Citrus Sinensis ID: 001456


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070----
MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIESYGNRGGDNSVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQIKISSPGVNGFALNKLKGLKELELSKVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDLSNNRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWICCNLEGNGKDSSNDDFISSSAEMDVYEGPMLENDGNVSFSESDAGSRHTSSSISTVSSSNSRSLTARKSSKQWKRHHLQQRARQERLNNSRKWRGEGHAQTSMKEGQRYKSGNLDALASETPSEEASDIIGLDDDDKQLLSPEAESENLLFSVEDDKIRSGTGLHVENCSCAGLESTGKEGNDECSKHDSSSLSTANGATEQDEGSSSENSKAVCKTKRHSDRDLDNPKPCKSRKSMGENSNASQKYSSVSFCSIEDRLPDGFYDAGRDRPFMQLTGYEQTPHLDSREVILVDRKSDEELDAIALSAQALVLHLKQLNGLTKDGVIEPVDNLQIALLLALFVSDHFGGSDRSGIVERTRKTVSGSNYRKPFVCTCSTGNSDSANTSQKQILDAVEDIVLSDLCEKSLRSIKSKRNSVVVPIGSVQFGVCRHRAVLLKYLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRPHDIREEADPEYFIRYIPLYRTIAPFSTESDHSPCSGLDPGSFPSLSSCDEAGKSVSSSLFRCKFGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVLRAMHKPNLYGLVSSSLFCQFKVESKLIICLVIFPQFRYLKLFYHFFFLLKGAPSTTI
ccccccccccEEcccccccccccHHHHHcccccEEEcccccccccccccccccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHccccccccEEEccccccccccccHHHHHHHccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHcHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHcccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHHcccccccccEEEcccccccccccEEEEEEccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccccEEEEEEEEEccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccccEEEcccccccccccccccEEEEccccccccccccccccccHHHHHHccccccccEEEEcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccc
cccccccccHHccccccccccccHHHHHHHcccEEEccccccccccHHHccccccccccccHHHHccccccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHHHccccEEEccccccccccHHHHHHHcccEEEccccccccccccccHHHHHcccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHHHHHHHHHccccccHHHcccHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHcccHHccccHHccccccccccccHHHHHHHHcHHHHHHHcccccccccccccccccccHccEEEccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccEEccHHHHHHHHHHHHHccccEEEccHcHccHHHHHHHHHHHHHcccccccccHHEccccccccccEEEEEEcccccEEEEEEEcccccccccccccHHEEEEEccccEEEEcccccccccccccccccccccccccHccccccEEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccEEEcccccccccHHHEEEEEEccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccEEEcccccccccccEEEEEccccEEEcccccccHHHHHcccccccccccccccccHHHHEHccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccc
mqltnsveitqkspegpikeklpseankinnekngsvndddddsvidvsgktvdfpliesygnrggdnsveGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLqikisspgvngfalnklkglkelelskvpprpsvLTLLSEIAglkcltklsvchfsirylppeigclsnleqldlsfnkmkylPTEICYLKALISLKVANNKLVELPSGLYLLQRlenldlsnnrltslgslDLCLMHNLQNLNLQYNKLLsycqvpswiccnlegngkdssnddfisssaemdvyegpmlendgnvsfsesdagsrhtsssistvsssnsrsltarKSSKQWKRHHLQQRARQERLNnsrkwrgeghaqtsmkegqryksgnldalasetpseeasdiiglddddkqllspeaesenllfsveddkirsgtglhvencscaglestgkegndecskhdssslstangateqdegsssenskavcktkrhsdrdldnpkpcksrksmgensnasqkyssvsfcsiedrlpdgfydagrdrpfmqltgyeqtphldsrevilvdrksdEELDAIALSAQALVLHLKQlngltkdgviepvDNLQIALLLALFVsdhfggsdrsgivertrktvsgsnyrkpfvctcstgnsdsantSQKQILDAVEDIVLSDLCEKSLRSIkskrnsvvvpigsvqfgvCRHRAVLLKYLCdrveppvpcelvrgyldfqphaWNTILVKKGDSWIRMIVDacrphdireeadpeyfiRYIPlyrtiapfstesdhspcsgldpgsfpslsscdeagksvssslfrckfgsaDAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMyghkisskwlpsadgnpehhlLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILIDLErkkadgkpvvklcdfdravplrsfLHTCCiahrgipapdvcvgtprwmapevlramhkpnlyglvsssLFCQFKVESKLIICLVIFPQFRYLKLFYHFFFLlkgapstti
mqltnsveitqkspegpikeklpseankinnekngsvndddddsvIDVSGktvdfpliesygnrggdnsVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQIKISSPGVNGFALNKLKGLKELELSKVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDLSNNRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWICCNLEGNGKDSSNDDFISSSAEMDVYEGPMLENDGNVSFSESDAgsrhtsssistvsssnsrsltarksskqwkrhhlqqrarqerlnnsrkwrgeghaqtsmkegqrykSGNLDALASETPSEEASDIIGLDDDDKQLLSPEAESENLLFSVEDDKIRSGTGLHVENCSCAGLESTGKEGNDECSKHDSSSLSTAngateqdegsssenskavcktkrhsdrdldnpkpcksrksmgensnasqkyssvsFCSIEDRLPDGFYDAGRDRPFMQltgyeqtphldsREVILVDRKSDEELDAIALSAQALVLHLKQLNGLTKDGVIEPVDNLQIALLLALFVSDHfggsdrsgivertrktvsgsnyrkpfVCTCSTGNSDSANTSQKQILDAVEDIVLSDLCEKSLrsikskrnsvvvpigsvqfgvcRHRAVLLKYLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRphdireeadpeYFIRYIPLYRTIAPFSTESDHSPCSGLDPGSFPSLSSCDEAGKSVSSSLFRCKFGSADAAAKVRtlkvcgssadeiRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELhskhimhrdikSENILIDLerkkadgkpvVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVLRAMHKPNLYGLVSSSLFCQFKVESKLIICLVIFPQFRYLKLFYHFFFLLKGAPSTTI
MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGsvndddddsvidvsGKTVDFPLIESYGNRGGDNSVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQIKISSPGVNGFAlnklkglkelelskVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDLSNNRLTSLGSLDlclmhnlqnlnlqynkllSYCQVPSWICCNLEGNGKDSSNDDFISSSAEMDVYEGPMLENDGNVSFSESDAGsrhtsssistvsssnsrsltarkssKQWKRHHLQQRARQERLNNSRKWRGEGHAQTSMKEGQRYKSGNLDALASETPSEEASDIIGLDDDDKQLLSPEAESENLLFSVEDDKIRSGTGLHVENCSCAGLESTGKEGNDECSKHDSSSLSTANGATEQDEGSSSENSKAVCKTKRHSDRDLDNPKPCKSRKSMGENSNASQKYSSVSFCSIEDRLPDGFYDAGRDRPFMQLTGYEQTPHLDSREVILVDRKSDEELDAIALSAQALVLHLKQLNGLTKDGVIEPVDNLQIALLLALFVSDHFGGSDRSGIVERTRKTVSGSNYRKPFVCTCSTGNSDSANTSQKQILDAVEDIVLSDLCEKSLRSIKSKRNSVVVPIGSVQFGVCRHRAVLLKYLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRPHDIREEADPEYFIRYIPLYRTIAPFSTESDHSPCSGLDPGSFPSLSSCDEAGKSVSSSLFRCKFGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVLRAMHKPNLYGLVSSSLFCQFKVESKLIICLVIFPQFRylklfyhfffllkGAPSTTI
*********************************************IDVSGKTVDFPLIESYGNRGGDNSVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQIKISSPGVNGFALNKLKGLKELELSKVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDLSNNRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWICCNLE**************************************************************************************************************************************************************LHVENCSC*******************************************************************************SFCSIEDRLPDGFYDAGRDRPFMQLTGYEQTPHLDSREVILVDRKSDEELDAIALSAQALVLHLKQLNGLTKDGVIEPVDNLQIALLLALFVSDHFGGSDRSGIVERT**TVSGSNYRKPFVCTCS************QILDAVEDIVLSDLCEKSLRSIKSKRNSVVVPIGSVQFGVCRHRAVLLKYLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRPHDIREEADPEYFIRYIPLYRTIAPF*********************************LFRCKFGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVLRAMHKPNLYGLVSSSLFCQFKVESKLIICLVIFPQFRYLKLFYHFFFLLK*******
MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIESYGNRGGDNSVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQIKISSPGVNGFALNKLKGLKELELSKVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDLSNNRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWICCNLEGNGKDSSNDDFISSSAEMDVYEGPM*********************************************************************************************************************************************************************************************************************************EDRLPDGFYDAGRD**F**********HLDSREVILVDRKSDEELDAIALSAQALVLHLKQLNGLTKDGVIEPVDNLQIALLLALFVSDHFGGSDRSG************NYRKPFVCTCS****************AVEDIVLSDLC*************VVVPIGSVQFGVCRHRAVLLKYLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRPHDIREEADPEYFIRYIPLYRTIAPF****D***CSGLDPGSFPSLSSCDEAGKSVSSSLFRCKFGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVLRAMHKPNLYGLVSSSLFCQFKVESKLIICLVIFPQFRYLKLFYHFFFLLKGAP****
MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIESYGNRGGDNSVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQIKISSPGVNGFALNKLKGLKELELSKVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDLSNNRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWICCNLEGNGKDSSNDDFISSSAEMDVYEGPMLENDGNV*************************************************LNNSRK**************QRYKSGNLDAL*********SDIIGLDDDDKQLLSPEAESENLLFSVEDDKIRSGTGLHVENCSCAGLES***********************************************************************SSVSFCSIEDRLPDGFYDAGRDRPFMQLTGYEQTPHLDSREVILVDRKSDEELDAIALSAQALVLHLKQLNGLTKDGVIEPVDNLQIALLLALFVSDHFGGSDRSGIVERTRKTVSGSNYRKPFVCTCSTG*********KQILDAVEDIVLSDLCEKSLRSIKSKRNSVVVPIGSVQFGVCRHRAVLLKYLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRPHDIREEADPEYFIRYIPLYRTIAPFS**********LDPGSFPSLS**********SSLFRCKFGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVLRAMHKPNLYGLVSSSLFCQFKVESKLIICLVIFPQFRYLKLFYHFFFLLKGAPSTTI
****NSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIESYGNRGGDNSVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQIKISSPGVNGFALNKLKGLKELELSKVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDLSNNRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWICCNLEGNGKDSSNDDFISSSAEMDVYEGPMLENDGNVSFSESDAGSRHTSSSISTVSSSNSRSLTARKSSKQWKRHHLQQRARQERLNNSRKWRGEGHAQTSMKEGQRYKSGNLDAL***********IIG********LS**********************************************************************************DLDNPKPCKSRKSMGENSNASQKYSSVSFCSIEDRLPDGFYDAGRDRPFMQLTGYEQTPHLDSREVILVDRKSDEELDAIALSAQALVLHLKQLNGLTKDGVIEPVDNLQIALLLALFVSDHFGGSDRSGIVERTRKTVSGSNYRKPFVCTCST***********QILDAVEDIVLSDLCEKSLRSIKSKRNSVVVPIGSVQFGVCRHRAVLLKYLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRPHDIREEADPEYFIRYIPLYRTIAPFSTESD*SPCSGLDPGSFPSLSSCDEAGKSVSSSLFRCKFGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVLRAMHKPNLYGLVSSSLFCQFKVESKLIICLVIFPQFRYLKLFYHFFFLLKGAP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIESYGNRGGDNSVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQIKISSPGVNGFALNKLKGLKELELSKVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDLSNNRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWICCNLEGNGKDSSNDDFISSSAEMDVYEGPMLENDGNVSFSESDAGSRHTSSSISTVSSSNSRSLTARKSSKQWKRHHLQQRARQERLNNSRKWRGEGHAQTSMKEGQRYKSGNLDALASETPSEEASDIIGLDDDDKQLLSPEAESENLLFSVEDDKIRSGTGLHVENCSCAGLESTGKEGNDECSKHDSSSLSTANGATEQDEGSSSENSKAVCKTKRHSDRDLDNPKPCKSRKSMGENSNASQKYSSVSFCSIEDRLPDGFYDAGRDRPFMQLTGYEQTPHLDSREVILVDRKSDEELDAIALSAQALVLHLKQLNGLTKDGVIEPVDNLQIALLLALFVSDHFGGSDRSGIVERTRKTVSGSNYRKPFVCTCSTGNSDSANTSQKQILDAVEDIVLSDLCEKSLRSIKSKRNSVVVPIGSVQFGVCRHRAVLLKYLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRPHDIREEADPEYFIRYIPLYRTIAPFSTESDHSPCSGLDPGSFPSLSSCDEAGKSVSSSLFRCKFGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVLRAMHKPNLYGLVSSSLFCQFKVESKLIICLVIFPQFRYLKLFYHFFFLLKGAPSTTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1074 2.2.26 [Sep-21-2011]
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.172 0.099 0.336 1e-14
Q55EC7 960 RasGEF domain-containing yes no 0.168 0.188 0.325 3e-13
Q8AVI4577 Leucine-rich repeat prote N/A no 0.181 0.337 0.327 5e-13
Q4H4B6 1724 Protein scribble homolog yes no 0.159 0.099 0.313 1e-12
Q5F4C4529 Leucine-rich repeat prote no no 0.181 0.368 0.317 2e-12
Q9HB75910 p53-induced protein with yes no 0.155 0.183 0.353 6e-12
Q80TH2 1402 Protein LAP2 OS=Mus muscu yes no 0.173 0.132 0.300 9e-12
Q54R82 942 Mitogen-activated protein no no 0.135 0.154 0.291 1e-11
A6QLV3582 Leucine-rich repeat prote no no 0.163 0.302 0.307 3e-11
Q5RAV5582 Leucine-rich repeat prote no no 0.163 0.302 0.307 3e-11
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function desciption
 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 107/208 (51%), Gaps = 23/208 (11%)

