PF01342 | 82 | SAND: SAND domain; InterPro: IPR000770 The SAND do | 97.71 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.67 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 97.65 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 97.65 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 97.65 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.6 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 97.58 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 97.49 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.47 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 97.37 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 97.34 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 97.33 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 97.28 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.24 | |
| KOG3397 | 225 | consensus Acetyltransferases [General function pre | 97.21 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.12 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.03 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 96.94 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 96.78 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 96.76 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 96.56 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 96.37 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 96.26 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 96.26 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 96.11 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 96.1 | |
| KOG4144 | 190 | consensus Arylalkylamine N-acetyltransferase [Gene | 95.96 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 95.93 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 95.85 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 95.77 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 95.67 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 95.63 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 95.6 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 95.52 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 95.49 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 95.47 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 95.25 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 94.76 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 94.68 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 94.45 | |
| KOG3138 | 187 | consensus Predicted N-acetyltransferase [General f | 94.3 | |
| smart00258 | 73 | SAND SAND domain. | 94.03 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 93.24 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 93.1 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 93.08 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 93.05 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 92.98 | |
| PF06852 | 181 | DUF1248: Protein of unknown function (DUF1248); In | 92.79 | |
| PF01342 | 82 | SAND: SAND domain; InterPro: IPR000770 The SAND do | 92.68 | |
| TIGR03694 | 241 | exosort_acyl putative PEP-CTERM/exosortase system- | 92.54 | |
| KOG3235 | 193 | consensus Subunit of the major N alpha-acetyltrans | 92.45 | |
| COG1243 | 515 | ELP3 Histone acetyltransferase [Transcription / Ch | 91.22 | |
| KOG3234 | 173 | consensus Acetyltransferase, (GNAT) family [Genera | 90.85 | |
| PF00765 | 182 | Autoind_synth: Autoinducer synthetase; InterPro: I | 88.85 | |
| PRK13834 | 207 | putative autoinducer synthesis protein; Provisiona | 88.16 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 84.32 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 84.27 | |
| cd04264 | 99 | DUF619-NAGS DUF619 domain of various N-acetylgluta | 82.58 | |
| PF07897 | 284 | DUF1675: Protein of unknown function (DUF1675); In | 81.32 |
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.16 E-value=2e-11 Score=143.33 Aligned_cols=150 Identities=25% Similarity=0.529 Sum_probs=99.0
Q ss_pred ccccccccccC-----CceEecCC--CCCccccccCCCCCCCCCCccccccccc-----------ccccceeeccccccc
Q 001383 716 NDDLCGICMDG-----GDLLCCDS--CPRAFHIDCVSLPGIPSGTWHCRYCMNT-----------FQKEKFVEYNANARA 777 (1088)
Q Consensus 716 ndd~C~VC~dg-----GeLl~CD~--C~rafH~~Cl~~~~vP~G~W~C~~C~~~-----------~~Kek~v~~~~na~a 777 (1088)
...-|.||.|. ..|++||+ |.-+.|+.|+++-++|.|.|||+.|... .+++....+..+..|
T Consensus 4 MVGGCCVCSDErGWaeNPLVYCDG~nCsVAVHQaCYGIvqVPtGpWfCrKCesqeraarvrCeLCP~kdGALKkTDn~GW 83 (900)
T KOG0956|consen 4 MVGGCCVCSDERGWAENPLVYCDGHNCSVAVHQACYGIVQVPTGPWFCRKCESQERAARVRCELCPHKDGALKKTDNGGW 83 (900)
T ss_pred cccceeeecCcCCCccCceeeecCCCceeeeehhcceeEecCCCchhhhhhhhhhhhccceeecccCcccceecccCCCc
Confidence 44579999974 47999997 9999999999999999999999999642 123333333333333
Q ss_pred c----------ccccccccccccchheeeeccCC--CCCCCcceeccCCCCCCCCCCCcceeecC--CCCCcCCCCCCCC
Q 001383 778 A----------GRIEGVDPFAQMVSRCIRIVQTP--DTELGGCVLCRGRDFCKSRFGRRTVILCD--QCEREYHVGCLKD 843 (1088)
Q Consensus 778 a----------grveGvdpieqi~~rciRivk~~--d~e~~~C~vCk~~d~sksgf~~g~LL~CD--qC~raYHv~CL~p 843 (1088)
+ -++..+..++.|. ++.+ |.....|+||.+.+... ....+.++.|+ .|.++||+.|...
