Citrus Sinensis ID: 001468

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070---

MAEHQNSTVKPAAGKPSGNAAANTYAINLDNFSKRLKMLYSHWTEHNSDLWGDSNALAVATPPVSEDLRYLKSSALNVWLVGYEFPETIMVFLKKQIHFLCSQKKASLLEVIKKSAKEAVGIEVVIHVKGKTDDGSGLMDKIFGAVNDQSKSGGQNSPVVGHISREAPEGKLLETWNEKLKKANFALSDVSNGFSDLFAIKDDTELTNIKKAAFLSSSVMKQFVVPKLEKVIDEEKKVSHSSLMDETEKAILEPARIKVKLKAENVDICYPPIFQSGGEFDLKPSASSNDNYLYYDSTSVIICAVGSRYNSYCSNVARTFLIDANTVQSKAYEVLLKAHEAAISALKSGNKVSAAYKAASTVVEKDAPELAANLTRNAGTGIGLEFRESGLSLNAKNDRILKAGMVFNVSLGFQNLQTENKNPKTQKFSVLLADTVIVGEKVPDIVTSKSSKAVKDVAYSFNEDDEEEEQPKVKAEVKGGEPTLSKATLRSDHQEMSKEELRRQHQAELARQKNEETARRLAGGGSSTADNRGSVKTIGDLVAYKNVNDLPPPRDLMIQVDQKNEAILLPIYGSMVPFHVATVKSVSSQQDTNRSCYIRIIFNVPGTSFTPHDSNSLKFQGSIYLKEVSLRSKDSRHISEVVQQIKTLRRQVTSRESERAERATLVTQEKLQLASAKFKPLKLFDLWIRPPFGGRGRKLTGSLEAHTNGFRYSTSRPDERVDVMYGNIKHAFFQPAEREMITLLHFHLHNHIMVGNKKTKDVQFYIEVMDVVQTLGGGKRSAYDPDEVEEEQRERARKNKINMDFQNFVNRVNDLWGQPQFKAFDLEFDQPLRELGFHGVPHKASAFIVPTSSCLVELIETPFVVITLSEIEIVNLERVGLGQKNFDMTIVFKDFKRDVLRIDSIPSSSLDGIKEWLDTTDLKYYESRLNLNWRPILKTITDDPEKFIEDGGWEFLNMEASDSESENSQDSDQGYEPSDVQSDSVSDDENDDSESLVESEDDEEEDSEEDSEEDKGKTWEELEREASYADREKGADSDSEDERKRRKMKAFGKARAPEKRNPGGSLPKRAKLR

ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccccccccccccHHHcccccccEEEEEEccEEEEEcccHHHHHHHHHHHHHcccccEEEEEEEcccccccccHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHcccEEEEcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHcccccccccccccEEECcccccccccccccccccccccccEEEEEccEEEcccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHccccccCEEEccccccccccccccccccccccEEEEEEccccccccccccccccEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccEEEcccccccccccccEEEEEccccEEEEEEccccccEEEEEEEcccccccccccEEEEEEEEccccccccccccccccccccEEEEEEEECccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcccccccccccccEEEcccccccccccccEEEEECcccccccccccccEEEEEccccccccccccccEEEEEEEEEcccEEEccccccccccEEEEcccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccccccccEEEEECcccccEEECccccEEEEEccEEEEEEEEcccccccCEEEEEEccccccCEEEEccccccHHHHHHHHccccEEEEEccccccHHHHHHHHHcccccccccccCEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccc

***********************TYAINLDNFSKRLKMLYSHWTEHNSDLWGDSNALAVATPPVSEDLRYLKSSALNVWLVGYEFPETIMVFLKKQIHFLCSQKKASLLEVIKKSAKEAVGIEVVIHVKGKTDDGSGLMDKIFGAVNDQSKSGGQNSPVVGHISREAPEGKLLETWNEKLKKANFALSDVSNGFSDLFAIKDDTELTNIKKAAFLSSSVMKQFVVPKLEKVIDEEKKVSHSSLMDETEKAILEPARIKVKLKAENVDICYPPIFQSGGEFDLKPSASSNDNYLYYDSTSVIICAVGSRYNSYCSNVARTFLIDANTVQSKAYEVLLKAHEAAISALKSGNKVSAAYKAASTVVEKDAPELAANLTRNAGTGIGLEFRESGLSLNAKNDRILKAGMVFNVSLGFQNLQTENKNPKTQKFSVLLADTVIVGEKVPDIVTSKSSKAVKDVAY*****************************************************************************TIGDLVAYKNVNDLPPPRDLMIQVDQKNEAILLPIYGSMVPFHVATVKSVSSQQDTNRSCYIRIIFNVPGTSFTPHDSNSLKFQGSIYLKEVSLRSKDSRHISEVVQQIKT**********************KLQLASAKFKPLKLFDLWIRPPFGGRGRKLTGSLEAHTNGFRYSTSRPDERVDVMYGNIKHAFFQPAEREMITLLHFHLHNHIMVGNKKTKDVQFYIEVMDVVQTL*************************INMDFQNFVNRVNDLWGQPQFKAFDLEFDQPLRELGFHGVPHKASAFIVPTSSCLVELIETPFVVITLSEIEIVNLERVGLGQKNFDMTIVFKDFKRDVLRIDSIPSSSLDGIKEWLDTTDLKYYESRLNLNWRPILKTITDDPEKFIEDGGWEFL*********************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAEHQNSTVKPAAGKPSGNAAANTYAINLDNFSKRLKMLYSHWTEHNSDLWGDSNALAVATPPVSEDLRYLKSSALNVWLVGYEFPETIMVFLKKQIHFLCSQKKASLLEVIKKSAKEAVGIEVVIHVKGKTDDGSGLMDKIFGAVNDQSKSGGQNSPVVGHISREAPEGKLLETWNEKLKKANFALSDVSNGFSDLFAIKDDTELTNIKKAAFLSSSVMKQFVVPKLEKVIDEEKKVSHSSLMDETEKAILEPARIKVKLKAENVDICYPPIFQSGGEFDLKPSASSNDNYLYYDSTSVIICAVGSRYNSYCSNVARTFLIDANTVQSKAYEVLLKAHEAAISALKSGNKVSAAYKAASTVVEKDAPELAANLTRNAGTGIGLEFRESGLSLNAKNDRILKAGMVFNVSLGFQNLQTENKNPKTQKFSVLLADTVIVGEKVPDIVTSKSSKAVKDVAYSFNEDDEEEEQPKVKAEVKGGEPTLSKATLRSDHQxxxxxxxxxxxxxxxxxxxxxETARRLAGGGSSTADNRGSVKTIGDLVAYKNVNDLPPPRDLMIQVDQKNEAILLPIYGSMVPFHVATVKSVSSQQDTNRSCYIRIIFNVPGTSFTPHDSNSLKFQGSIYLKEVSLRSKDSRHISEVVQQIKTLRRQVTSRESERAERATLVTQEKLQLASAKFKPLKLFDLWIRPPFGGRGRKLTGSLEAHTNGFRYSTSRPDERVDVMYGNIKHAFFQPAEREMITLLHFHLHNHIMVGNKKTKDVQFYIEVMDVVQTLGGGKRSAYDPDEVEEEQRERARKNKINMDFQNFVNRVNDLWGQPQFKAFDLEFDQPLRELGFHGVPHKASAFIVPTSSCLVELIETPFVVITLSEIEIVNLERVGLGQKNFDMTIVFKDFKRDVLRIDSIPSSSLDGIKEWLDTTDLKYYESRLNLNWRPILKTITDDPEKFIEDGGWEFLNMEASDSESENSQDSDQGYEPSDVQSDSVSDDENDDSESLVESEDDEEEDSEEDSEEDKGKTWEELEREASYADREKGADSDSEDERKRRKMKAFGKARAPEKRNPGGSLPKRAKLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
FACT complex subunit SPT16	Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. SSRP1 binds specifically to double-stranded DNA.	confident	Q7X923
FACT complex subunit SPT16	Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II.	confident	O82491
FACT complex subunit SPT16	Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. SSRP1 binds specifically to double-stranded DNA.	probable	Q8H6B1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CB6, chain A
Confidence level:very confident
Coverage over the Query: 25-461
View the alignment between query and template
View the model in PyMOL

Template: 3BIQ, chain A
Confidence level:confident
Coverage over the Query: 26-461
View the alignment between query and template
View the model in PyMOL

Template: 4IOY, chain X
Confidence level:confident
Coverage over the Query: 682-778,794-815,826-944
View the alignment between query and template
View the model in PyMOL