Query: 81  NLIPKSVGRYEKLRNLKFFG-NEINL--FPSEVGNLLGLECLQIKISSPGVNGFALNKLK 137
           N IPK    + +L+NL   G N+++L   P++ G+L  LE L+++ +        +++L 
Sbjct: 116 NPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLT 175

Query: 138 GLKEL-----ELSKVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPEIGCLSNLEQL 192
            LK L     E+  +PP          +  L  L +L + H  ++ LPPE+G L+ L  L
Sbjct: 176 KLKRLDLGDNEIEDLPPY---------LGYLPGLHELWLDHNQLQRLPPELGLLTKLTYL 226

Query: 193 DLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDLSNNRLTSLG-SL 251
           D+S N+++ LP EI  L +L  L +A N L  LP G+  L RL  L L  NRL  L  +L
Sbjct: 227 DVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTL 286

Query: 252 DLCLMHNLQNLNLQYNKLLSYCQVPSWI 279
             C   N+Q L L  N L    ++P+ I
Sbjct: 287 GNC--ENMQELILTENFL---SELPASI 309




Required for polarization of the embryonic, imaginal disk and follicular epithelia. Specifically restricts apical membrane determinants to the apical cell surface; acts to exclude crb from the basolateral domain and define adherens junction position. Regulates cellular growth and differentiation; acts as a tumor suppressor. Essential for odor guided behavior.
Drosophila melanogaster (taxid: 7227)
>sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 Back     alignment and function description
>sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 Back     alignment and function description
>sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|Q9HB75|PIDD_HUMAN p53-induced protein with a death domain OS=Homo sapiens GN=PIDD PE=1 SV=2 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 Back     alignment and function description
>sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1074
2254328061117 PREDICTED: uncharacterized protein LOC10 0.932 0.897 0.687 0.0
2555520331152 ATP binding protein, putative [Ricinus c 0.899 0.838 0.669 0.0
224099855 1214 predicted protein [Populus trichocarpa] 0.925 0.818 0.649 0.0
4494332931131 PREDICTED: uncharacterized protein LOC10 0.936 0.889 0.609 0.0
3565744351021 PREDICTED: uncharacterized protein LOC10 0.932 0.981 0.613 0.0
3565341871109 PREDICTED: uncharacterized protein LOC10 0.927 0.898 0.616 0.0
152196751112 leucine-rich repeat protein kinase-like 0.899 0.868 0.579 0.0
2978432321115 leucine-rich repeat family protein [Arab 0.899 0.866 0.572 0.0
449525764970 PREDICTED: uncharacterized protein LOC10 0.786 0.871 0.615 0.0
2181937361112 hypothetical protein OsI_13471 [Oryza sa 0.883 0.853 0.477 0.0
>gi|225432806|ref|XP_002279386.1| PREDICTED: uncharacterized protein LOC100249467 [Vitis vinifera] gi|297737117|emb|CBI26318.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1411 bits (3653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/1032 (68%), Positives = 833/1032 (80%), Gaps = 30/1032 (2%)

Query: 1    MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIES 60
            MQL +S E+        + E +  + +K  +  +   N+ DD S++DVSG+ ++F ++E+
Sbjct: 1    MQLPDSGEVVS------VTEPVKDDQSKPLDAASTGENNADDQSILDVSGRNLEFSVLEN 54

Query: 61   YGNRGGDNSVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQ 120
                  +++VEGLYLYKNV NLIP+ +G   +L+ LKFF NEINLFP E  NL+GLECLQ
Sbjct: 55   C-----ESTVEGLYLYKNVFNLIPQRLGELGRLKMLKFFANEINLFPPEFRNLVGLECLQ 109

Query: 121  IKISSPGVNGFALNKLKGLKELELSKVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLP 180
            +K+SSPG+NG  L+KL+GLKELEL KVPPRPS   LLSEIAGLKCLTKLSVCHFSIRYLP
Sbjct: 110  VKLSSPGLNGLPLHKLRGLKELELCKVPPRPSAFPLLSEIAGLKCLTKLSVCHFSIRYLP 169

Query: 181  PEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSGLYLLQRLENLDL 240
            PEIGCL+NLE LDLSFNKMK LPTEI YL ALISLKVANNKLVELPSGL  LQRLENLDL
Sbjct: 170  PEIGCLNNLEDLDLSFNKMKSLPTEISYLSALISLKVANNKLVELPSGLSSLQRLENLDL 229