T Consensus 84 AHVVCALYIPEVrFgNV~TMEPIi------Lq~VP~dRfnKtCYIC~E~Grpn-kA~~GACMtCNKs~CkqaFHVTCAQ~ 156 (900)
T KOG0956|consen 84 AHVVCALYIPEVRFGNVHTMEPII------LQDVPHDRFNKTCYICNEEGRPN-KAAKGACMTCNKSGCKQAFHVTCAQR 156 (900)
T ss_pred eEEEEEeeccceeeccccccccee------eccCchhhhcceeeeecccCCcc-ccccccceecccccchhhhhhhHhhh
Confidence 2 1222232333321 2222 22346799999864322 22346799998 7999999999998
Q ss_pred CCCCCccc--CCCCCcccCCCchhhHHHHHHH
Q 001383 844 HGMEDLQE--LPKGKWLCCADCKRINLALQKL 873 (1088)
Q Consensus 844 ~g~~~LkE--iP~g~WfCp~~C~~I~~kLqkL 873 (1088)
.|+-.-++ +-+.--|| ..|+..+.+|.+-
T Consensus 157 ~GLLCEE~gn~~dNVKYC-GYCk~HfsKlkk~ 187 (900)
T KOG0956|consen 157 AGLLCEEEGNISDNVKYC-GYCKYHFSKLKKS 187 (900)
T ss_pred hccceeccccccccceec-hhHHHHHHHhhcC
Confidence 87644333 11223588 6999999988763
|
|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00258 SAND SAND domain | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF01342 SAND: SAND domain; InterPro: IPR000770 The SAND domain (named after Sp100, AIRE-1, NucP41/75, DEAF-1) is a conserved ~80 residue region found in a number of nuclear proteins, many of which function in chromatin-dependent transcriptional control | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG3397 consensus Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00258 SAND SAND domain | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >PF01342 SAND: SAND domain; InterPro: IPR000770 The SAND domain (named after Sp100, AIRE-1, NucP41/75, DEAF-1) is a conserved ~80 residue region found in a number of nuclear proteins, many of which function in chromatin-dependent transcriptional control | Back alignment and domain information |
|---|
| >TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase | Back alignment and domain information |
|---|
| >KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] | Back alignment and domain information |
|---|
| >PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth | Back alignment and domain information |
|---|
| >PRK13834 putative autoinducer synthesis protein; Provisional | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish | Back alignment and domain information |
|---|
| >PF07897 DUF1675: Protein of unknown function (DUF1675); InterPro: IPR012463 The members of this family are sequences derived from hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1088 | ||||
| 1xwh_A | 66 | Nmr Structure Of The First Phd Finger Of Autoimmune | 6e-12 | ||
| 2kft_A | 56 | Nmr Solution Structure Of The First Phd Finger Doma | 4e-11 | ||
| 3u5m_A | 207 | Crystal Structure Of Trim33 Phd-Bromo In The Free S | 1e-10 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 3e-10 | ||
| 1mm2_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 3e-10 | ||
| 1mm3_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 5e-09 | ||
| 2puy_A | 60 | Crystal Structure Of The Bhc80 Phd Finger Length = | 5e-07 | ||
| 2l5u_A | 61 | Structure Of The First Phd Finger (Phd1) From Chd4 | 8e-07 | ||
| 2yql_A | 56 | Solution Structure Of The Phd Domain In Phd Finger | 1e-06 | ||
| 2ku3_A | 71 | Solution Structure Of Brd1 Phd1 Finger Length = 71 | 1e-06 | ||
| 2l43_A | 88 | Structural Basis For Histone Code Recognition By Br | 2e-06 |
| >pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 | Back alignment and structure |
|
| >pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 | Back alignment and structure |
| >pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 | Back alignment and structure |
| >pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 | Back alignment and structure |
| >pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 | Back alignment and structure |
| >pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 | Back alignment and structure |
| >pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 | Back alignment and structure |
| >pdb|2KU3|A Chain A, Solution Structure Of Brd1 Phd1 Finger Length = 71 | Back alignment and structure |
| >pdb|2L43|A Chain A, Structural Basis For Histone Code Recognition By Brpf2-Phd1 Finger Length = 88 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
Score = 94.1 bits (233), Expect = 8e-23
Identities = 26/116 (22%), Positives = 41/116 (35%), Gaps = 18/116 (15%)
Query: 653 GYKKGFGILCTCCNSEVSPSQFEAHAGWASRRKPFQHIYTSNGVSLHELSIKLSLERPFS 712
+ CT C +V+ Q + R P + + +S +S
Sbjct: 2 PLGSMGIVSCTACGQQVNHFQK-----DSIYRHPSLQVLICKNCFKYYMSDDIS----RD 52
Query: 713 SKENDDLCGICMDGGDLLCCDSCPRAFHIDCVSLP---------GIPSGTWHCRYC 759
S D+ C C +GG+L+CCD C AF C+ + W+C C
Sbjct: 53 SDGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRRELSTIMDENNQWYCYIC 108
|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 164 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1088 | |||
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.7 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.66 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.6 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 99.55 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 99.18 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 99.14 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 99.12 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 99.11 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 99.09 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.08 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 99.05 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 99.02 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.02 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 99.02 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 99.01 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 99.01 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.0 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 99.0 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 98.97 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 98.96 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.95 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.95 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 98.94 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 98.94 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 98.94 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 98.93 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.93 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.93 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.93 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 98.93 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.92 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 98.92 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 98.92 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 98.91 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 98.91 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 98.91 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 98.9 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 98.9 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 98.9 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 98.89 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 98.89 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 98.89 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 98.89 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 98.89 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 98.88 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 98.88 