Citrus Sinensis ID: 001400

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080-----

MWNSAENVFSRTSSFRDEVEDEEALRWAALERLPTYARARRGIFKNVVGDVKEVDVSELAVQEQRLVLDRLVNAVEDDPERFFDRMRKRCEAVDLELPKIEVRFQNLTVESFVHLGSRALPTIPNFIFNMTEALLRQLRIYRGNRSKLTILDDLSGIIRPSRLTLLLGPPSSGKTTLLLALAGRLGHHLQVSGKITYNGHGFKEFVPPRTSAYVSQQDWQVAEMTVRETLDFAGQCQGVGSKYDMITELARREKIAGIKPDEDLDIFMKSFALGGQKTSLVVEYIMKILGLDTCADTLVGDEMLKGISGGQKKRLTTGELLVGPARVLFMDEISNGLDSSTTYQIIKYLKHSTRALDGTTVISLLQPAPEAYELFDDVILLSEGQIVYQGPRVSVLDFFASMGFSCPKRKNVADFLQEVTSKKDQEQYWSNPYLPYRYISPGKFAEAFHSYHTGKNLSEELAVPFDRRFNHPAALSTSKYGEKRSELLKTSFNWQLLLMKRNSFIYVFKFIQLLIVALITMTVFFRTTMHHKTIDDGGLYLGALYFSMVIILFNGFTEVSMLVAKLPVLYKHRDLHFYPSWVYTIPSWALSIPTSLIESGFWVAVTYYVIGYDPNVVRFSRQLLLYFFLHQMSIGLFRVIGSLGRNMIVANTFGSFAMLVVMALGGFIISRDSIPKWWIWGFWVSPLMYAQNAASVNEFLGHSWDKKAGNSNFSLGEAILRQRSLFPESYWYWIGVGAMLGYTLLFNALFTFFLSYLNPLGKQQAVVSKKELQERDRRRKGENVVIELREYLQRSSSLNGKYFKQKGMVLPFQPLSMAFGNINYFVDVPVELKQEGVLEDRLQLLVNVTGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTGGIIEGDIYISGYPKRQETFARISGYCEQNDIHSPGLTVLESLLFSAWLRLPSEIELETQRAFVEEVMELVELTSLSGALIGLPGINGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARAAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDELLFMKRGGELIYAGPLGSKSCELIKYFEVESFMFKSPRIFYCQILFG

cccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccEEEEEcEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccCEECccEEEEEEccccccHHHHHHHHHccccccccEEEEEEEccccccccccccEEEEEcccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHccccEEcEEEccccccHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHccccEEEEcccCEEEEccccHHHHHHHccccccccccccccccccccccccccHHccccccccccccHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccccccEEEECcEEEEECcccHHHccccccccccccccccEEEEccEEEEEcccccccHHHHHHHHHccccccEEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHcHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccccHHHHHHHHcc

***********************ALRWAALERLPTYARARRGIFKNVVGDVKEVDVSELAVQEQRLVLDRLVNAVEDDPERFFDRMRKRCEAVDLELPKIEVRFQNLTVESFVHLGSRALPTIPNFIFNMTEALLRQLRIYRGNRSKLTILDDLSGIIRPSRLTLLLGPPSSGKTTLLLALAGRLGHHLQVSGKITYNGHGFKEFVPPRTSAYVSQQDWQVAEMTVRETLDFAGQCQGVGSKYDMITELARREKIAGIKPDEDLDIFMKSFALGGQKTSLVVEYIMKILGLDTCADTLVGDEMLKGISGGQKKRLTTGELLVGPARVLFMDEISNGLDSSTTYQIIKYLKHSTRALDGTTVISLLQPAPEAYELFDDVILLSEGQIVYQGPRVSVLDFFASMGFSCPKRKNVADFLQEVTSKKDQEQYWSNPYLPYRYISPGKFAEAFHSYHTGKNLSEELAVPFDRRFNHPA***********SELLKTSFNWQLLLMKRNSFIYVFKFIQLLIVALITMTVFFRTTMHHKTIDDGGLYLGALYFSMVIILFNGFTEVSMLVAKLPVLYKHRDLHFYPSWVYTIPSWALSIPTSLIESGFWVAVTYYVIGYDPNVVRFSRQLLLYFFLHQMSIGLFRVIGSLGRNMIVANTFGSFAMLVVMALGGFIISRDSIPKWWIWGFWVSPLMYAQNAASVNEFLGHSWDKKAGNSNFSLGEAILRQRSLFPESYWYWIGVGAMLGYTLLFNALFTFFLSYLNPLGKQ******************************************KGMVLPFQPLSMAFGNINYFVDVPVELKQEGVLEDRLQLLVNVTGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTGGIIEGDIYISGYPKRQETFARISGYCEQNDIHSPGLTVLESLLFSAWLRLPSEIELETQRAFVEEVMELVELTSLSGALIGLPGINGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARAAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDELLFMKRGGELIYAGPLGSKSCELIKYFEVESFMFKSPRIFYCQILFG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ABC transporter G family member 32	May be a general defense protein.	probable	O81016
Pleiotropic drug resistance protein 6	May be a general defense protein.	probable	Q8GU87
Putative pleiotropic drug resistance protein 7	May be a general defense protein.	probable	Q8GU88

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OZX, chain A
Confidence level:very confident
Coverage over the Query: 844-1068
View the alignment between query and template
View the model in PyMOL

Template: 3OZX, chain A
Confidence level:very confident
Coverage over the Query: 150-240,259,277-396
View the alignment between query and template
View the model in PyMOL

Template: 1G6H, chain A
Confidence level:very confident
Coverage over the Query: 148-261,275-394
View the alignment between query and template
View the model in PyMOL

Template: 3FVQ, chain A
Confidence level:very confident
Coverage over the Query: 832-1056
View the alignment between query and template
View the model in PyMOL

Template: 4ABY, chain A
Confidence level:confident
Coverage over the Query: 148-390
View the alignment between query and template
View the model in PyMOL

Template: 3J15, chain B
Confidence level:probable
Coverage over the Query: 778-920,931-1058
View the alignment between query and template
View the model in PyMOL