Query: 241  SNNRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWICCNLEGNGKDSSNDDFISSSA 300
            SNNRLTSLGSL+L  MHNLQNLNLQYNKLLS CQ+PSWICCNLEGNGKD+ ND+FISSS 
Sbjct: 230  SNNRLTSLGSLELVSMHNLQNLNLQYNKLLSCCQIPSWICCNLEGNGKDACNDEFISSSV 289

Query: 301  EMDVYEGPMLENDGNVSFSESDAGSRHTSSSISTVSSSNSRSLTARKSSKQWKR-HHLQQ 359
            EMDV E    E D ++  +    GS +TSSS  T  SSNSR   AR S K WKR ++LQQ
Sbjct: 290  EMDVLETTNQEIDESICCN----GSPNTSSSTLTGPSSNSRCFVARMSQKGWKRRYYLQQ 345

Query: 360  RARQERLNNSRKWRGEGHAQT-SMKEGQRYKSGNLDALASETPSEEASDIIGLDDDDKQL 418
            RARQERLNNSRKW+ E HA+  ++K  ++ + G L  L  E+ +E A DI+ LD+DDKQL
Sbjct: 346  RARQERLNNSRKWKSEDHAEVLTIKAAEKCEHGKLAVLHPESLAEHAPDIVVLDNDDKQL 405

Query: 419  LSPEAESENLLFSVEDDKIRSGTGLHVENCSCAGLESTG--KEGNDECSKHDSSSLSTAN 476
            LS EAESENLL SVED +     G      SCA L+S    +    EC+  D+S  S + 
Sbjct: 406  LSEEAESENLLNSVEDAESGPRKG------SCAVLDSIAINQGSKSECNDDDASLSSLSK 459

Query: 477  GATEQDEGSSSENSKAVCKTKRHSDRDLDNPKPCKSRKSMGENSNASQKYSSVSFCSIED 536
            GA+E++EGSSSE SK+  K+KRHSDRDLDNPKPCK+R+ + E+SN S KYS +S+C+IED
Sbjct: 460  GASEKNEGSSSEVSKSTPKSKRHSDRDLDNPKPCKARRPVNEHSNLSCKYSKISYCNIED 519

Query: 537  RLPDGFYDAGRDRPFMQLTGYEQTPHLDSREVILVDRKSDEELDAIALSAQALVLHLKQL 596
            RLPDGFYDAGRDRPFM LT YEQ  H DSREVIL+DR+ DEELDAI LSAQALV  LKQL
Sbjct: 520  RLPDGFYDAGRDRPFMPLTVYEQNFHFDSREVILLDRERDEELDAITLSAQALVSQLKQL 579

Query: 597  NGLTKDGVIEPVDNLQIALLLALFVSDHFGGSDRSGIVERTRKTVSGSNYRKPFVCTCST 656
            NGLTK+      DNLQIA LLALFVSDHFGGSD+S ++ERTRK+VSGSNY+KPFVC+CST
Sbjct: 580  NGLTKERKQVTDDNLQIASLLALFVSDHFGGSDKSALIERTRKSVSGSNYQKPFVCSCST 639

Query: 657  GNSDSANTSQKQILDAVEDIVLSDLCEKSLRSIKSKRNSVVVPIGSVQFGVCRHRAVLLK 716
            GN ++ +TS KQ LD VEDIV+SDLCEKSLRSIK++RNS++VPIG++QFGVCRHRAVL+K
Sbjct: 640  GNRNNISTSNKQNLDTVEDIVVSDLCEKSLRSIKARRNSIIVPIGTLQFGVCRHRAVLMK 699

Query: 717  YLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRPHDIREEADPEYFI 776
            YLCDR+EPPVPCELVRGYLDF PHAWN +  K+GDSW+RMIVDACRPHDIREE DPEYF 
Sbjct: 700  YLCDRMEPPVPCELVRGYLDFLPHAWNVVHTKRGDSWVRMIVDACRPHDIREETDPEYFC 759

Query: 777  RYIPLYRTIAPFSTESDHSPCSGLDPGSFPSLSSCDEAGKSVSSSLFRCKFGSADAAAKV 836
            RYIPL R   P ST+S  +P +G   GSFPSLS+CDE   + SSSL +CKFGS +AAAKV
Sbjct: 760  RYIPLSRINVPLSTQS--TPVTG---GSFPSLSACDEIANAPSSSLIQCKFGSVEAAAKV 814

Query: 837  RTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLL 896
            R L+VCG S DE+RNFEY CLGEVR+LGAL+HSCIVE+YGH+ISSKW+P++DGN EH +L
Sbjct: 815  RILEVCGDSVDEVRNFEYCCLGEVRILGALKHSCIVEIYGHQISSKWIPASDGNLEHRVL 874

Query: 897  QSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKS 956
            QSAI ME+VKGGS+K+Y+EKLSE GEKHV V+LAL IA+DVA+AL ELHSKHI+HRDIKS
Sbjct: 875  QSAILMEHVKGGSLKSYLEKLSEAGEKHVPVELALCIARDVASALAELHSKHIIHRDIKS 934

Query: 957  ENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEV 1016
            ENILIDL++K+ADG PVVKLCDFDRAVPLRSFLH+CCIAH GIP PDVCVGTPRWMAPEV
Sbjct: 935  ENILIDLDKKRADGTPVVKLCDFDRAVPLRSFLHSCCIAHIGIPPPDVCVGTPRWMAPEV 994

Query: 1017 LRAMHKPNLYGL 1028
            LRAMHK  +YGL
Sbjct: 995  LRAMHKREIYGL 1006




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255552033|ref|XP_002517061.1| ATP binding protein, putative [Ricinus communis] gi|223543696|gb|EEF45224.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224099855|ref|XP_002311646.1| predicted protein [Populus trichocarpa] gi|222851466|gb|EEE89013.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449433293|ref|XP_004134432.1| PREDICTED: uncharacterized protein LOC101218031 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356574435|ref|XP_003555353.1| PREDICTED: uncharacterized protein LOC100811118 [Glycine max] Back     alignment and taxonomy information
>gi|356534187|ref|XP_003535639.1| PREDICTED: uncharacterized protein LOC100819959 [Glycine max] Back     alignment and taxonomy information
>gi|15219675|ref|NP_171917.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|3142291|gb|AAC16742.1| Contains similarity to adenylate cyclase gb|AF012921 from Magnaporthe grisae. EST gb|Z24512 comes from this gene [Arabidopsis thaliana] gi|20466532|gb|AAM20583.1| unknown protein [Arabidopsis thaliana] gi|34365545|gb|AAQ65084.1| At1g04210 [Arabidopsis thaliana] gi|332189549|gb|AEE27670.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297843232|ref|XP_002889497.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297335339|gb|EFH65756.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449525764|ref|XP_004169886.1| PREDICTED: uncharacterized protein LOC101227936, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|218193736|gb|EEC76163.1| hypothetical protein OsI_13471 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1074
TAIR|locus:20202201112 AT1G04210 [Arabidopsis thalian 0.891 0.860 0.547 6.4e-273
TAIR|locus:2027794 1030 AT1G73660 [Arabidopsis thalian 0.060 0.063 0.420 8.1e-14
DICTYBASE|DDB_G0269250 3184 pats1 "LRRK family protein kin 0.164 0.055 0.298 1e-13
TAIR|locus:2194055 992 AT1G18160 [Arabidopsis thalian 0.060 0.065 0.420 1.1e-13
TAIR|locus:2827587526 PIRL5 "AT2G17440" [Arabidopsis 0.159 0.325 0.307 2.1e-13
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.166 0.142 0.279 6.3e-12
TAIR|locus:2117617549 PIRL4 "plant intracellular ras 0.159 0.311 0.290 9.9e-12
DICTYBASE|DDB_G0294094510 lrrA "leucine-rich repeat-cont 0.155 0.327 0.289 8.2e-11
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.163 0.140 0.278 1.4e-10
DICTYBASE|DDB_G0286127 1867 roco8 "LRRK family protein kin 0.089 0.051 0.367 1.7e-10
TAIR|locus:2020220 AT1G04210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2624 (928.8 bits), Expect = 6.4e-273, P = 6.4e-273
 Identities = 538/982 (54%), Positives = 672/982 (68%)

Query:    50 GKTVDFPLIESYGNRGGDNSVEGLYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSE 109
             G+ ++F L+++      D+SV+GLY ++NV NLIPKS+G   +LR LKFF NEI+LFP E
Sbjct:    43 GQNLEFSLLDNV-----DDSVKGLYFFRNVFNLIPKSIGGLGRLRKLKFFSNEIDLFPPE 97

Query:   110 VGNLLGLECLQIKISSPGV-NGFAXXXXXXXXXXXXXXVPPRPSVLTLLSEIAGLKCLTK 168
             +GNL+ LE LQ+KISSPG  +G +              VP R S LTLLSEI+GLKCLT+
Sbjct:    98 LGNLVNLEYLQVKISSPGFGDGLSWDKLKGLKELELTKVPKRSSALTLLSEISGLKCLTR 157

