Citrus Sinensis ID: 001452

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070-----

MAASVPPGAPRQQPPPPPPNYNPNLQQNPNSLSDNFQNLNLNRPVSMPNSGPRPTPFAQSPQFPVTAPSPPMSRPGPPPPGALSRPAGTPQQSFPPNVAPVRPFGPPVGQSLPFGSRPPPGSFPSSMGGGGPVGVPTSGVPPSSAFPSSGSLTRPVGATPGARPFPLASSLPFSSGLNVAPSGASDGVTSNGPMAFAASGGPRFPPAGSGAQQTRTPPAGPPSMLTSARSPQQSPSMRFPPVQQSPFSAAPQNAPPFSSAPPFSAAPQSAPPFSAAPQSTPPFSGAPSFPAPSPQGPPQVSPFGAHTWSAQPVGPSSSIPGSAQPSRMFGMPPPLQTQTMTNMPPAMGQTGAPMPASSKIDPQQIPRPVPSSTVVLYDTREGNQANPPPPATSEYIVRDMGNCSPRYMRCTISQIPCTNDLLTTSGMQLALLVQPLALPHPSEEPIQIVDFGDMGPVRCSRCKAYINPFMKFIDQGRRFICSLCGFTDETPRDYHCNLGPDGRRRDADDRPELCRGTVEFVATKEYMVRDPMPAVFFFLIDVSMNALQTGATAAACSAISQVISDLPEGPRTMVGIATFDSTIHFYNLKRALQQPLMLIVPDVEDVYTPLQSDIIVPVSECRQHLELLLESIPSMFQNNRTAESAFGAAVKAAFLALKSTGGKLLVFQSVLPSVGIGALSAREAEGRSNISSGEKETHKLLQPADKTLKAMAIEFAEYQVCVDVFITTQTYVDIASISVIPKTTGGQVYYYYPFSALSDPAKLYNDLRWNITRPQGFEAVMRVRCSQGIQVQEYHGNFCKRIPTDIDLPAIDCNKAIMVTLKHDDKLQDGSECAFQCALLYTTVYGQRRIRVTTLSLPCTSNLSNLYRSADLDTQFTCFMKQAASEIPSTPLANVREQMMNLCVNALVSYRKFCATVSSSGQLILPEALKLLPLYTLALIKSTGLRTDGRIDDRSFWITYVSSVSIPFAVPFVYPRMVAIHDLDKGEDGSIIPPFLPLSSEHVSDEGIYLLENGEDALIYIGSSVDSSILHQLFGISSVDEVPTQFVLQQYDNPLSKKLNDVVNEIRRQRCSYLR

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHcccccEEEEcccccccccccccCECcccccccccccccccccccccEEEccccEEEEcccccccccccccccccccccccccccccccccccEEEEECccccccccccccEEEEEEEccHHHHHHcHHHHHHHHHHHHHHccccccccEEEEEEEccEEEEEEcccccccccEEEcccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccHHHccccccHHHHHHHHHHHHHcccEEEEEEEccccccccccccccCCccCEEEECccccccccHHHHHHHHHHHccccccccEEEEEEEcccEEEEEEEEcccccccccccccccccccEEEEEEEEcccccccccEEEEEEEEEEEcccCEEEEEEEEcccccccHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHccHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHcccccCEEccccccccccccccccccccHHHcccccEEEEEcccEEEEEEcccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccccc

****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YDTREGNQANPPPPATSEYIVRDMGNCSPRYMRCTISQIPCTNDLLTTSGMQLALLVQPLALPHPSEEPIQIVDFGDMGPVRCSRCKAYINPFMKFIDQGRRFICSLCGFTDETPRDYHCNLGPDGR*R*ADDRPELCRGTVEFVATKEYMVRDPMPAVFFFLIDVSMNALQTGATAAACSAISQVISDLPEGPRTMVGIATFDSTIHFYNLKRALQQPLMLIVPDVEDVYTPLQSDIIVPVSECRQHLELLLESIPSMFQNNRTAESAFGAAVKAAFLALKSTGGKLLVFQSVLPSVGIGAL*******************KLLQPADKTLKAMAIEFAEYQVCVDVFITTQTYVDIASISVIPKTTGGQVYYYYPFSALSDPAKLYNDLRWNITRPQGFEAVMRVRCSQGIQVQEYHGNFCKRIPTDIDLPAIDCNKAIMVTLKHDDKLQDGSECAFQCALLYTTVYGQRRIRVTTLSLPCTSNLSNLYRSADLDTQFTCFMKQAASEIPSTPLANVREQMMNLCVNALVSYRKFCATVSSSGQLILPEALKLLPLYTLALIKSTGLRTDGRIDDRSFWITYVSSVSIPFAVPFVYPRMVAIHDLDKGEDGSIIPPFLPLSSEHVSDEGIYLLENGEDALIYIGSSVDSSILHQLFGISSVDEVPTQFVLQQYDNPLSKKLNDVVNEIRRQRCS***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein transport protein Sec24-like At4g32640	Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII is composed of at least five proteins: the SEC23/24 complex, the SEC13/31 complex, and the protein SAR1. Acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.	probable	Q9M081
Protein transport protein Sec24C	Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.	probable	P53992

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M2V, chain B
Confidence level:very confident
Coverage over the Query: 356-1031,1055-1070
View the alignment between query and template
View the model in PyMOL

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 356-1031,1055-1070
View the alignment between query and template
View the model in PyMOL