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 98.88 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 98.87 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 98.87 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 98.87 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 98.86 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 98.86 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 98.86 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 98.86 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 98.85 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 98.85 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 98.85 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 98.85 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 98.84 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 98.84 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 98.83 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 98.83 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 98.83 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 98.83 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 98.83 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 98.83 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.82 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 98.82 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 98.82 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 98.82 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 98.81 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 98.8 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.8 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 98.8 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.79 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 98.79 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 98.79 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 98.79 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 98.78 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 98.78 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.77 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 98.77 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 98.77 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 98.77 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 98.77 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 98.77 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 98.77 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 98.76 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 98.76 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.75 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 98.75 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 98.75 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 98.74 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 98.73 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 98.73 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 98.72 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 98.72 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 98.71 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.7 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 98.7 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.7 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 98.69 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 98.69 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.68 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 98.68 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 98.67 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 98.67 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 98.67 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.66 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 98.65 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 98.65 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.65 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 98.64 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 98.64 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 98.64 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 98.63 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 98.63 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 98.62 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 98.61 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 98.61 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.61 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 98.61 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 98.6 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 98.6 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 98.6 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.6 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 98.59 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 98.59 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 98.59 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 98.58 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 98.58 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 98.57 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 98.56 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 98.56 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 98.55 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.55 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 98.55 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 98.53 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 98.53 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 98.53 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 98.52 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 98.51 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 98.51 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 98.51 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.5 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.5 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 98.5 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.49 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 98.49 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 98.49 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 98.48 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 98.48 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.47 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.46 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.46 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 98.46 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 98.45 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 98.45 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 98.45 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.44 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 98.44 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 98.44 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 98.44 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.43 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.42 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 98.42 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 98.41 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.41 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 98.4 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 98.37 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 98.37 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 