Query:   169 LSVCHFSIRYLPPEIGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVANNKLVELPSG 228
             LSVCHFSIRYLPPEIGCL +LE LDLSFNK+K LP EI YL +L  LKVA+N+L+EL   
Sbjct:   158 LSVCHFSIRYLPPEIGCLKSLEYLDLSFNKIKSLPNEIGYLSSLTFLKVAHNRLMELSPV 217

Query:   229 LYLLQRLENLDLSNNRLTSLGSLDXXXXXXXXXXXXXXXXXXSYCQVPSWICCNLEGNGK 288
             L LLQ LE+LD+SNNRLT+L  LD                  SYC +P+WI CN EGN +
Sbjct:   218 LALLQNLESLDVSNNRLTTLHPLDLNLMPRLQILNLRYNKLPSYCWIPTWIQCNFEGNYE 277

Query:   289 DSSNDDFISSSAEMDVYEGPMLENDGNVSFSESDAGXXXXXXXXXXXXXXXXXXXXXXXX 348
             +   D   SS  EMDV+E P  EN  NV  +    G                        
Sbjct:   278 EMGVDTCSSSMVEMDVFETPY-EN--NV-ITVPHKGSHRNPLNMSTGISSISRCFSARKS 333

Query:   349 XKQWKR--HHLQQRARQERLNNSRKWRGEGHAQTSMKEGQRYKSGNLDALASETPSEEAS 406
              K+WKR  ++ QQRARQERLNNSRKW+GE   +    + +  ++G       +     + 
Sbjct:   334 SKRWKRRQYYFQQRARQERLNNSRKWKGEVPPEGLSLKMEVEETGKQGMKVPQNTDRGSV 393

Query:   407 DIIGLDDDDKQLLSPEAESENLLFSVEDDKIRSGTGLHVENCSCAGLESTGKEGNDECSK 466
             D    D++DK  L  EA     + + E+++      +  +N  C   + T +  N E  +
Sbjct:   394 DNSCSDENDK--LFEEAS----VITSEEEESSLKADVVSDNSQCVETQLTSERDNYESCE 447

Query:   467 HDSSSLSTANGATEQDEGSSSENSKAVCKTKRHSDRDLDNPKPCKSRKSMGENSNASQKY 526
               +SS S+ +     D  SSSE  K   K+KR S++ LDNPK  K  K   + +N S+KY
Sbjct:   448 IKTSSPSSGDAPGTVDYNSSSERKKPNNKSKRCSEKYLDNPKGSKCHKLSTDITNLSRKY 507

Query:   527 SSVSFCSIEDRLPDGFYDAGRDRPFMQLTGYEQTPHLDSREVILVDRKSDEELDAIALSA 586
             SS SFCS ED LPDGF+DAGRDRPFM L+ YE+   LDSREVIL+DR  DE LDAI LSA
Sbjct:   508 SSNSFCSTEDSLPDGFFDAGRDRPFMTLSKYEKVLPLDSREVILLDRAKDEVLDAITLSA 567

Query:   587 QALVLHLKQLNGLTKDGVIEPVDNLQIALLLALFVSDHFGGSDRSGIVERTRKTVSGSNY 646
             +ALV  LK+LN LT D     +DNLQ+A  LALFVSDHFGGSDR+ I+ERTRK VSG+NY
Sbjct:   568 RALVARLKKLNCLTPDVDQVSIDNLQVASFLALFVSDHFGGSDRTAIIERTRKAVSGTNY 627

Query:   647 RKPFVCTCSTGNSDSANTSQKQILDAVEDIVLSDLCEKSLRSIKSKRNSVVVPIGSVQFG 706
             +KPF+CTC TGN D      KQ+    ED +LSD+CEKSLRSIKSKRNS+VVP+G +QFG
Sbjct:   628 QKPFICTCLTGNQDDLAALNKQVSTTAEDAILSDVCEKSLRSIKSKRNSIVVPLGKLQFG 687

Query:   707 VCRHRAVLLKYLCDRVEPPVPCELVRGYLDFQPHAWNTILVKKGDSWIRMIVDACRPHDI 766
             +CRHRA+L+KYLCDR+EPPVPCELVRGYLDF PHAWN + VK+G SW+RM+VDACRPHDI
Sbjct:   688 ICRHRALLMKYLCDRMEPPVPCELVRGYLDFMPHAWNIVPVKQGSSWVRMVVDACRPHDI 747

Query:   767 REEADPEYFIRYIPLYRTIAPFSTESDHSPCSGLDPGSFPSLSSCDEAGKSVSSSLFRCK 826
             RE+ D EYF RYIPL R       ES       L+PG   S  S  +  +  +SSL RCK
Sbjct:   748 REDTDQEYFCRYIPLNRL-----NESIRIK-EKLEPGCSVSSLSTGKGVERANSSLIRCK 801

Query:   827 FGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSKWLPS 886
              GS +A  K+RTL+V G+S D+IR FEY+CLGEVR+LGAL+H CIVE+YGH+ISSKW+ S
Sbjct:   802 LGSTEAVVKMRTLEVSGASLDDIRTFEYTCLGEVRILGALKHDCIVELYGHEISSKWITS 861

Query:   887 ADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHS 946
              +GN EH +LQS+I ME++KGGS+K +IEKLSE G+ HV + LAL IA+D++ AL+ELHS
Sbjct:   862 ENGN-EHRVLQSSILMEHIKGGSLKGHIEKLSEAGKHHVPMDLALSIARDISGALMELHS 920

Query:   947 KHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCV 1006
             K I+HRDIKSEN+LIDL+ + A+G+P+VKLCDFDRAVPLRS LH CCIAH GIP P++CV
Sbjct:   921 KDIIHRDIKSENVLIDLDNQSANGEPIVKLCDFDRAVPLRSHLHGCCIAHVGIPPPNICV 980

Query:  1007 GTPRWMAPEVLRAMHKPNLYGL 1028
             GTPRWM+PEV RAMH+ N YGL
Sbjct:   981 GTPRWMSPEVFRAMHEQNFYGL 1002




GO:0004672 "protein kinase activity" evidence=IEA;ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2027794 AT1G73660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269250 pats1 "LRRK family protein kinase Pats1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2194055 AT1G18160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827587 PIRL5 "AT2G17440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0294094 lrrA "leucine-rich repeat-containing protein (LRR)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286127 roco8 "LRRK family protein kinase Roco8" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.737
3rd Layer2.7.110.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00020066001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (1117 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1074
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 4e-29
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-25
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-25
pfam00069260 pfam00069, Pkinase, Protein kinase domain 7e-25
pfam14381203 pfam14381, EDR1, Ethylene-responsive protein kinas 9e-21
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 2e-20
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 9e-20
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-18
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-18
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 1e-18
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-18
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 5e-18
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 8e-18
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-17
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 2e-16
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-16
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-15
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 4e-15
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-14
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 3e-14
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-14
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 6e-14
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 7e-14
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-13
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-13
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 4e-13
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 5e-13
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 7e-13
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-12
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 3e-12
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 1e-11
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 2e-11
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 2e-11
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 2e-11
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-11
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 8e-11
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-10
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 1e-10
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 2e-10
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 2e-10
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 2e-10
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 3e-10
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 4e-10
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 5e-10
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 6e-10
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 6e-10
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 7e-10
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 8e-10
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 1e-09
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 2e-09
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 2e-09
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 2e-09
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 2e-09
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 3e-09
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 3e-09
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 3e-09
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 4e-09
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 6e-09
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 7e-09
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 7e-09
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 1e-08
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-08
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 1e-08
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 2e-08
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 2e-08
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 3e-08
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 3e-08
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 4e-08
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 4e-08
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 7e-08
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 8e-08
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 8e-08
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 1e-07
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 1e-07
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 1e-07
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 1e-07
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 1e-07
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 2e-07
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 2e-07
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 2e-07
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 2e-07
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 2e-07
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 3e-07
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 3e-07
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-07
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 3e-07
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-07
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 4e-07
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 4e-07
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 4e-07
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 5e-07
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 6e-07
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 9e-07
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 1e-06
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 1e-06
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 1e-06
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 1e-06
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 2e-06
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 2e-06
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 2e-06
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 3e-06
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 3e-06
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 3e-06
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-06
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-06
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 3e-06
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 3e-06
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 3e-06
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 3e-06
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 4e-06
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 5e-06
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 5e-06
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 5e-06
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 6e-06
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 6e-06
cd05598 376 cd05598, STKc_LATS, Catalytic domain of the Protei 9e-06
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 9e-06
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 1e-05
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 1e-05
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 1e-05
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-05
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 2e-05
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 2e-05
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 2e-05
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 2e-05
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 2e-05
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 2e-05
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 3e-05
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 3e-05
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 3e-05
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 3e-05
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 3e-05
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 4e-05
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-05
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 5e-05
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 5e-05
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 5e-05
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 6e-05
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 6e-05
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 7e-05
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 7e-05
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 8e-05
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 8e-05
cd05586 330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 8e-05
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 8e-05
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 8e-05
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 1e-04
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 1e-04
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 1e-04
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 1e-04
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 1e-04
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 1e-04
cd06650 333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 1e-04
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 1e-04
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 2e-04
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 2e-04
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 2e-04
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 2e-04
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-04
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 3e-04
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 3e-04
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 3e-04
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 3e-04
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 3e-04
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 3e-04
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 3e-04
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 4e-04
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 4e-04
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 4e-04
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 4e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
cd05625 382 cd05625, STKc_LATS1, Catalytic domain of the Prote 4e-04
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 5e-04
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 5e-04
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 5e-04
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 5e-04
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 6e-04
cd05626 381 cd05626, STKc_LATS2, Catalytic domain of the Prote 6e-04
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 7e-04
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 7e-04
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 8e-04
PTZ00036 440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 9e-04
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 9e-04
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 9e-04
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 0.001
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 0.001
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 0.001
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 0.001
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 0.001
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 0.001
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 0.001
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 0.001
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 0.002
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 0.002
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 0.002
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 0.003
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 0.003
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 0.003
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 0.003
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 0.004
pfam06293206 pfam06293, Kdo, Lipopolysaccharide kinase (Kdo/Waa 0.004
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 0.004
PLN03225 566 PLN03225, PLN03225, Serine/threonine-protein kinas 0.004
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
 Score =  115 bits (291), Expect = 4e-29
 Identities = 56/210 (26%), Positives = 83/210 (39%), Gaps = 43/210 (20%)

