Citrus Sinensis ID: 001415


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080--
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQPTPAPVPTPLAGWMSNPPTVTHPAVSGGAIGLGSPSIPAAALKHPRTPPTNPSVDYPSGDSDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSHSHSQAFSTPEDLPKTVTRTLNQGSSPMSMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVSVNRVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKQLCVITCGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLGSRVDYEAPGRWCTTMAYSADGTRTYQGFRKRSLGVVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTSIDADGGLPASPRIRFNKDGCLLAVSTNDNGIKILATSDGIRLLRTFENLAYDASRTSENSKNGDVRSLADVKPRITEESNDKSKVWKLTELSEPNQCRSLRLPENLRATKISRLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATASVAPQLWQPPSGIMMTNDVTDSNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADSQLCVWSSDGWEKQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIFETTKLECVKQWVPRESSAPITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRINPSAYLPAGVSSSNVHPLVIAAHPQEPNEFALGLSDGGVHVFEPLESEGKWGVPPPVDNGSTSSMPATPPVGGSGSDQAQR
cccHHHHHHHHHHHHccccHHHHHHHHHHHccccEEEHHHHHHHHHcccHHHHHHHHccccccccccCEEEEHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccEEEEEEECcccccEEECcccccccccccccEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEEEEEEcccccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEccEEECcccccEEEEEEcccccEEEEEEECcccEEEEEEcccccEEEEcccccccEEEEEccccccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEECccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEEEcccccccccEEEEcccccEEEEEEccccEEEEEcccccEEEEEccccccccCECccccccccEEEEEEccccCEEEEcccEEEEEcccccccccccccccccccccccEEEEEEcccccEEEEEEcccEEEEEEccccccccccccccccccEEECcccccEEEcccccccccccEEEEEEcccccEEEEECcccEEEEEcccccEEEEEccccccEEEEEEccccccEEEEECccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEECccccEEEEEcccccccccEEEEcccccccccccccEEEEcccccEEEEEEcccEEEEEcccccEEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccccccccccccccEEEEEccccccEEEEECccccEEEEccccccccccccccccccccccccccccccccccccccc
****SRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHTCGQPNG*RAPSPANNPLLGSLPKAGVFPPLGAHGPFQPT********************************************TPPTNPSVDYPSGDSDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSHSHSQAFSTPEDLPKTVTRTLNQGSSPMSMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVSVNRVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKQLCVITCGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLGSRVDYEAPGRWCTTMAYSADGTRTYQGFRKRSLGVVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTSIDADGGLPASPRIRFNKDGCLLAVSTNDNGIKILATSDGIRLLRTFENLAYDASRTSENSKNGDVRSLADVKPRITEESNDKSKVWKLTELSEPNQCRSLRLPENLRATKISRLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATASVAPQLWQPPSGIMMTNDVTDSNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADSQLCVWSSDGWEKQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIFETTKLECVKQWVPRESSAPITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRINPSAYLPAGVSSSNVHPLVIAAHPQEPNEFALGLSDGGVHVFEPLESEGKWGVPP**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQPTPAPVPTPLAGWMSNPPTVTHPAVSGGAIGLGSPSIPAAALKHPRTPPTNPSVDYPSGDSDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSHSHSQAFSTPEDLPKTVTRTLNQGSSPMSMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVSVNRVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKQLCVITCGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLGSRVDYEAPGRWCTTMAYSADGTRTYQGFRKRSLGVVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTSIDADGGLPASPRIRFNKDGCLLAVSTNDNGIKILATSDGIRLLRTFENLAYDASRTSENSKNGDVRSLADVKPRITEESNDKSKVWKLTELSEPNQCRSLRLPENLRATKISRLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATASVAPQLWQPPSGIMMTNDVTDSNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADSQLCVWSSDGWEKQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIFETTKLECVKQWVPRESSAPITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRINPSAYLPAGVSSSNVHPLVIAAHPQEPNEFALGLSDGGVHVFEPLESEGKWGVPPPVDNGSTSSMPATPPVGGSGSDQAQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein TOPLESS Transcriptional corepressor. May repress the expression of root-promoting genes in the top half of the embryo to allow proper differentiation of the shoot pole during the transition stage of embryogenesis. Regulates the expression of PLT1 and PLT2. Negative regulator of jasmonate responses. Negative regulator of auxin responses.confidentQ94AI7
Topless-related protein 1 Transcriptional corepressor. Activates TIR-NB-LRR R protein-mediated immune responses through repression of negative regulators such as CNGC2/DND1. Negative regulator of jasmonate responses.probableQ0WV90

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YMU, chain A
Confidence level:probable
Coverage over the Query: 422-698,709-755,766-773,785-919
View the alignment between query and template
View the model in PyMOL
Template: 2YMU, chain A
Confidence level:probable
Coverage over the Query: 422-698,709-755,766-773,785-919
View the alignment between query and template
View the model in PyMOL
Template: 1VYH, chain C
Confidence level:probable
Coverage over the Query: 461-543,564-749
View the alignment between query and template
View the model in PyMOL
Template: 2YNN, chain A
Confidence level:probable
Coverage over the Query: 346-559,573-614
View the alignment between query and template
View the model in PyMOL
Template: 3SHF, chain A
Confidence level:probable
Coverage over the Query: 422-538,550-562,573-801,844-911
View the alignment between query and template
View the model in PyMOL