98.37 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 98.36 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 98.34 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.33 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 98.31 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 98.31 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.31 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.3 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.29 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.28 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 98.26 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 98.25 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 98.25 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 98.24 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 98.24 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 98.23 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 98.23 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.22 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.21 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 98.21 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.2 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 98.2 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 98.18 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.17 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 98.17 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.15 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.12 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 98.11 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.11 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.08 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 98.05 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.02 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.01 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 97.96 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 97.94 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 97.94 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 97.89 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 97.87 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 97.87 | |
| 1kzf_A | 230 | Acyl-homoserinelactone synthase ESAI; alpha-beta, | 97.83 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.83 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 97.82 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.8 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 97.77 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 97.75 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 97.74 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 97.73 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 97.72 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 97.66 | |
| 1h5p_A | 95 | Nuclear autoantigen SP100-B; transcription, DNA bi | 97.64 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 97.64 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 97.6 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 97.55 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 97.52 | |
| 1ufn_A | 94 | Putative nuclear protein homolog 5830484A20RIK; SA | 97.51 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 97.46 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 97.44 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 97.32 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 97.25 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.12 | |
| 1oqj_A | 97 | Glucocorticoid modulatory element binding protein- | 97.08 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 97.05 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 97.02 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 96.84 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 96.83 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.82 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.77 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 96.72 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 96.67 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 96.59 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 96.59 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 96.54 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 96.53 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 96.5 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.49 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 96.39 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.38 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 96.38 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 96.31 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 96.27 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 96.26 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 96.2 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 96.19 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 96.13 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 96.08 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.05 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 95.89 | |
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 95.18 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 94.95 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 94.71 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 94.6 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 94.58 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 94.09 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 93.45 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 93.17 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 92.49 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 90.5 | |
| 1yle_A | 342 | Arginine N-succinyltransferase, alpha chain; struc | 88.87 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 88.84 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 88.63 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 87.85 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 83.63 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 82.95 |
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.70 E-value=8.9e-18 Score=159.71 Aligned_cols=96 Identities=28% Similarity=0.845 Sum_probs=81.6
Q ss_pred CCccccccccccccCCce---EecCCCCCccccccCCCCC--CCCCCcccccccccccccceeecccccccccccccccc
Q 001383 712 SSKENDDLCGICMDGGDL---LCCDSCPRAFHIDCVSLPG--IPSGTWHCRYCMNTFQKEKFVEYNANARAAGRIEGVDP 786 (1088)
Q Consensus 712 ss~~ndd~C~VC~dgGeL---l~CD~C~rafH~~Cl~~~~--vP~G~W~C~~C~~~~~Kek~v~~~~na~aagrveGvdp 786 (1088)
++..+++.|.+|+++|++ ++|+.|+++||..|++++. ++.+.|+|+.|..
T Consensus 2 s~~~~~~~C~~C~~~g~~~~ll~C~~C~~~~H~~Cl~~~~~~~~~~~W~C~~C~~------------------------- 56 (111)
T 2ysm_A 2 SSGSSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKV------------------------- 56 (111)
T ss_dssp CCCCCCSCBTTTCCCCCTTTSEECSSSCCEECTTTTTCCCCTTTSTTCCCTTTCC-------------------------
T ss_pred CCCCCCCCCcCCCCCCCCcCCeECCCCCCCcChHHhCCccccccccCccCCcCCc-------------------------
Confidence 356789999999999876 9999999999999998764 4579999999962
Q ss_pred ccccchheeeeccCCCCCCCcceeccCCCCCCCCCCCcceeecCCCCCcCCCCCCCCCCCCCcccCCCCCcccCCCch
Q 001383 787 FAQMVSRCIRIVQTPDTELGGCVLCRGRDFCKSRFGRRTVILCDQCEREYHVGCLKDHGMEDLQELPKGKWLCCADCK 864 (1088)
Q Consensus 787 ieqi~~rciRivk~~d~e~~~C~vCk~~d~sksgf~~g~LL~CDqC~raYHv~CL~p~g~~~LkEiP~g~WfCp~~C~ 864 (1088)
|.+|++.+ ++..|+.||+|+++||+.||.| +|.++|.+.|||+ .|.