Query: 815  GKSVSSSLFRCKFGSAD--AAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIV 872
            G+    +++  +        A K+   +   S  +E+         E+ +L  L H  IV
Sbjct: 2    GEGGFGTVYLARDKKTGKKVAIKIIKKEDSSSLLEELLR-------EIEILKKLNHPNIV 54

Query: 873  EMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALF 932
            ++YG       L               + MEY +GGS+K+ +++     E  +S    L 
Sbjct: 55   KLYGVFEDENHL--------------YLVMEYCEGGSLKDLLKEN----EGKLSEDEILR 96

Query: 933  IAQDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTC 992
            I   +   L  LHS  I+HRD+K ENIL+D           VKL DF  +  L S     
Sbjct: 97   ILLQILEGLEYLHSNGIIHRDLKPENILLD------SDNGKVKLADFGLSKLLTSDKSLL 150

Query: 993  CIAHRGIPAPDVCVGTPRWMAPEVLRAMHK 1022
                         VGTP +MAPEVL     
Sbjct: 151  K----------TIVGTPAYMAPEVLLGKGY 170


Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and 550 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. Length = 215

>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|222722 pfam14381, EDR1, Ethylene-responsive protein kinase Le-CTR1 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|218977 pfam06293, Kdo, Lipopolysaccharide kinase (Kdo/WaaP) family Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1074
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PF14381204 EDR1: Ethylene-responsive protein kinase Le-CTR1 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0598 357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0583 370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
KOG0605 550 consensus NDR and related serine/threonine kinases 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG0694 694 consensus Serine/threonine protein kinase [Signal 100.0
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0201 467 consensus Serine/threonine protein kinase [Signal 100.0
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG0589 426 consensus Serine/threonine protein kinase [General 100.0
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 100.0
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
KOG0610 459 consensus Putative serine/threonine protein kinase 100.0
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.98
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.98
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.98
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.98
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.98
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.98
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.98
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.98
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.98
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.98
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.98
PTZ00036 440 glycogen synthase kinase; Provisional 99.98
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.98
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.98
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.98
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.98
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.98
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.98
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.97
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.97
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.97
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.97
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.97
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.97
PHA03212391 serine/threonine kinase US3; Provisional 99.97
PTZ00267 478 NIMA-related protein kinase; Provisional 99.97
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.97
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.97
PHA02988283 hypothetical protein; Provisional 99.97
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.97
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.97
PTZ00283 496 serine/threonine protein kinase; Provisional 99.97
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.97
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.97
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.97
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.97
KOG0690 516 consensus Serine/threonine protein kinase [Signal 99.97
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.97
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.97
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.97
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.97
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.97
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.97
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.97
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.97
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.97
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.97
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.97
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.97
KOG0584 632 consensus Serine/threonine protein kinase [General 99.97
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.97
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.97
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.97
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.97
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.97
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.97
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.97
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.97
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.97
KOG0586 596 consensus Serine/threonine protein kinase [General 99.97
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.97
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.97
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.97
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.97
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.97
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.97
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.97
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.97
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.97
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.97
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.97
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.97
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.97
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.97
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.97
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.97
PTZ00284 467 protein kinase; Provisional 99.97
KOG0607 463 consensus MAP kinase-interacting kinase and relate 99.97
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.97
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.97
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.97
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.97
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.97
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.97
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.97
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.97
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.97
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.97
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.96
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.96
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.96
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.96
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.96
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.96
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.96
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.96
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.96
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.96
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.96
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.96
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.96
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.96
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.96
PHA03207392 serine/threonine kinase US3; Provisional 99.96
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.96
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.96
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.96
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.96
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.96
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.96
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.96
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.96
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.96
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.96
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.96
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.96
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.96
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.96
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.96
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.96
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.96
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.96
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.96
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.96
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.96
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.96
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.96
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.96
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.96
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.96
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.96
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.96
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.96
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.96
PHA03209357 serine/threonine kinase US3; Provisional 99.96
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.96
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.96
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.96
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.96
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.96
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.96
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.96
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 99.96
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.96
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.96
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.96
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.96
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.96
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.96
PLN00009294 cyclin-dependent kinase A; Provisional 99.96
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.96
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.96
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.96
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.96
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.96
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.96
PHA03211461 serine/threonine kinase US3; Provisional 99.96
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.96
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.96
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.96
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.96
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.96
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.96
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.96
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.96
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.96
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.96
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.96
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.96
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.96
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.96
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.96
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.96
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.96
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.96
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.96
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.96
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.96
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.96
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.96
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.96
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.96
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.96
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.96
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.96
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.96
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.96
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.96
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.96
KOG0596677 consensus Dual specificity; serine/threonine and t 99.96
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.96
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.96
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.96
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.96
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.96
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.96
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.96
PHA03210 501 serine/threonine kinase US3; Provisional 99.96
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.96
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.96
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 99.96
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.96
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.96
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.96
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.96
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.96
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.96
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.96
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.96
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.96
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.96
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.96
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.96
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.96
KOG0695 593 consensus Serine/threonine protein kinase [Signal 99.96
PHA02882294 putative serine/threonine kinase; Provisional 99.95
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.95
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.95
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.95
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.95
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.95
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.95
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.95
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.95
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.95
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.95
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.95
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.95
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.95
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.95
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.95
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.95
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.95
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.95
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.95
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.95
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.95
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.95
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.95
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.95
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.95
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.95
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.95
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.95
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.95
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.95
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.95
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.95
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.95
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.95
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.95
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.95
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.95
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.95
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.95
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.95
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.95
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.95
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.95
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.95
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.95
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.95
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.95
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.95
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.95
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.95
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.95
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.95
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.95
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.95
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.95
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.95
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.95
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.95
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.95
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.95
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.95
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.95
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.95
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.95
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.95
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.95
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.95
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.95
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.95
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.95
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.94
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.94
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.94
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.94
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.94
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.94
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.94
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.94
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.94
KOG3653534 consensus Transforming growth factor beta/activin 99.94
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.94
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.94
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.94
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.94
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.94
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.94
KOG1152772 consensus Signal transduction serine/threonine kin 99.94
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.94
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.94
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.94
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.93
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.93
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.92
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.92
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.92
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.91
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.91
PLN03224507 probable serine/threonine protein kinase; Provisio 99.91
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.9
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.9
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.9
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.89
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 99.89
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.87
PRK09188 365 serine/threonine protein kinase; Provisional 99.87
KOG1167 418 consensus Serine/threonine protein kinase of the C 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
COG0515 384 SPS1 Serine/threonine protein kinase [General func 99.83
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.82
PLN00181 793 protein SPA1-RELATED; Provisional 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.79
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.79
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.78
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.77
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.76
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.74
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.74
KOG4237498 consensus Extracellular matrix protein slit, conta 99.74
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.73
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.73
PRK10345210 hypothetical protein; Provisional 99.72
PLN032101153 Resistant to P. syringae 6; Provisional 99.72
PRK12274218 serine/threonine protein kinase; Provisional 99.72
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.72
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.69
PRK14879211 serine/threonine protein kinase; Provisional 99.69
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.68
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.67
PLN032101153 Resistant to P. syringae 6; Provisional 99.67
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 99.66
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.63
smart00090237 RIO RIO-like kinase. 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.57
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.57
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.56
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.55
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.53
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.51
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.49
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.48
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.46
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.45
KOG4237498 consensus Extracellular matrix protein slit, conta 99.44
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.41
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.39
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.38
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.33
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.32
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.28
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.1
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.08
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 99.08
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.02
KOG3087229 consensus Serine/threonine protein kinase [General 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
KOG0606 1205 consensus Microtubule-associated serine/threonine 98.95
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.93
PLN03150623 hypothetical protein; Provisional 98.85
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.85
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.85
PLN03150623 hypothetical protein; Provisional 98.83
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.75
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.74
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.73
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.73
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.73
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.72
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.72
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.64
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.6
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.6
KOG1243 690 consensus Protein kinase [General function predict 98.53
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.51
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.51
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.37
KOG1266 458 consensus Protein kinase [Signal transduction mech 98.36
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.34
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.32
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.22
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.03
PRK09902216 hypothetical protein; Provisional 98.02
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 98.02
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.98
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 97.88
COG0478304 RIO-like serine/threonine protein kinase fused to 97.87
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
PRK15386426 type III secretion protein GogB; Provisional 97.83
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.9e-50  Score=519.08  Aligned_cols=282  Identities=23%  Similarity=0.268  Sum_probs=247.1

Q ss_pred             ccccCCCCC-CCCcCEEecCCCCCCCcCCCCCCCCCCCcEEEccCCCCCCcCchhhhCCCCCCcccEEEccCCCCC-CCC
Q 001456            7 VEITQKSPE-GPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIESYGNRGGDNSVEGLYLYKNVLN-LIP   84 (1074)
Q Consensus         7 ~~i~~~~f~-l~~L~~L~L~~N~i~~~~~~~~~~l~~L~~LdLs~N~lsg~ip~~l~~l~~l~~L~~L~Ls~N~L~-~IP   84 (1074)
                      +.++...|. +++|++|+|++|++++.+|.  +.+++|++|+|++|.+++.+|..++++   ++|++|+|++|.+. .+|
T Consensus       107 ~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l---~~L~~L~L~~n~l~~~~p  181 (968)
T PLN00113        107 GPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSF---SSLKVLDLGGNVLVGKIP  181 (968)
T ss_pred             CcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcC---CCCCEEECccCcccccCC
Confidence            356677774 99999999999999988875  468899999999999999999999865   89999999999987 789


Q ss_pred             ccccCCCCCcEEEccCCCCC-CCCccccCCCCCCEEEeccCCCCCCc---ccccCCCCCCeeecCCCCCCCCcccchhhh
Q 001456           85 KSVGRYEKLRNLKFFGNEIN-LFPSEVGNLLGLECLQIKISSPGVNG---FALNKLKGLKELELSKVPPRPSVLTLLSEI  160 (1074)
Q Consensus        85 ~~l~~L~~L~~L~Ls~N~l~-~iP~~l~~L~~L~~L~L~~n~n~l~g---~~~~~L~~L~~L~Ls~~~~n~~~~~ip~~l  160 (1074)
                      ..|+++++|++|+|++|.++ .+|..++++++|+.|+|  +.|.+.+   ..+.++++|+.|++++|...   +.+|..+
T Consensus       182 ~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L--~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~---~~~p~~l  256 (968)
T PLN00113        182 NSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYL--GYNNLSGEIPYEIGGLTSLNHLDLVYNNLT---GPIPSSL  256 (968)
T ss_pred             hhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEEC--cCCccCCcCChhHhcCCCCCEEECcCceec---cccChhH
Confidence            99999999999999999998 78999999999999988  4555554   34678889999999987653   4678889


Q ss_pred             cCCCCCCeEeccCCcCC-CCCccccCCCCCCEEEcCCCCCC-cCChhhcCCCCCCEEEccCCCCC-cCCccccCCCCCCE
Q 001456          161 AGLKCLTKLSVCHFSIR-YLPPEIGCLSNLEQLDLSFNKMK-YLPTEICYLKALISLKVANNKLV-ELPSGLYLLQRLEN  237 (1074)
Q Consensus       161 ~~L~~L~~L~Ls~N~l~-~LP~~i~~L~sL~~LdLS~N~Ls-~lP~~i~~L~~L~~LdLs~N~Ls-~IP~~l~~L~sL~~  237 (1074)
                      +++++|+.|++++|.+. .+|.+++++++|+.|+|++|+++ .+|..+.++++|+.|++++|.++ .+|..+..+++|+.
T Consensus       257 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~  336 (968)
T PLN00113        257 GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQV  336 (968)
T ss_pred             hCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCE
Confidence            99999999999999987 67889999999999999999998 67888999999999999999998 78888999999999


Q ss_pred             EECcCCCCCCCCcccccCCCCCCEEEccCCCCCCCCCCchhhhhcCCCCCccCCCCCcccCcc
Q 001456          238 LDLSNNRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWICCNLEGNGKDSSNDDFISSSA  300 (1074)
Q Consensus       238 LdLs~N~Lsg~~p~~l~~l~~L~~L~Ls~N~L~g~~~iP~~~~~~~~l~~l~ls~n~l~~~~~  300 (1074)
                      |+|++|.+++.+|..++.+++|+.|+|++|++++  .+|.+++....+..++++.|.+.+..+
T Consensus       337 L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~--~~p~~~~~~~~L~~L~l~~n~l~~~~p  397 (968)
T PLN00113        337 LQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTG--EIPEGLCSSGNLFKLILFSNSLEGEIP  397 (968)
T ss_pred             EECcCCCCcCcCChHHhCCCCCcEEECCCCeeEe--eCChhHhCcCCCCEEECcCCEecccCC
Confidence            9999999999999889999999999999999998  789999888888888999988876544