T Consensus 57 ---------------------C~~C~~~~------~~~~ll~Cd~C~~~yH~~Cl~p----pl~~~P~g~W~C~-~C~ 102 (111)
T 2ysm_A 57 ---------------------CQNCKQSG------EDSKMLVCDTCDKGYHTFCLQP----VMKSVPTNGWKCK-NCR 102 (111)
T ss_dssp ---------------------CTTTCCCS------CCTTEEECSSSCCEEEGGGSSS----CCSSCCSSCCCCH-HHH
T ss_pred ---------------------ccccCccC------CCCCeeECCCCCcHHhHHhcCC----ccccCCCCCcCCc-CCc
Confidence 88898753 2457999999999999999994 6888999999996 553
|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1h5p_A Nuclear autoantigen SP100-B; transcription, DNA binding, SAND domain, KDWK, nuclear protein, alternative splicing; NMR {Homo sapiens} SCOP: d.217.1.1 | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >1ufn_A Putative nuclear protein homolog 5830484A20RIK; SAND domain, KDWK motif, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.217.1.1 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >1oqj_A Glucocorticoid modulatory element binding protein-1; SAND domain, alpha-beta fold, KDWK motif, zinc-binding motif, DNA binding protein; 1.55A {Homo sapiens} SCOP: d.217.1.1 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1088 | ||||
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 4e-16 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 3e-05 | |
| d1ygha_ | 164 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 7e-15 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 1e-13 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 6e-04 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 3e-10 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 1e-05 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 3e-09 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 0.002 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 5e-09 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 6e-06 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 2e-08 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 2e-04 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 1e-07 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 0.004 | |
| d1wesa_ | 71 | g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I | 7e-06 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 4e-05 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 7e-04 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 0.003 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 0.002 |
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Mi2-beta (CHD4) species: Human (Homo sapiens) [TaxId: 9606]
Score = 71.5 bits (175), Expect = 4e-16
Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
Query: 710 PFSSKENDDLCGICMDGGDLLCCDSCPRAFHIDCV--SLPGIPSGTWHCRYCMNTFQKEK 767
P S + + C +C DGG+LLCCD+CP ++HI C+ LP IP+G W C C K K
Sbjct: 2 PLGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGK 61
|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1088 | |||
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.53 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.53 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 99.52 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 99.32 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 99.24 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 99.16 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 99.15 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 99.13 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 99.06 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 99.04 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 99.03 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 99.03 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 98.97 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 98.97 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 98.96 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 98.95 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.91 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 98.87 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 98.87 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 98.86 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 98.84 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 98.84 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 98.83 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 98.8 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 98.78 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 98.78 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.74 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 98.71 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 98.7 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 98.69 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 98.67 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 98.66 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 98.65 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 98.64 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 98.61 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 98.59 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 98.58 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 98.56 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 98.53 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 98.53 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 98.47 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 98.4 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 98.4 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 98.39 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 98.36 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.36 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.36 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 98.36 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 98.35 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 98.34 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 98.31 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.31 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 98.31 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.27 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 98.2 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.02 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.02 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 97.86 | |
| d1ufna_ | 94 | Putative nuclear protein homolog 5830484a20rik {Mo | 97.83 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.75 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 97.71 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 97.7 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.62 | |
| d1h5pa_ | 95 | Nuclear autoantigen Sp100b {Human (Homo sapiens) [ | 97.59 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 97.57 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.51 | |
| d1oqja_ | 90 | Glucocorticoid modulatory element binding protein- | 97.49 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.44 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 97.39 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.36 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.23 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 97.21 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.19 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 97.07 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.01 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 96.98 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 96.96 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.87 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.85 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.39 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 96.15 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 95.95 | |
| d1kzfa_ | 210 | Acyl-homoserinelactone synthase EsaI {Pantoea stew | 95.65 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 95.61 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 93.45 | |
| d1ufna_ | 94 | Putative nuclear protein homolog 5830484a20rik {Mo | 93.24 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 89.15 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 88.8 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 87.66 | |
| d1lrza3 | 182 | Methicillin resistance protein FemA {Staphylococcu | 86.22 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 85.24 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 80.85 |
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Catalytic domain of GCN5 histone acetyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.53 E-value=3e-14 Score=141.46 Aligned_cols=140 Identities=16% Similarity=0.236 Sum_probs=111.3
Q ss_pred hhhHHHHHHHHhhhhccCcccccCcCCCccccccccccCCCcceeceEEEEEEeCCEEEEEEEEEEe-cCceEEEeeeee
Q 001383 921 GTRALLSKAVSIFHDRFDPIIESASKLDLIPAMVYGRSHRGQDYHGMYCAILTVNQVVVSAGIFRIF-GQELAELPLVAT 999 (1088)
Q Consensus 921 e~~~~LavAl~If~EcFdPIiD~~Sg~DLIp~MVYg~~~~rl~f~GfY~~VL~~~~evVsaA~lri~-g~~~AEip~VAT 999 (1088)
+...+|..+.++|...| +...+|.|+.++|..+ ..++|+..+|++||++.++++ +.++|||..+||
T Consensus 19 ~~~~~L~~~~~iF~~~l-----p~m~~~yi~r~~~d~~--------~~~~v~~~~~~iIG~i~~~~~~~~~~aeI~~laV 85 (162)
T d1z4ra1 19 RVLLWLVGLQNVFSHQL-----PRMPKEYIARLVFDPK--------HKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAV 85 (162)
T ss_dssp HHHHHHHHHHHHHHHHC-----TTSCHHHHHHHHTCTT--------CEEEEEEETTEEEEEEEEEEETTTTEEEEEEEEE
T ss_pred HHHHHHHHHHHHHHHhC-----CCCcHHHHHHHhcCCC--------ceEEEEEECCEEEEEEEEEEECCCCEEEEEEEEE
Confidence 44556667778898887 3445788999998653 346777889999999999987 557999999999
Q ss_pred ccCcccCChhHHHHHHHHHHhhhcCccEEEecChhhhHHHHHhccCcEEcCHHHHHhhhcccCeeeeCCceeeeccC
Q 001383 1000 SNDCQGQGYFQSLFCCIEKLLGFLNVKTLVLPSASEAQAIWTNKFGFSMMTEEEQNKYRNDYPLMIFQGTSMLQKPV 1076 (1088)
Q Consensus 1000 ~~~~RgqG~gr~L~~aIE~~L~~lgV~~LvLpA~~eA~~~w~~kfGF~~i~~~el~~~~~~~~ll~F~GT~mLqK~l 1076 (1088)
+++|||||+|+.||+.+++.++..|+.+|++.|...|..||.+ +||+....-....+. . -+-.+.|.+++|=.|
T Consensus 86 ~~~~qgkGiG~~Lm~~l~~~~~~~g~~~i~~~~~~~A~~fY~k-~GF~~~~~~~~~~~~-~-~ikdy~~~~lm~~~~ 159 (162)
T d1z4ra1 86 TSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKK-QGFSKDIKVPKSRYL-G-YIKDYEGATLMECEL 159 (162)
T ss_dssp CGGGCSSSHHHHHHHHHHHHHHHTTCCEEEEEECGGGHHHHHH-TTEESCCCSCHHHHT-T-TSCCCTTCEEEEEEC
T ss_pred ChhhhhhhHHHHHHHHHHHHHHHCCCcEEEEecCcchHHHHHh-CCCeEeccCchhHhc-C-CccCCCCeEEEEEec
Confidence 9999999999999999999999999999999999999999987 999774432222221 1 134578888887544
|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ufna_ d.217.1.1 (A:) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h5pa_ d.217.1.1 (A:) Nuclear autoantigen Sp100b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oqja_ d.217.1.1 (A:) Glucocorticoid modulatory element binding protein-1 (Gmeb1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufna_ d.217.1.1 (A:) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|