>PF14381 EDR1: Ethylene-responsive protein kinase Le-CTR1 Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1074
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 8e-11
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 4e-10
3v8s_A 410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 9e-10
2esm_A 415 Crystal Structure Of Rock 1 Bound To Fasudil Length 1e-09
2v55_A 406 Mechanism Of Multi-site Phosphorylation From A Rock 1e-09
4fie_A423 Full-Length Human Pak4 Length = 423 2e-09
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 2e-09
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 2e-09
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 2e-09
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 2e-09
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 3e-09
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 3e-09
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 3e-09
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 3e-09
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 9e-09
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 1e-08
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 1e-08
4aw2_A 437 Crystal Structure Of Cdc42 Binding Protein Kinase A 1e-08
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 7e-08
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 1e-07
3uc3_A 361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 2e-07
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-07
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-07
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 2e-07
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-07
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 3e-07
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 3e-07
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 3e-07
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 3e-07
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 3e-07
3tku_A 433 Mrck Beta In Complex With Fasudil Length = 433 4e-07
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 4e-07
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 4e-07
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 5e-07
3qfv_A 415 Mrck Beta In Complex With Tpca-1 Length = 415 5e-07
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 5e-07
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 5e-07
3uc4_A 362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 5e-07
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 5e-07
3ujg_A 361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 5e-07
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 5e-07
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 5e-07
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 5e-07
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 5e-07
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 6e-07
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 6e-07
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 6e-07
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 6e-07
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 6e-07
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 6e-07
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 6e-07
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 6e-07
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 6e-07
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 6e-07
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 6e-07
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 7e-07
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 7e-07
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 7e-07
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 7e-07
2i0e_A 353 Structure Of Catalytic Domain Of Human Protein Kina 7e-07
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 7e-07
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 7e-07
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 7e-07
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 7e-07
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 8e-07
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 8e-07
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 8e-07
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 8e-07
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 9e-07
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 1e-06
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 1e-06
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 1e-06
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-06
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 1e-06
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 1e-06
2vd5_A 412 Structure Of Human Myotonic Dystrophy Protein Kinas 1e-06
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 1e-06
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 1e-06
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 1e-06
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 1e-06
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-06
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-06
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 2e-06
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-06
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 2e-06
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 2e-06
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 2e-06
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 2e-06
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 2e-06
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-06
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 2e-06
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 3e-06
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 3e-06
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 3e-06
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 3e-06
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 3e-06
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 3e-06
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 3e-06
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 3e-06
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 3e-06
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 3e-06
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 3e-06
2qcs_A350 A Complex Structure Between The Catalytic And Regul 3e-06
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 4e-06
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 4e-06
4ae6_A343 Structure And Function Of The Human Sperm-specific 4e-06
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 4e-06
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 4e-06
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 4e-06
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 4e-06
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 4e-06
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 4e-06
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 4e-06
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 4e-06
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 4e-06
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 4e-06
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 4e-06
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 4e-06
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 4e-06
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 4e-06
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 4e-06
3zut_A 362 The Structure Of Ost1 (D160a) Kinase Length = 362 4e-06
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 4e-06
3lxn_A318 Structural And Thermodynamic Characterization Of Th 4e-06
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 4e-06
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 4e-06
2nry_A307 Crystal Structure Of Irak-4 Length = 307 4e-06
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 4e-06
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 4e-06
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 4e-06
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 5e-06
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 5e-06
4ae9_A343 Structure And Function Of The Human Sperm-specific 5e-06
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 5e-06
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 5e-06
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 5e-06
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 5e-06
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 5e-06
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 5e-06
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 5e-06
3zuu_A 362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 5e-06
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 5e-06
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 6e-06
4h58_A275 Braf In Complex With Compound 3 Length = 275 6e-06
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 6e-06
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 6e-06
2nru_A307 Crystal Structure Of Irak-4 Length = 307 7e-06
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 7e-06
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 7e-06
3a7f_A303 Human Mst3 Kinase Length = 303 7e-06
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 7e-06
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 7e-06
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 8e-06
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 8e-06
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 8e-06
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 8e-06
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 8e-06
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 8e-06
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 8e-06
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 8e-06
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 8e-06
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 8e-06
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 8e-06
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 9e-06
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 9e-06
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 9e-06
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 1e-05
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 1e-05
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 1e-05
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 1e-05
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 1e-05
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 1e-05
1b6c_B342 Crystal Structure Of The Cytoplasmic Domain Of The 1e-05
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 1e-05
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 1e-05
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 1e-05
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 1e-05
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 1e-05
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 1e-05
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 1e-05
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 1e-05
3c4x_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 1e-05
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 1e-05
3t8o_A 543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 1e-05
1py5_A326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 1e-05
3qc9_A 543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 1e-05
3c4w_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 1e-05
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 2e-05
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 2e-05
3tzm_A309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 2e-05
1rw8_A301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 2e-05
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 2e-05
2wot_A306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 2e-05
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-05
1vjy_A303 Crystal Structure Of A Naphthyridine Inhibitor Of H 2e-05
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-05
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 2e-05
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-05
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 2e-05
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 2e-05
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 2e-05
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 2e-05
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 2e-05
1smh_A350 Protein Kinase A Variant Complex With Completely Or 2e-05
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-05
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 2e-05
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 2e-05
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 2e-05
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 2e-05
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 2e-05
2onl_C 406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 2e-05
1kwp_A 400 Crystal Structure Of Mapkap2 Length = 400 2e-05
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 3e-05
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 3e-05
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 3e-05
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 3e-05
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 3e-05
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 3e-05
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 3e-05
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 3e-05
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 3e-05
2oza_A 356 Structure Of P38alpha Complex Length = 356 3e-05
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 3e-05
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 4e-05
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 4e-05
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 4e-05
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 4e-05
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 4e-05
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 4e-05
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 4e-05
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 4e-05
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 5e-05
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 5e-05
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 6e-05
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 6e-05
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 6e-05
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 6e-05
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 7e-05
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 7e-05
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 7e-05
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 7e-05
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 7e-05
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 7e-05
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 7e-05
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 8e-05
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 8e-05
3zgw_A 347 Crystal Structure Of Maternal Embryonic Leucine Zip 8e-05
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 8e-05
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 9e-05
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 9e-05
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 9e-05
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 9e-05
1nxk_A 400 Crystal Structure Of Staurosporine Bound To Map Kap 9e-05
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 9e-05
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 1e-04
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 1e-04
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 1e-04
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 1e-04
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 1e-04
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 1e-04
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-04
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 1e-04
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 1e-04
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 1e-04
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-04
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 1e-04
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 1e-04
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 1e-04
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 1e-04
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 1e-04
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 1e-04
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 1e-04
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 1e-04
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 1e-04
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 1e-04
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 2e-04
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 2e-04
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 2e-04
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 2e-04
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 2e-04
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 2e-04
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 2e-04
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 2e-04
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-04
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 2e-04
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 2e-04
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 3e-04
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 3e-04
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 3e-04
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 3e-04
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 3e-04
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-04
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-04
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 3e-04
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 3e-04
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 3e-04
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 3e-04
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-04
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 3e-04
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 3e-04
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 3e-04
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 3e-04
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 4e-04
4fst_A269 Crystal Structure Of The Chk1 Length = 269 4e-04
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 4e-04
2y4i_C 395 Ksr2-Mek1 Heterodimer Length = 395 4e-04
3ocb_A 341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 4e-04
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 4e-04
3cqu_A 342 Crystal Structure Of Akt-1 Complexed With Substrate 4e-04
3g51_A325 Structural Diversity Of The Active Conformation Of 5e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 5e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 5e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 5e-04
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 5e-04
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 5e-04
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 5e-04
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 5e-04
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 6e-04
3eqc_A 360 X-Ray Structure Of The Human Mitogen-Activated Prot 6e-04
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 6e-04
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 6e-04
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 6e-04
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 7e-04
2p55_A 333 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 7e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 7e-04
1s9j_A 341 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-04
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 8e-04
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 8e-04
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 8e-04
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 8e-04
3h9r_A330 Crystal Structure Of The Kinase Domain Of Type I Ac 8e-04
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 8e-04
3p23_A 432 Crystal Structure Of The Human Kinase And Rnase Dom 8e-04
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 8e-04
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 9e-04
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure

Iteration: 1

Score = 66.2 bits (160), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 47/161 (29%), Positives = 77/161 (47%), Gaps = 37/161 (22%) Query: 857 LGEVRMLGALRHSCIVEMYGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEK 916 EV ++ +H +VEMY + + L + ME+++GG++ + + + Sbjct: 90 FNEVVIMRDYQHFNVVEMYKSYLVGEEL--------------WVLMEFLQGGALTDIVSQ 135 Query: 917 LSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKL 976 + E+ +V + V AL LH++ ++HRDIKS++IL+ L DG+ VKL Sbjct: 136 VRLNEEQIATV------CEAVLQALAYLHAQGVIHRDIKSDSILLTL-----DGR--VKL 182 Query: 977 CDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVL 1017 DF C + +P VGTP WMAPEV+ Sbjct: 183 SDFG----------FCAQISKDVPKRKXLVGTPYWMAPEVI 213
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1074
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 8e-27
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-26
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 4e-26
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 4e-26
3q4u_A301 Activin receptor type-1; structural genomics conso 5e-26
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 1e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 1e-25
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-25
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-06
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 7e-25
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 7e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-18
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-24
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 2e-24
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-24
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 2e-24
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-24
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 3e-24
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 3e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 5e-24
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 6e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3soc_A322 Activin receptor type-2A; structural genomics cons 4e-22
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 4e-22
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 5e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-21
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-21
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-21
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 7e-21
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 7e-21
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 7e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 2e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 3e-20
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 3e-20
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-08
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 5e-20
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 5e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 7e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-12
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-19
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-19
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 3e-19
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 4e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 4e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-19
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 5e-19
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 6e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-19
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-14
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-12
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 4e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-18
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 5e-18
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 8e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-04
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-17
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 4e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 5e-17
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 6e-17
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 8e-17
3ork_A311 Serine/threonine protein kinase; structural genomi 8e-17
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 9e-17
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 1e-16
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-16
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 1e-16
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-16
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-16
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 2e-16
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-16
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 2e-16
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 3e-16
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-16
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 4e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 5e-16
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 6e-16
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 7e-16
3fme_A290 Dual specificity mitogen-activated protein kinase; 7e-16
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 7e-16
3aln_A327 Dual specificity mitogen-activated protein kinase; 7e-16
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 1e-15
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 1e-15
2dyl_A318 Dual specificity mitogen-activated protein kinase 1e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-15
3an0_A340 Dual specificity mitogen-activated protein kinase; 3e-15
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 3e-15
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-15
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 3e-15
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 4e-15
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 4e-15
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 5e-15
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 5e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-05
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 6e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-14
3dls_A335 PAS domain-containing serine/threonine-protein KI; 1e-14
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 1e-14
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 1e-14
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 1e-14
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-14
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 2e-14
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-14
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 2e-14
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 3e-14
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 3e-14
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 4e-14
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 5e-14
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 5e-14
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 5e-14
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 6e-14
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 7e-14
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 7e-14
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 9e-14
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 9e-14
3bhy_A283 Death-associated protein kinase 3; death associate 9e-14
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-13
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 1e-13
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-13
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-13
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 1e-13
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 1e-13
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 1e-13
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 2e-13
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-13
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 3e-13
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-13
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 3e-13
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 3e-13
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-13
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 4e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 5e-13
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 5e-13
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 6e-13
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 6e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-10
3lzb_A327 Epidermal growth factor receptor; epidermal growth 9e-13
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 2e-12
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 2e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-10
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 2e-12
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 2e-12
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 3e-12
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 3e-12
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 4e-12
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 4e-12
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 5e-12
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 5e-12
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 5e-12
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 5e-12
2eue_A275 Carbon catabolite derepressing protein kinase; kin 6e-12
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 6e-12
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 7e-12
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 7e-12
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 8e-12
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 8e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-04
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-11
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 1e-11
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 2e-11
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-11
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 2e-11
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 2e-11
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 2e-11
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-11
3poz_A327 Epidermal growth factor receptor; kinase domain, a 3e-11
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
3uqc_A286 Probable conserved transmembrane protein; structur 6e-11
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 7e-11
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 7e-11
3pls_A298 Macrophage-stimulating protein receptor; protein k 8e-11
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 9e-11
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 1e-10
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-10
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-10
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 1e-10
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-10
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 3e-10
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 4e-10
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 5e-10
4aoj_A329 High affinity nerve growth factor receptor; transf 6e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-10
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 8e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-08
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 1e-09
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-09
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 2e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2xir_A316 Vascular endothelial growth factor receptor 2; ang 3e-09
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 4e-09
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 6e-09
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 6e-09
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 9e-09
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 9e-09
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 1e-08
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-08
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-08
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 2e-08
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 2e-08
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 4e-08
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 8e-08
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 9e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-07
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 1e-06
3niz_A311 Rhodanese family protein; structural genomics, str 1e-06
3o0g_A292 Cell division protein kinase 5; kinase activator c 1e-06
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-06
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 1e-06
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 1e-06
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 3e-06
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 3e-06
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 3e-06
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 3e-06
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 4e-06
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 4e-06
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 5e-06
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 1e-05
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 3e-05
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 3e-05
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 4e-05
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 8e-05
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 9e-05
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 1e-04
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 2e-04
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 2e-04
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-04
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 3e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  136 bits (344), Expect = 3e-35
 Identities = 53/220 (24%), Positives = 86/220 (39%), Gaps = 19/220 (8%)

Query: 73  LYLYKNVLNLIPKSVGRYEKLRNLKFFGNEINLFPSEVGNLLGLECLQI---KISS-PGV 128
           L L    L   P    R   L+++      +   P  +    GLE L +    + + P  
Sbjct: 86  LELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPA- 144

Query: 129 NGFALNKLKGLKELELS------KVPPRPSVLTLLSEIAGLKCLTKLSVCHFSIRYLPPE 182
              ++  L  L+EL +       ++P   +      E  GL  L  L +    IR LP  
Sbjct: 145 ---SIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPAS 201

Query: 183 IGCLSNLEQLDLSFNKMKYLPTEICYLKALISLKVA-NNKLVELPSGLYLLQRLENLDLS 241
           I  L NL+ L +  + +  L   I +L  L  L +     L   P        L+ L L 
Sbjct: 202 IANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILK 261

Query: 242 N-NRLTSLGSLDLCLMHNLQNLNLQYNKLLSYCQVPSWIC 280
           + + L +L  LD+  +  L+ L+L+    LS  ++PS I 
Sbjct: 262 DCSNLLTL-PLDIHRLTQLEKLDLRGCVNLS--RLPSLIA 298


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1074
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-24
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 3e-22
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-22
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-21
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-21
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-21
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-20
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-20
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-20
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-20
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 6e-20
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-19
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-19
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 4e-19
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 6e-19
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-18
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-18
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-18
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 7e-18
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 8e-18
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-17
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-17
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-17
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-17
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 9e-17
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-16
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-16
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-16
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 3e-16
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 5e-16
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 5e-16
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 6e-16
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 6e-16
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 9e-16
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-15
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 4e-15
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 7e-15
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 7e-15
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-14
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-14
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-14
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-14
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-14
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-14
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-14
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 6e-14
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 7e-14
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 9e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-13
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 7e-13
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-12
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-12
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-12
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 8e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-10
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-11
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 5e-11
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-11
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-10
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-10
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-08
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-06
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  101 bits (254), Expect = 2e-24
 Identities = 47/208 (22%), Positives = 83/208 (39%), Gaps = 41/208 (19%)

Query: 815  GKSVSSSLFRCKFGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEM 874
            G     ++++ K+   D A K+  L V   +  +++ F      EV +L   RH  I+  
Sbjct: 17   GSGSFGTVYKGKWHG-DVAVKM--LNVTAPTPQQLQAF----KNEVGVLRKTRHVNILLF 69

Query: 875  YGHKISSKWLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIA 934
             G+  + +                 I  ++ +G S+ +++  +    E    +   + IA
Sbjct: 70   MGYSTAPQLA---------------IVTQWCEGSSLYHHLHII----ETKFEMIKLIDIA 110

Query: 935  QDVAAALVELHSKHIMHRDIKSENILIDLERKKADGKPVVKLCDFDRAVPLRSFLHTCCI 994
            +  A  +  LH+K I+HRD+KS NI +            VK+ DF  A     +  +   
Sbjct: 111  RQTAQGMDYLHAKSIIHRDLKSNNIFL-------HEDLTVKIGDFGLATVKSRWSGSHQF 163

Query: 995  AHRGIPAPDVCVGTPRWMAPEVLRAMHK 1022
                        G+  WMAPEV+R   K
Sbjct: 164  EQ--------LSGSILWMAPEVIRMQDK 183


>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1074
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.83
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.2
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.93
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.68
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.99
d1nw1a_ 395 Choline kinase {Caenorhabditis elegans [TaxId: 623 96.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.23
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 95.96
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 94.83
d2f4ma1287 Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) 92.04
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Pkb kinase (Akt-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=0  Score=343.24  Aligned_cols=221  Identities=22%  Similarity=0.233  Sum_probs=180.4

Q ss_pred             CCCCCCEEEEEEEEECCEEEEEEEECCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCC
Q ss_conf             88999438706631096499999999920899999704689996898765562999999997159998004764797589
Q 001456          803 GSFPSLSSCDEAGKSVSSSLFRCKFGSADAAAKVRTLKVCGSSADEIRNFEYSCLGEVRMLGALRHSCIVEMYGHKISSK  882 (1074)
Q Consensus       803 ~~~~~y~i~~~LG~G~fG~Vyka~~~~~~vaVKvk~l~~~~~~~~~~~~~~~~~lrEi~iL~~L~HpNIV~l~g~~~~~~  882 (1074)
                      +.+++|++.+.||+|+||.||+|++..++..|++|.++...   ...+.....+.+|+.+|++++|||||++++++....
T Consensus         2 i~l~dy~~~~~lG~G~fg~V~~~~~~~~~~~~AiK~i~k~~---~~~~~~~~~~~~E~~il~~l~hp~Iv~l~~~~~~~~   78 (337)
T d1o6la_           2 VTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEV---IIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHD   78 (337)
T ss_dssp             CCGGGEEEEEEEEECSSEEEEEEEETTTCCEEEEEEEEHHH---HHHTTCHHHHHHHHHHHHSCCCTTBCCEEEEEECSS
T ss_pred             CCHHHCEEEEEEECCCCEEEEEEEECCCCCEEEEEEECHHH---CCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCC
T ss_conf             84474289889831768499999998999899999981565---449799999999999998679998877876403564


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEE
Q ss_conf             87899999854564119999135999999999997304998789999999999999999999959922148999986780
Q 001456          883 WLPSADGNPEHHLLQSAIFMEYVKGGSVKNYIEKLSETGEKHVSVKLALFIAQDVAAALVELHSKHIMHRDIKSENILID  962 (1074)
Q Consensus       883 ~l~~~~~~~~~~~~~~~IVmEy~~gGSL~~~L~~~~~~~~~~l~~~~~~~i~~qIa~GL~yLHs~gIIHRDLKp~NILId  962 (1074)
                      .+              |+||||++||+|.+++.+     ...+++..++.++.|++.||.|||+++||||||||+|||++
T Consensus        79 ~~--------------~iv~ey~~gg~L~~~~~~-----~~~~~e~~~~~~~~qil~al~ylH~~~iiHRDlKP~NILl~  139 (337)
T d1o6la_          79 RL--------------CFVMEYANGGELFFHLSR-----ERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLD  139 (337)
T ss_dssp             EE--------------EEEEECCTTCBHHHHHHH-----HSCCCHHHHHHHHHHHHHHHHHHHHTTCBCCCCCGGGEEEC
T ss_pred             CC--------------CCCEECCCCCCHHHHHHC-----CCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHEEEC
T ss_conf             21--------------110003579860555532-----56775999999999996521134315962246477784765


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             58877899993999202344103565653233467889997544797424055440255777788533420111439999
Q 001456          963 LERKKADGKPVVKLCDFDRAVPLRSFLHTCCIAHRGIPAPDVCVGTPRWMAPEVLRAMHKPNLYGLVSSSLFCQFKVESK 1042 (1074)
Q Consensus       963 ~~~~~~~~~~~VKL~DFGla~~~~~~~~~~~~~~~~~~~~~~~vGT~~YmAPEvL~~~~~~~~y~~ksDIWS~G~SLG~i 1042 (1074)
                      .++.       +||+|||+|+........          ....+||+.|||||++.+    ..|+.++|||    |+||+
T Consensus       140 ~~g~-------vkl~DFG~a~~~~~~~~~----------~~~~~GT~~Y~aPE~~~~----~~y~~~~Diw----SlGvi  194 (337)
T d1o6la_         140 KDGH-------IKITDFGLCKEGISDGAT----------MKTFCGTPEYLAPEVLED----NDYGRAVDWW----GLGVV  194 (337)
T ss_dssp             TTSC-------EEECCCTTCBCSCCTTCC----------BCCCEECGGGCCGGGGSS----SCBCTTHHHH----HHHHH
T ss_pred             CCCC-------EEEEECCCCCCCCCCCCC----------CCCCEECHHHHHHHHCCC----CCCCHHHCCC----CHHHH
T ss_conf             8998-------888205652003567862----------055100889966665048----9888333102----23067


Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             9999819999887579999999961999
Q 001456         1043 LIICLVIFPQFRYLKLFYHFFFLLKGAP 1070 (1074)
Q Consensus      1043 L~el~tG~~Pf~~~~~~~~i~~il~g~P 1070 (1074)
                      +|+|++|++||...+...++..+.++.+
T Consensus       195 lyeml~G~~pf~~~~~~~~~~~i~~~~~  222 (337)
T d1o6la_         195 MYEMMCGRLPFYNQDHERLFELILMEEI  222 (337)
T ss_dssp             HHHHHHSSCSSCCSSHHHHHHHHHHCCC
T ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHCCCC
T ss_conf             8899878999999699999999852899



>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f4ma1 d.3.1.4 (A:164-450) Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure