Citrus Sinensis ID: 001482
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1070 | 2.2.26 [Sep-21-2011] | |||||||
| Q61107 | 620 | Guanylate-binding protein | no | no | 0.327 | 0.564 | 0.330 | 2e-52 | |
| P32456 | 591 | Interferon-induced guanyl | yes | no | 0.298 | 0.539 | 0.333 | 3e-52 | |
| Q9H0R5 | 595 | Guanylate-binding protein | no | no | 0.397 | 0.714 | 0.307 | 4e-52 | |
| Q8N8V2 | 638 | Guanylate-binding protein | no | no | 0.316 | 0.531 | 0.326 | 3e-51 | |
| Q5R9T9 | 633 | Guanylate-binding protein | no | no | 0.331 | 0.560 | 0.318 | 4e-51 | |
| Q6ZN66 | 633 | Guanylate-binding protein | no | no | 0.330 | 0.559 | 0.323 | 9e-51 | |
| Q5D1D6 | 590 | Interferon-induced guanyl | N/A | no | 0.300 | 0.545 | 0.327 | 1e-50 | |
| P32455 | 592 | Interferon-induced guanyl | no | no | 0.506 | 0.915 | 0.285 | 2e-50 | |
| Q01514 | 589 | Interferon-induced guanyl | no | no | 0.314 | 0.570 | 0.332 | 2e-50 | |
| Q5RBE1 | 592 | Interferon-induced guanyl | no | no | 0.506 | 0.915 | 0.285 | 4e-50 |
| >sp|Q61107|GBP4_MOUSE Guanylate-binding protein 4 OS=Mus musculus GN=Gbp4 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 208 bits (530), Expect = 2e-52, Method: Compositional matrix adjust.
Identities = 120/363 (33%), Positives = 203/363 (55%), Gaps = 13/363 (3%)
Query: 42 PIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVA 101
PI LV + K + ++ EA+ L+ + +P+ VV++ G R GKS+++N+L GR+ GF +
Sbjct: 4 PICLVE-NWKNQLTVNLEAIRILEQIAQPLVVVAIVGLYRTGKSYLMNRLAGRNHGFSLG 62
Query: 102 STHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGI-DAYDQTGTYSTQIFSLAVLLSS 160
ST + TKG+W+W P + L+LLD+EG+ D + IF+LAVLLSS
Sbjct: 63 STVQSETKGIWMWCVPHPTKP----THTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLSS 118
Query: 161 MFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTT---PSELGQFSPIFVWLLRDFY 217
F+YN M I++ A+++L VT++T+ IR ++S + SE F P F+W +RDF
Sbjct: 119 TFVYNSMSTINQQALEQLHFVTELTQLIRAKSSPREDKVKDSSEFVGFFPDFIWAVRDFA 178
Query: 218 LDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNEN 277
L+L + R IT +YLE AL+ +QG + N R+ IR FP R+CF RP S++
Sbjct: 179 LELKLNGRPITEDEYLENALKLIQGDNLKVQQSNMTRECIRYFFPVRKCFVFDRPTSDKR 238
Query: 278 ELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV-GATVLTGPVLIGITESYLDAIN 336
L +++ + ++L F+ + ++F + K + G ++TG L + ++Y++AIN
Sbjct: 239 LLLQIENVPENQLERNFQVESEKFCSYIFTNGKTKTLRGGVIVTGNRLGTLVQTYVNAIN 298
Query: 337 NGAVPTISSSWQSVEEAECRRAYDSATETYMSTF-DRSKPPEEVA--LGEAHEAAVQKAL 393
+G VP + ++ ++ + E A A + Y R + P + L H A ++A+
Sbjct: 299 SGTVPCLENAVTTLAQRENSIAVQKAADHYSEQMAQRMRLPTDTLQELLTVHAACEKEAI 358
Query: 394 AVY 396
AV+
Sbjct: 359 AVF 361
|
Binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. Plays a role in erythroid differentiation. Mus musculus (taxid: 10090) |
| >sp|P32456|GBP2_HUMAN Interferon-induced guanylate-binding protein 2 OS=Homo sapiens GN=GBP2 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9H0R5|GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens GN=GBP3 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q8N8V2|GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens GN=GBP7 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q5R9T9|GBP6_PONAB Guanylate-binding protein 6 OS=Pongo abelii GN=GBP6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZN66|GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens GN=GBP6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5D1D6|GBP1_CHLAE Interferon-induced guanylate-binding protein 1 OS=Chlorocebus aethiops GN=GBP1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P32455|GBP1_HUMAN Interferon-induced guanylate-binding protein 1 OS=Homo sapiens GN=GBP1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q01514|GBP1_MOUSE Interferon-induced guanylate-binding protein 1 OS=Mus musculus GN=Gbp1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5RBE1|GBP1_PONAB Interferon-induced guanylate-binding protein 1 OS=Pongo abelii GN=GBP1 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1070 | ||||||
| 224077052 | 1070 | predicted protein [Populus trichocarpa] | 0.965 | 0.965 | 0.773 | 0.0 | |
| 255536707 | 1065 | interferon-induced guanylate-binding pro | 0.995 | 1.0 | 0.751 | 0.0 | |
| 449433796 | 1062 | PREDICTED: uncharacterized protein LOC10 | 0.990 | 0.998 | 0.747 | 0.0 | |
| 356548658 | 1060 | PREDICTED: uncharacterized protein LOC10 | 0.989 | 0.999 | 0.710 | 0.0 | |
| 356521418 | 1060 | PREDICTED: uncharacterized protein LOC10 | 0.989 | 0.999 | 0.708 | 0.0 | |
| 356546617 | 1059 | PREDICTED: uncharacterized protein LOC10 | 0.987 | 0.998 | 0.700 | 0.0 | |
| 145358912 | 1082 | Guanylate-binding protein [Arabidopsis t | 0.985 | 0.974 | 0.678 | 0.0 | |
| 9757727 | 1060 | unnamed protein product [Arabidopsis tha | 0.964 | 0.973 | 0.658 | 0.0 | |
| 222632561 | 1062 | hypothetical protein OsJ_19548 [Oryza sa | 0.952 | 0.959 | 0.636 | 0.0 | |
| 357128517 | 1066 | PREDICTED: uncharacterized protein LOC10 | 0.985 | 0.988 | 0.609 | 0.0 |
| >gi|224077052|ref|XP_002305110.1| predicted protein [Populus trichocarpa] gi|222848074|gb|EEE85621.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1658 bits (4294), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 801/1036 (77%), Positives = 920/1036 (88%), Gaps = 3/1036 (0%)
Query: 36 VTGPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRS 95
VTGPARPIRLVY DEKGKFRMD EAVAALQLVKEPIGVVSVCGR+RQGKSFILNQLLGRS
Sbjct: 37 VTGPARPIRLVYYDEKGKFRMDSEAVAALQLVKEPIGVVSVCGRSRQGKSFILNQLLGRS 96
Query: 96 SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLA 155
SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDA+DQTGTYSTQIFSLA
Sbjct: 97 SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAFDQTGTYSTQIFSLA 156
Query: 156 VLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRD 215
VLLSSMFIYNQMGGIDE+A+DRLSLVTQMTKHIR+RASGG+++ SELGQFSPIFVWLLRD
Sbjct: 157 VLLSSMFIYNQMGGIDEAALDRLSLVTQMTKHIRVRASGGRSSASELGQFSPIFVWLLRD 216
Query: 216 FYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSN 275
FYLDLVEDN++ITPRDYLE+ALRPVQGSG+DIAAKNEIRDSIRALFPDRECF LVRPL+N
Sbjct: 217 FYLDLVEDNKRITPRDYLELALRPVQGSGKDIAAKNEIRDSIRALFPDRECFPLVRPLNN 276
Query: 276 ENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAI 335
EN+LQR+DQISLD+LRPEFRAGLDALTKFVFERTRPKQVGATV+TGP+L+GITESYL+A+
Sbjct: 277 ENDLQRMDQISLDKLRPEFRAGLDALTKFVFERTRPKQVGATVMTGPILVGITESYLEAL 336
Query: 336 NNGAVPTISSSWQSVEEAECRRAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAV 395
NNGAVPTISSSWQSVEEAECRRAYD+ATE YMS+FDRSKPPEEV L E+H+ AVQK+LA
Sbjct: 337 NNGAVPTISSSWQSVEEAECRRAYDTATEIYMSSFDRSKPPEEVFLRESHDEAVQKSLAA 396
Query: 396 YNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAACHSS 455
+NA AVG+G ARKKYEGLLQKFFR+A ED+K+N +MEAD+RCS+AIQ+ME++LRAACH+S
Sbjct: 397 FNAAAVGIGSARKKYEGLLQKFFRRALEDYKRNAFMEADLRCSNAIQNMEKRLRAACHAS 456
Query: 456 DASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSERSS 515
DA+IDN+VKVLDGL+SEYETSCHGPGKWQKLA FLQQS EG ILDL KRL D+IGSE+SS
Sbjct: 457 DANIDNIVKVLDGLLSEYETSCHGPGKWQKLAMFLQQSLEGSILDLAKRLNDKIGSEKSS 516
Query: 516 LMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDYTSRINNLQGENIS 575
LML+ S+ED M LL KQLE SE+ KSEY+KRYD+AIN+KKKLADDY RIN+LQ S
Sbjct: 517 LMLRCHSMEDKMALLHKQLEASEKDKSEYMKRYDEAINEKKKLADDYMRRINDLQSNRGS 576
Query: 576 LREKSSSLSKTVDSLKNEISDWKRKYDQVLTKQKAMEDQVCSEIEVLKSRSTAAEARLAA 635
L E+ SSL K ++S K E S+WKRK+DQVL+KQKA E+Q SEI +LKSRS+A+EARLAA
Sbjct: 577 LDERCSSLVKALESAKQETSNWKRKHDQVLSKQKADEEQAASEIAILKSRSSASEARLAA 636
Query: 636 AREQALSAQEEVEEWKRKYGVAVREAKAALEKAAIVQERTSKEMQQREDVLREEFSSTLA 695
A EQ SA+E+ EWKRKY +AVRE KAALEKAA VQERT+KE Q RED LREEFSS L
Sbjct: 637 AHEQTRSAEEDAAEWKRKYDIAVRETKAALEKAANVQERTNKETQLREDALREEFSSHLV 696
Query: 696 EKEEEMKEKATKIEHAEQCLTTLRLELKAAESKMRSYEVEISSQKLETKELSEKLEAVNA 755
KE+E+KEK +IE+AEQCLT L LELKAAESKM+SY EISS KLE KEL EKLE N
Sbjct: 697 VKEDEIKEKNRRIEYAEQCLTALNLELKAAESKMKSYGTEISSLKLEIKELVEKLETANT 756
Query: 756 KAQSFEREARIMEQDKVYLEQKYKSEFERFEEVQERCKVAEKEAKKATELADRERAEAAA 815
KAQS+++EARI+EQ+K++LEQ+Y+SEFERF EVQERC AEKE K+ATELAD+ RA+A +
Sbjct: 757 KAQSYDKEARILEQEKIHLEQRYQSEFERFAEVQERCNHAEKECKRATELADKARADAVS 816
Query: 816 ARKGKSEFENLAMERMAVIERVQRQIESLERQKTDLTNEVNRIRESELEALSKVALLEAR 875
A+K K+EF+ LAMER+A IER QR IESL+RQK +L E+ R+R SEL+A+SKV+LLEAR
Sbjct: 817 AQKEKNEFQKLAMERLAQIERAQRHIESLDRQKNNLAGELERVRVSELDAVSKVSLLEAR 876
Query: 876 VEEREKEIESLLESNNEQRASTVKKLEDLLESERRSRAAANAMAERLSLEVQSAQAKLDE 935
VEEREKEIESLL+SNNE+RASTVK L+DLLE ER++ + AN AE SL+++ A+AKLD
Sbjct: 877 VEEREKEIESLLKSNNEERASTVKALQDLLEDERKAHSVANKRAEDFSLQLEVARAKLDA 936
Query: 936 MQQELTKARLNETALGSKLRAVSHGKRARADDYEAGVGSVQEMDTNDKVLRANKRSRSTT 995
+QQE T RLNE+AL +KL+A SHGKR R D+ E G GSVQ+ TND+ R NKRSRSTT
Sbjct: 937 LQQEFTSVRLNESALDNKLKAASHGKRFRTDNVEMGGGSVQDAVTNDR--RVNKRSRSTT 994
Query: 996 SPLKYTQPEDGGSVFRG-DDDNLSQQSNQEDYTKFTVQKLKQELTKHNFGAELLQLRNPN 1054
SP+ +TQPEDGGSVF+G DDDN SQQ+ QEDY KFT QKL+QELTKHNFGAELLQLRN N
Sbjct: 995 SPVMFTQPEDGGSVFKGDDDDNQSQQTGQEDYKKFTAQKLRQELTKHNFGAELLQLRNNN 1054
Query: 1055 KKEILALYEKCILQKS 1070
KK++LALYEKC+L+KS
Sbjct: 1055 KKDVLALYEKCVLRKS 1070
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255536707|ref|XP_002509420.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] gi|223549319|gb|EEF50807.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449433796|ref|XP_004134683.1| PREDICTED: uncharacterized protein LOC101220489 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356548658|ref|XP_003542717.1| PREDICTED: uncharacterized protein LOC100808644 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356521418|ref|XP_003529353.1| PREDICTED: uncharacterized protein LOC100796442 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356546617|ref|XP_003541721.1| PREDICTED: uncharacterized protein LOC100776402 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|145358912|ref|NP_199419.2| Guanylate-binding protein [Arabidopsis thaliana] gi|332007951|gb|AED95334.1| Guanylate-binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9757727|dbj|BAB08252.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|222632561|gb|EEE64693.1| hypothetical protein OsJ_19548 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|357128517|ref|XP_003565919.1| PREDICTED: uncharacterized protein LOC100834701 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1070 | ||||||
| TAIR|locus:2161358 | 1082 | AT5G46070 [Arabidopsis thalian | 0.991 | 0.980 | 0.604 | 0.0 | |
| RGD|1561523 | 558 | Mpa2l "macrophage activation 2 | 0.332 | 0.637 | 0.351 | 3.8e-59 | |
| UNIPROTKB|F1N9J3 | 623 | GBP7 "Uncharacterized protein" | 0.471 | 0.808 | 0.297 | 1.2e-57 | |
| ZFIN|ZDB-GENE-070705-98 | 645 | si:ch211-209n20.1 "si:ch211-20 | 0.514 | 0.854 | 0.291 | 1.5e-57 | |
| MGI|MGI:1926263 | 620 | Gbp3 "guanylate binding protei | 0.515 | 0.890 | 0.279 | 2.9e-54 | |
| UNIPROTKB|Q9H0R5 | 595 | GBP3 "Guanylate-binding protei | 0.501 | 0.902 | 0.283 | 1.4e-53 | |
| RGD|1311040 | 586 | Gbp5 "guanylate binding protei | 0.393 | 0.718 | 0.303 | 9.9e-53 | |
| ZFIN|ZDB-GENE-070912-618 | 630 | gbp2 "guanylate binding protei | 0.527 | 0.895 | 0.270 | 1.3e-52 | |
| UNIPROTKB|F1N1I1 | 629 | LOC781225 "Uncharacterized pro | 0.512 | 0.871 | 0.287 | 2.1e-52 | |
| ZFIN|ZDB-GENE-041210-233 | 618 | si:dkey-61p9.3 "si:dkey-61p9.3 | 0.360 | 0.624 | 0.340 | 4.6e-52 |
| TAIR|locus:2161358 AT5G46070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3229 (1141.7 bits), Expect = 0., P = 0.
Identities = 647/1071 (60%), Positives = 776/1071 (72%)
Query: 2 MMKFFGKGKDSSPYXXXXXXXXXXXXXXXXXXXXVTGPARPIRLVYCDEKGKFRMDPEAV 61
M FFG+G SP VTGP RPIRLVYCDEKGKFRMDPEAV
Sbjct: 1 MRSFFGRGGKDSPADSASPSPRSYPSTSPASSSAVTGPPRPIRLVYCDEKGKFRMDPEAV 60
Query: 62 AALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRT 121
A LQLVKEPIGVVSVCGRARQGKSFILNQLLGRS+GFQVASTH+PCTKGLWLWS+P+KRT
Sbjct: 61 ATLQLVKEPIGVVSVCGRARQGKSFILNQLLGRSNGFQVASTHKPCTKGLWLWSSPIKRT 120
Query: 122 ALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLV 181
ALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMF+YNQMGGIDE+++DRLSLV
Sbjct: 121 ALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFVYNQMGGIDEASLDRLSLV 180
Query: 182 TQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQ 241
TQMTKHIR++ASGG ++ SELGQFSPIFVWLLRDFYLDLVEDNRKI+PRDYLEIALRPVQ
Sbjct: 181 TQMTKHIRVKASGGTSSRSELGQFSPIFVWLLRDFYLDLVEDNRKISPRDYLEIALRPVQ 240
Query: 242 GSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDAL 301
GSG DI AKNEIRDSIRALFPDRECFTLVRPL+NE +LQRLDQISL++LRPEF AGLDA
Sbjct: 241 GSGGDIGAKNEIRDSIRALFPDRECFTLVRPLNNEKDLQRLDQISLEKLRPEFGAGLDAF 300
Query: 302 TKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTISSSWQSVEEAECRRAYDS 361
TKFVFE+TRPKQ+G TV+TGP+L+GIT+SYLDA+NNGAVPTI+SSWQSVEE ECRRAYDS
Sbjct: 301 TKFVFEKTRPKQLGGTVMTGPILVGITQSYLDALNNGAVPTITSSWQSVEETECRRAYDS 360
Query: 362 ATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKA 421
E YM+ FD+SK PEE AL E HE AV+KALA++N+ AVG G ARKK+E LL K +K
Sbjct: 361 GVEAYMAAFDQSKAPEEGALREEHEEAVRKALAIFNSNAVGNGSARKKFEDLLHKDLKKK 420
Query: 422 FEDHKKNVYMEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPG 481
FED+KKN +MEAD+RC+S IQ ME++LRAACH+S+A++DNVVKVL+ ++EYE SCHGPG
Sbjct: 421 FEDYKKNAFMEADLRCTSTIQRMEKQLRAACHASNANMDNVVKVLEARLAEYEASCHGPG 480
Query: 482 KWQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYK 541
KWQKL+ FLQQS EGPI DL KRLID I E++SL +K+RS+ED MK LK+QL+DSERYK
Sbjct: 481 KWQKLSVFLQQSLEGPIYDLTKRLIDSIAIEKNSLAMKFRSVEDAMKHLKQQLDDSERYK 540
Query: 542 SEYLKRYDDAINDKKKLADDYTSRINNLQGENISLREKSSSLSKTVDSLKNEISDWKRKY 601
EY KRYD++ NDKKKL D Y RI LQGEN SL E+ S+L KTV+S K EI +W R Y
Sbjct: 541 LEYQKRYDESNNDKKKLEDIYRERITKLQGENSSLNERCSTLVKTVESKKEEIKEWIRNY 600
Query: 602 DQVLTKQKAMEDQVCSEIEVLKSRSTXXXXXXXXXXXXXXXXXXXVEEWKRKYGVAVREA 661
DQ++ KQKA+++Q+ SE+EVL++RST +EWKRKY AV EA
Sbjct: 601 DQIVLKQKAVQEQLSSEMEVLRTRSTTSEARVAAAREQAKSAAEETKEWKRKYDYAVGEA 660
Query: 662 KAALEKAAIVQERTSKEMQQREDVLREEFSSTLAXXXXXXXXXXXXXXHAEQCLTTLRLE 721
++AL+KAA VQER+ KE Q RED LREEFS TLA AEQ LT LR +
Sbjct: 661 RSALQKAASVQERSGKETQLREDALREEFSITLANKDEEITEKATKLEKAEQSLTVLRSD 720
Query: 722 LKAAESKMRSYEVEIXXXXXXXXXXXXXXXAVNAKAQSFEREARIMEQDKVYLEQKYKSE 781
LK AESK+ S+EVE+ + N KA ++E+EA +EQ+K+ +EQKY+SE
Sbjct: 721 LKVAESKLESFEVELASLRLTLSEMTDKLDSANKKALAYEKEANKLEQEKIRMEQKYRSE 780
Query: 782 FERFEEVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGKSEFENLAMERMAVIERVQRQI 841
F+RF+EV+ K KSE + LAMER+A IER +RQ+
Sbjct: 781 FQRFDEVKERCKAAEIEAKRATELADKARTDAVTSQKEKSESQRLAMERLAQIERAERQV 840
Query: 842 ESLERQKTDLTNEVNRIRESELEALSKXXXXXXXXXXXXXXXXXXXXXNNEQRASTVKKL 901
E+LERQKTDL +E++R+R SE+EA+SK N QRA VK L
Sbjct: 841 ENLERQKTDLEDELDRLRVSEMEAVSKVTILEARVEEREKEIGSLIKETNAQRAHNVKSL 900
Query: 902 EDXXXXXXXXXXXXXXXXXXXXXEVQSAQAKLDEMQQELTKARLNETALGSKLRAVS--H 959
E E+Q+AQA +D +QQEL +ARL ETAL +K+RA S H
Sbjct: 901 EKLLDEERKAHIAANRRAEALSLELQAAQAHVDNLQQELAQARLKETALDNKIRAASSSH 960
Query: 960 GKRARADDY-EAGVGSVQEMDTNDKVLRANKRSRSTTSPLKYTQPEDGGSVFRGDDDNLS 1018
GKR+R +D + +G + +D++LR NKR+RST + ++G F+ DN
Sbjct: 961 GKRSRFEDVVDMDIG-----EGSDRILRTNKRARSTRGD-DHGPTDEGDEDFQSHQDN-G 1013
Query: 1019 QQSNQEDYTKFTVQKLKQELTKHNFGAELLQLRNPNKKEILALYEKCILQK 1069
++ +EDY K TVQ LK ELTK++ G LL + NKKEILALYE +L K
Sbjct: 1014 EEEEEEDYRKLTVQNLKHELTKYDCGHLLLNRGHQNKKEILALYEAHVLPK 1064
|
|
| RGD|1561523 Mpa2l "macrophage activation 2 like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N9J3 GBP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-98 si:ch211-209n20.1 "si:ch211-209n20.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1926263 Gbp3 "guanylate binding protein 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H0R5 GBP3 "Guanylate-binding protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1311040 Gbp5 "guanylate binding protein 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070912-618 gbp2 "guanylate binding protein 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N1I1 LOC781225 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041210-233 si:dkey-61p9.3 "si:dkey-61p9.3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.5 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | eugene3.00040459 | hypothetical protein (1070 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1070 | |||
| cd01851 | 224 | cd01851, GBP, Guanylate-binding protein (GBP) fami | 3e-62 | |
| pfam02263 | 264 | pfam02263, GBP, Guanylate-binding protein, N-termi | 1e-60 | |
| pfam02841 | 297 | pfam02841, GBP_C, Guanylate-binding protein, C-ter | 1e-23 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-17 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-16 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-15 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-14 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-13 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-13 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-13 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-13 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-12 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-12 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-11 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-11 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 6e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-11 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-10 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-09 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-08 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 2e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-08 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-08 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-08 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 1e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-07 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 5e-07 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 6e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 8e-07 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 9e-07 | |
| pfam05701 | 484 | pfam05701, DUF827, Plant protein of unknown functi | 1e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-06 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 3e-06 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 3e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-06 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 2e-05 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 3e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-05 | |
| pfam06548 | 488 | pfam06548, Kinesin-related, Kinesin-related | 5e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 6e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 6e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-05 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 7e-05 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 7e-05 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 9e-05 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 1e-04 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 1e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 2e-04 | |
| pfam05701 | 484 | pfam05701, DUF827, Plant protein of unknown functi | 2e-04 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 2e-04 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 2e-04 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 2e-04 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 2e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 3e-04 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 3e-04 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 4e-04 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 4e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 4e-04 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 6e-04 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 7e-04 | |
| COG4717 | 984 | COG4717, COG4717, Uncharacterized conserved protei | 7e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 8e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 8e-04 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 0.001 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 0.001 | |
| PLN03229 | 762 | PLN03229, PLN03229, acetyl-coenzyme A carboxylase | 0.001 | |
| COG3096 | 1480 | COG3096, MukB, Uncharacterized protein involved in | 0.001 | |
| PRK12705 | 508 | PRK12705, PRK12705, hypothetical protein; Provisio | 0.001 | |
| COG1842 | 225 | COG1842, PspA, Phage shock protein A (IM30), suppr | 0.001 | |
| COG3206 | 458 | COG3206, GumC, Uncharacterized protein involved in | 0.001 | |
| COG4913 | 1104 | COG4913, COG4913, Uncharacterized protein conserve | 0.001 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 0.002 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 0.002 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 0.002 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.002 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 0.002 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 0.002 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.002 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.002 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 0.003 | |
| COG2268 | 548 | COG2268, COG2268, Uncharacterized protein conserve | 0.003 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.003 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 0.004 | |
| COG5185 | 622 | COG5185, HEC1, Protein involved in chromosome segr | 0.004 |
| >gnl|CDD|206650 cd01851, GBP, Guanylate-binding protein (GBP) family (N-terminal domain) | Back alignment and domain information |
|---|
Score = 210 bits (537), Expect = 3e-62
Identities = 81/245 (33%), Positives = 112/245 (45%), Gaps = 22/245 (8%)
Query: 65 QLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALD 124
V P+ VVSV G GKSF+LN L G S GF V T + TKG+W+WS P K T D
Sbjct: 1 LDVGFPVVVVSVFGSQSSGKSFLLNHLFGTSDGFDVMDTSQQTTKGIWMWSDPFKDT--D 58
Query: 125 GTEYNLLLLDSEGIDAYDQT-GTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQ 183
G ++ +LLLD+EG D ++ ++F+LA LLSS+ IYN I +D+L + +
Sbjct: 59 GKKHAVLLLDTEGTDGRERGEFENDARLFALATLLSSVLIYNMWQTILGDDLDKLMGLLK 118
Query: 184 MTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGS 243
+ G + P+ ++++RDF + +T + S
Sbjct: 119 TAL-----ETLGLAGLHNFSKPKPLLLFVVRDFTGPTPLEGLDVT------------EKS 161
Query: 244 GRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTK 303
I N+I SIR F CF L P LQ L L PEFR L AL +
Sbjct: 162 ETLIEELNKIWSSIRKPFTPITCFVLPHPGLLHKLLQN--DGRLKDLPPEFRKALKALRQ 219
Query: 304 FVFER 308
F
Sbjct: 220 RFFSS 224
|
Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons. The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins. They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase. In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins. The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein (GAP) cannot approach. Length = 224 |
| >gnl|CDD|111185 pfam02263, GBP, Guanylate-binding protein, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|218704 pfam05701, DUF827, Plant protein of unknown function (DUF827) | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|219083 pfam06548, Kinesin-related, Kinesin-related | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|218704 pfam05701, DUF827, Plant protein of unknown function (DUF827) | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178768 PLN03229, PLN03229, acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|225747 COG3206, GumC, Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227250 COG4913, COG4913, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1070 | |||
| PF02263 | 260 | GBP: Guanylate-binding protein, N-terminal domain; | 100.0 | |
| cd01851 | 224 | GBP Guanylate-binding protein (GBP), N-terminal do | 100.0 | |
| KOG2037 | 552 | consensus Guanylate-binding protein [General funct | 100.0 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 99.97 | |
| KOG2203 | 772 | consensus GTP-binding protein [General function pr | 99.96 | |
| PF05879 | 742 | RHD3: Root hair defective 3 GTP-binding protein (R | 99.96 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.74 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.72 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 99.68 | |
| KOG2037 | 552 | consensus Guanylate-binding protein [General funct | 99.68 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 99.67 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.64 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.63 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.59 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.52 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.43 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.42 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.4 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 99.37 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.35 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 99.35 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.32 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.3 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 99.27 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 99.25 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 99.24 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.22 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.22 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 99.2 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.19 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 99.18 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 99.18 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.16 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 99.16 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 99.13 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 99.12 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 99.1 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 99.04 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 99.04 | |
| KOG4181 | 491 | consensus Uncharacterized conserved protein [Funct | 99.02 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 99.02 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.98 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.96 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.89 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.89 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.8 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.79 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 98.75 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.73 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.73 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.72 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.72 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 98.69 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 98.67 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.62 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.62 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.61 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.59 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.59 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.54 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 98.54 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.5 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.37 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 98.29 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 98.27 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.26 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.26 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.22 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.19 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.19 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 98.18 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.12 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 98.1 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 98.04 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 98.02 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 98.01 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.01 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.94 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 97.93 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 97.92 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 97.92 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.92 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.92 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 97.89 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.89 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 97.88 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.87 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.84 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.82 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 97.81 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.8 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 97.8 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 97.8 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.78 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.73 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.73 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 97.71 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.7 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 97.69 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 97.69 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.67 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 97.66 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 97.65 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 97.65 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.64 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.63 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 97.61 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 97.59 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.56 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 97.51 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.47 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 97.45 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.45 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.44 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 97.42 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.41 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 97.41 | |
| PF10220 | 895 | DUF2146: Uncharacterized conserved protein (DUF214 | 97.41 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.39 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.37 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.36 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 97.36 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.29 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.28 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.26 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 97.24 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 97.22 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.21 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 97.19 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.14 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 97.1 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.1 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 97.09 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 97.08 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 97.07 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 97.07 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 97.06 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 97.03 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 96.95 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 96.92 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.91 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 96.9 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 96.89 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 96.88 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 96.88 | |
| KOG1423 | 379 | consensus Ras-like GTPase ERA [Cell cycle control, | 96.88 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.88 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 96.86 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 96.85 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 96.83 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 96.82 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 96.8 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 96.79 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 96.78 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.77 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.76 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 96.74 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 96.74 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 96.72 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.72 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 96.7 | |
| TIGR02836 | 492 | spore_IV_A stage IV sporulation protein A. A compa | 96.7 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 96.69 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 96.66 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 96.66 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 96.66 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 96.62 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 96.6 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.6 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 96.6 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 96.58 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 96.57 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.56 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 96.56 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 96.56 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 96.54 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 96.53 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 96.52 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.51 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 96.51 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 96.46 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 96.44 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 96.41 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 96.38 | |
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 96.35 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 96.34 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.34 | |
| COG5019 | 373 | CDC3 Septin family protein [Cell division and chro | 96.34 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 96.33 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 96.31 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 96.31 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 96.29 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.28 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 96.24 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 96.24 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 96.23 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 96.22 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 96.22 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 96.21 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 96.2 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 96.2 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 96.19 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 96.19 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 96.19 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 96.18 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 96.17 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.17 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 96.17 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 96.16 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 96.16 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 96.15 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 96.12 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 96.1 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 96.1 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 96.09 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 96.08 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 96.08 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 96.06 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 96.04 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 96.04 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 96.01 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.01 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 96.01 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 96.0 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 95.98 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 95.94 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 95.94 | |
| KOG2655 | 366 | consensus Septin family protein (P-loop GTPase) [C | 95.93 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 95.93 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 95.93 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 95.93 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 95.91 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 95.89 | |
| PF13514 | 1111 | AAA_27: AAA domain | 95.89 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 95.88 | |
| KOG1547 | 336 | consensus Septin CDC10 and related P-loop GTPases | 95.86 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 95.86 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 95.85 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.84 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 95.84 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 95.83 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 95.83 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 95.81 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 95.8 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 95.79 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 95.79 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 95.78 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 95.77 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 95.76 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 95.72 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 95.71 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 95.71 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 95.71 | |
| PLN03118 | 211 | Rab family protein; Provisional | 95.7 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 95.7 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 95.69 | |
| PF00735 | 281 | Septin: Septin; InterPro: IPR000038 Septins consti | 95.69 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 95.69 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 95.67 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 95.65 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 95.64 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 95.64 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 95.64 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 95.64 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 95.63 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 95.6 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 95.59 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.58 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 95.57 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 95.56 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 95.56 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 95.55 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 95.54 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 95.54 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 95.53 | |
| PTZ00258 | 390 | GTP-binding protein; Provisional | 95.53 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 95.52 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 95.5 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 95.49 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 95.47 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 95.47 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 95.43 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 95.42 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 95.41 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 95.41 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 95.4 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 95.4 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 95.4 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 95.4 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 95.38 | |
| cd01900 | 274 | YchF YchF subfamily. YchF is a member of the Obg f | 95.37 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 95.34 | |
| KOG0448 | 749 | consensus Mitofusin 1 GTPase, involved in mitochon | 95.34 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 95.33 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.32 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 95.31 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 95.29 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 95.27 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 95.26 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 95.23 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 95.23 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 95.17 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 95.16 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 95.16 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 95.16 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 95.13 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 95.13 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 95.06 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 95.05 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 95.05 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.02 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 95.01 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 95.0 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 94.99 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 94.99 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 94.98 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 94.98 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 94.98 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.94 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 94.92 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 94.91 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 94.9 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 94.88 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 94.85 | |
| PLN03108 | 210 | Rab family protein; Provisional | 94.81 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 94.81 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 94.8 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 94.79 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 94.78 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 94.78 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.77 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 94.76 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 94.76 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 94.72 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 94.7 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 94.67 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 94.64 | |
| PRK09601 | 364 | GTP-binding protein YchF; Reviewed | 94.64 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.63 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 94.62 | |
| CHL00071 | 409 | tufA elongation factor Tu | 94.62 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.62 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 94.61 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 94.59 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 94.57 | |
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 94.54 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 94.54 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 94.52 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 94.51 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 94.5 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 94.48 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 94.47 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 94.46 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 94.44 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.43 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.43 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 94.36 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 94.35 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 94.35 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 94.34 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 94.29 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 94.29 | |
| KOG2485 | 335 | consensus Conserved ATP/GTP binding protein [Gener | 94.26 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 94.25 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 94.24 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 94.24 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 94.24 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 94.24 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 94.18 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 94.17 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 94.16 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 94.16 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 94.14 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 94.13 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 94.11 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 94.1 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.05 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 94.04 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 94.04 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 93.97 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 93.96 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 93.95 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 93.95 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 93.93 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 93.93 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 93.92 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 93.9 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 93.84 | |
| KOG1191 | 531 | consensus Mitochondrial GTPase [Translation, ribos | 93.77 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 93.77 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 93.76 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 93.74 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 93.65 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 93.59 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 93.58 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 93.57 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 93.52 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 93.51 | |
| KOG0086 | 214 | consensus GTPase Rab4, small G protein superfamily | 93.44 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 93.42 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 93.41 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 93.38 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 93.37 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 93.37 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 93.31 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 93.27 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 93.26 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 93.26 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 93.17 | |
| COG3172 | 187 | NadR Predicted ATPase/kinase involved in NAD metab | 93.17 | |
| KOG0410 | 410 | consensus Predicted GTP binding protein [General f | 93.13 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 93.06 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 93.05 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 92.96 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 92.92 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 92.91 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 92.9 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 92.88 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 92.86 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 92.86 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 92.84 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 92.8 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 92.78 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 92.77 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 92.68 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 92.67 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 92.67 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 92.62 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 92.6 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 92.6 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 92.59 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 92.58 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 92.56 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 92.45 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 92.41 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 92.37 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.36 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 92.3 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 92.28 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 92.26 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 92.26 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 92.26 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 92.24 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 92.15 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 92.13 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 92.08 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 92.01 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 91.99 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 91.99 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 91.99 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 91.96 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 91.94 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 91.94 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 91.88 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 91.85 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 91.85 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 91.81 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 91.81 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 91.8 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 91.79 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 91.79 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 91.74 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 91.72 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 91.71 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 91.68 | |
| PF13514 | 1111 | AAA_27: AAA domain | 91.67 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 91.66 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 91.62 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 91.62 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 91.61 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 91.59 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 91.54 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 91.51 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 91.47 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 91.45 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 91.44 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 91.43 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 91.43 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 91.43 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 91.38 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 91.35 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 91.35 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 91.34 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 91.33 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 91.31 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 91.28 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 91.28 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 91.26 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 91.25 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 91.19 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 91.17 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 91.12 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 91.12 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 91.12 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 91.11 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 91.1 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 91.09 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 91.08 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 91.06 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 91.06 |
| >PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-61 Score=527.78 Aligned_cols=258 Identities=47% Similarity=0.869 Sum_probs=226.9
Q ss_pred CCceeeCHHHHHHHHccCCCEEEEEeecCCCCChhHHHHHHhCCCCCccccCCCCcccceEEeeccccccccCCCCceeE
Q 001482 51 KGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNL 130 (1070)
Q Consensus 51 ~~~~~~~~eal~~l~~~~~~v~vvsv~G~~r~GKS~lln~l~~~~~gF~~~~~~~~~t~giw~~~~p~~~~~~~g~~~~~ 130 (1070)
+++|.||++|+++|..++.||+||||+|+||||||||||+|+|...||+||++..|||+|||||+.|. +.|++++|
T Consensus 1 ~~~~~~~~~al~~l~~~~~~v~vvsi~G~~rtGKSfLln~l~~~~~gF~~~~~~~~~T~Giw~w~~~~----~~~~~~~v 76 (260)
T PF02263_consen 1 DNKLELNEEALEILQQIDQPVAVVSIVGPYRTGKSFLLNQLLGPQSGFSWGPTVEPCTKGIWMWSEPL----PDGEKVAV 76 (260)
T ss_dssp TTEEEE-HHHHHHHCTTTSBEEEEEEEEETTSSHHHHHHHHCCBSSSSESSSCSSST-SCEEEECCE-----TTSTCEEE
T ss_pred CCeEEECHHHHHHHhcCCCCEEEEEeecCCccchHHHHHHHhcccccccccCCCCCCCcceeeeeccc----ccccceeE
Confidence 47899999999999889999999999999999999999999999999999999999999999999993 56788999
Q ss_pred EEeecccccccC-CCCcchhHHHHHHHhhhhheeecCCCCCCHHHhhhhHHHHHhhhhHHHHhcCCCCCCCcccccCCce
Q 001482 131 LLLDSEGIDAYD-QTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIF 209 (1070)
Q Consensus 131 ~llDteG~~~~~-~~~~~d~~ifaL~~llSS~~IyN~~~~i~~~~l~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~ 209 (1070)
|||||||+++.. .+.++|++||+|++||||++|||++|.|++++|++|+++++++++|+++... .....++..+||+|
T Consensus 77 ~llDteG~~~~~~~~~~~d~~if~Ls~LLSS~~IyN~~~~i~~~~l~~L~~~~~l~~~i~~~~~~-~~~~~~~~~~fp~l 155 (260)
T PF02263_consen 77 VLLDTEGLGDVEQSDEKYDAKIFALSMLLSSVLIYNSMGNIDEDDLDQLELFTELAKHIRVKYGD-SADSEDLGKPFPSL 155 (260)
T ss_dssp EEEEEECBTTTTCCCCHHCHHHHHHHHHH-SEEEEEECSSSSHHHHHCCHHHHHHHHHHHHTHHH-HHHHHCTTTTCEEE
T ss_pred EEecchhccccccCcccccHHHHHHHHHHhCceeeCCCCccchhHHHHHHHHHHHHHHHHHhccc-ccchhhhcccchHH
Confidence 999999999854 4567899999999999999999999999999999999999999999876311 11233456789999
Q ss_pred eeeecccccccccccccCChHHHHHHhccCCCCCCchhhhhhHHHHHHHhhCCCCceEeccCCCCChhhcccccCCCcCC
Q 001482 210 VWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDR 289 (1070)
Q Consensus 210 ~wlvRD~~~~~~~~g~~~t~~~yLe~~L~~~~~~~~~~~~~n~~r~~i~~~F~~~~c~~l~~P~~~~~~l~~l~~~~~~~ 289 (1070)
+||||||++++..+|+.+|+++||+.+|+...+.++.+..+|.+|++|++||++++||+||||+.++..++++++++.++
T Consensus 156 ~wlvRDf~~~~~~~~~~~t~~eyLe~~L~~~~~~~~~~~~~N~iR~~I~~~F~~~~cf~Lp~P~~~~~~l~~l~~l~~~~ 235 (260)
T PF02263_consen 156 VWLVRDFSLELEDDGGKITPQEYLEQALKPESGQDEEIQERNKIRECIRSCFPSRDCFTLPHPGSDVDKLQNLDGLSLDD 235 (260)
T ss_dssp EEEEECE-SCTCCTTECHHHHHHHHHHCCSSTSSSCCCCCHHHHHHHHHHHECCEEEEEEE-SSCCCCC-TCGCCCBGGG
T ss_pred HHHHhhccchhhhccCCCCHHHHHHHHHhcccchhHHHHHhhHHHHHHHHHCCCCeEEEecCCCchhhhccCcccCChhh
Confidence 99999999988888889999999999999888877788889999999999999999999999999999889999999999
Q ss_pred CcHHHHHHHHHHHHHHhccCCccc
Q 001482 290 LRPEFRAGLDALTKFVFERTRPKQ 313 (1070)
Q Consensus 290 l~~~F~~~~~~l~~~i~~~~~pK~ 313 (1070)
|+|+|+++++.|+++|+....+|+
T Consensus 236 L~~eF~~~l~~l~~~i~~~~~~k~ 259 (260)
T PF02263_consen 236 LDPEFVEQLDELVKYIFSSAKVKT 259 (260)
T ss_dssp S-HHHHHHHHHHHHHHHCCT---B
T ss_pred CCHHHHHHHHHHHHHHhccCCccc
Confidence 999999999999999999887775
|
GTPases induced by IFN-gamma are key to the protective immunity against microbial and viral pathogens. These GTPases are classified into three groups: the small 47-kd GTPases, the Mx proteins, and the large 65- to 67-kd GTPases. Guanylate-binding proteins (GBP) fall into the last class. In humans, there are seven GBPs (hGBP1-7) []. Structurally, hGBP1 consists of two domains: a compact globular N-terminal domain harbouring the GTPase function, and an alpha-helical finger-like C-terminal domain (IPR003191 from INTERPRO). Human GBP1 is secreted from cells without the need of a leader peptide, and has been shown to exhibit antiviral activity against Vesicular stomatitis virus and Encephalomyocarditis virus, as well as being able to regulate the inhibition of proliferation and invasion of endothelial cells in response to IFN-gamma [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3QOF_A 3Q5E_C 3QNU_A 3Q5D_A 1DG3_A 2D4H_A 2B8W_B 2B92_A 2BC9_A 1F5N_A. |
| >cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain | Back alignment and domain information |
|---|
| >KOG2037 consensus Guanylate-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >KOG2203 consensus GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2037 consensus Guanylate-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG4181 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PF10220 DUF2146: Uncharacterized conserved protein (DUF2146); InterPro: IPR019354 Smg8 and Smg9 are two subunits of the Smg-1 complex | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >TIGR02836 spore_IV_A stage IV sporulation protein A | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >PTZ00258 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >cd01900 YchF YchF subfamily | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >PRK09601 GTP-binding protein YchF; Reviewed | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0410 consensus Predicted GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1070 | ||||
| 1dg3_A | 592 | Structure Of Human Guanylate Binding Protein-1 In N | 1e-51 | ||
| 2b8w_A | 328 | Crystal-Structure Of The N-Terminal Large Gtpase Do | 2e-47 | ||
| 3qnu_A | 459 | Crystal Structure Of The Cytosolic Domain Of Human | 2e-10 | ||
| 3q5e_A | 447 | Crystal Structure Of Human Atlastin-1 (Residues 1-4 | 2e-10 | ||
| 4idq_A | 447 | Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 44 | 2e-10 | ||
| 4idn_A | 457 | Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 | 2e-10 | ||
| 4idp_A | 447 | Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 | 6e-09 | ||
| 3q5d_A | 447 | Crystal Structure Of Human Atlastin-1 (Residues 1-4 | 6e-09 |
| >pdb|1DG3|A Chain A, Structure Of Human Guanylate Binding Protein-1 In Nucleotide Free Form Length = 592 | Back alignment and structure |
|
| >pdb|2B8W|A Chain A, Crystal-Structure Of The N-Terminal Large Gtpase Domain Of Human Guanylate Binding Protein 1 (Hgbp1) In Complex With GmpALF4 Length = 328 | Back alignment and structure |
| >pdb|3QNU|A Chain A, Crystal Structure Of The Cytosolic Domain Of Human Atlastin-1 In Complex With Gdp, Hexagonal Form Length = 459 | Back alignment and structure |
| >pdb|3Q5E|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 2 Length = 447 | Back alignment and structure |
| >pdb|4IDQ|A Chain A, Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 447 | Back alignment and structure |
| >pdb|4IDN|A Chain A, Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 | Back alignment and structure |
| >pdb|4IDP|A Chain A, Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 | Back alignment and structure |
| >pdb|3Q5D|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 1 Length = 447 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
Score = 314 bits (804), Expect = 3e-95
Identities = 153/587 (26%), Positives = 278/587 (47%), Gaps = 32/587 (5%)
Query: 40 ARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQ 99
P+ L+ + G+ +PEA+ L + +P+ VV++ G R GKS+++N+L G+ GF
Sbjct: 8 TGPMCLIE-NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS 66
Query: 100 VASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGI-DAYDQTGTYSTQIFSLAVLL 158
+ ST + TKG+W+W P + L+LLD+EG+ D + IF+LAVLL
Sbjct: 67 LGSTVQSHTKGIWMWCVPHP----KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLL 122
Query: 159 SSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTT-----PSELGQFSPIFVWLL 213
SS F+YN +G I++ A+D+L VT++T IR ++S + ++ F P FVW L
Sbjct: 123 SSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTL 182
Query: 214 RDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPL 273
RDF LDL D + +TP +YL +L+ +G+ + N R IR FP ++CF RP+
Sbjct: 183 RDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPV 242
Query: 274 SNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV-GATVLTGPVLIGITESYL 332
+L +L+++ + L PEF + ++F ++ K + G + GP L + +Y+
Sbjct: 243 HRR-KLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTYV 301
Query: 333 DAINNGAVPTISSSWQSVEEAECRRAYDSATETY---MSTFDRSKPPEEVALGEAHEAAV 389
+AI++G +P + ++ ++ + E A A Y M + L + H +
Sbjct: 302 NAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDLHRDSE 361
Query: 390 QKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQ----SME 445
++A+ V+ ++ L K +D K + RCS +Q +E
Sbjct: 362 REAIEVFI--RSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSGLLQVIFSPLE 419
Query: 446 RKLRAACHSSDASIDNVVKVLDGLISEY-ETSCHGPGKWQKLATFLQ--QSSEGPILDLV 502
+++A +S V+ L L +Y E G + L T+L+ +S IL
Sbjct: 420 EEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTD 479
Query: 503 KRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDY 562
+ L ++ E +K S + + K+L + +E+ + + Y + + + ++
Sbjct: 480 QTLTEKE-KEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMEND 538
Query: 563 TSRINNLQGENISLREKS------SSLSKTVDSLKNEISDWKRKYDQ 603
++ Q ++L+ + K +KNEI D + K +
Sbjct: 539 RVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRR 585
|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Length = 447 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Length = 386 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1070 | ||||
| d1f5na2 | 277 | c.37.1.8 (A:7-283) Interferon-induced guanylate-bi | 1e-75 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 6e-15 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 0.004 |
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 248 bits (634), Expect = 1e-75
Identities = 94/279 (33%), Positives = 156/279 (55%), Gaps = 12/279 (4%)
Query: 42 PIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVA 101
P+ L+ + G+ +PEA+ L + +P+ VV++ G R GKS+++N+L G+ GF +
Sbjct: 4 PMCLIE-NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLG 62
Query: 102 STHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQ-TGTYSTQIFSLAVLLSS 160
ST + TKG+W+W P + L+LLD+EG+ ++ + IF+LAVLLSS
Sbjct: 63 STVQSHTKGIWMWCVPHP----KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSS 118
Query: 161 MFIYNQMGGIDESAIDRLSLVTQMTKHIRIRAS-----GGKTTPSELGQFSPIFVWLLRD 215
F+YN +G I++ A+D+L VT++T IR ++S ++ F P FVW LRD
Sbjct: 119 TFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRD 178
Query: 216 FYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSN 275
F LDL D + +TP +YL +L+ +G+ + N R IR FP ++CF RP+
Sbjct: 179 FSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHR 238
Query: 276 ENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV 314
L +L+++ + L PEF + ++F ++ K +
Sbjct: 239 RK-LAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTL 276
|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1070 | |||
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 100.0 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 99.93 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 97.68 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 97.6 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 97.28 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 97.08 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 96.91 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 96.62 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 96.47 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 96.27 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 96.15 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 95.72 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 95.68 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 95.52 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 95.4 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.4 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 95.35 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 95.01 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 94.73 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 94.57 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 94.44 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 94.22 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 93.89 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 93.83 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 93.79 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 93.54 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 93.44 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 93.23 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 93.23 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 93.12 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 92.96 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 92.9 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 92.85 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 92.83 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 92.8 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 92.41 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 92.38 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 92.36 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 92.27 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 92.12 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.11 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 92.1 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 91.9 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 91.88 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 91.84 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 91.8 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 91.74 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 91.72 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 91.67 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 91.64 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 91.61 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 91.36 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 91.2 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 91.17 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 91.04 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 91.0 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 90.97 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 90.64 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 90.59 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 90.48 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 90.27 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 90.22 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 89.77 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 89.73 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 89.59 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 89.47 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 89.32 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 89.21 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 88.76 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 88.75 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 88.66 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 88.19 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 86.81 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 86.46 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 86.4 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 86.16 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 85.93 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 85.56 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 85.28 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 83.69 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 83.65 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 83.57 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 82.42 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 81.52 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 81.04 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 81.03 |
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=0 Score=457.10 Aligned_cols=271 Identities=35% Similarity=0.673 Sum_probs=246.3
Q ss_pred CCCCEEEEEECCCCCEEECHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCC
Q ss_conf 99970489848998535199889997713999799986268999813799888289998544678886654077513654
Q 001482 39 PARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPL 118 (1070)
Q Consensus 39 ~~~p~~lv~~~~~~~~~i~~eal~~l~~~~~~v~vvsv~G~~r~GKS~lln~l~~~~~~F~~~~~~~~~t~giw~~~~p~ 118 (1070)
++.|++||+ +.+++|.++++|+++|..++.||+||||+|++|||||||||+|+|...||+||+++++||+|||||+.|+
T Consensus 1 ~~~p~~li~-~~~~~l~~~~e~l~~l~~~~~~v~vvsi~G~~~sGKS~llN~l~~~~~~f~~~~~~~~~T~Giw~~~~~~ 79 (277)
T d1f5na2 1 MTGPMCLIE-NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPH 79 (277)
T ss_dssp CCSCEEEEE-EETTEEEECHHHHHHHHTCCSBEEEEEEEEBTTSSHHHHHHHHTTCSSCSCCCCSSSCCCCSEEEEEEEC
T ss_pred CCCCEEEEE-CCCCEEEECHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEEEC
T ss_conf 998858997-6999499899999999707998799998899999799999998099878764787777777658998541
Q ss_pred CCCCCCCCCEEEEEEECCCCCCCCC-CCCCHHHHHHHHHHHHHHEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCC---
Q ss_conf 3445789822689840666554577-876405999999852101213277888988845658899965667877149---
Q 001482 119 KRTALDGTEYNLLLLDSEGIDAYDQ-TGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASG--- 194 (1070)
Q Consensus 119 ~~~~~~g~~~~~~llDteG~~~~~~-~~~~d~~if~L~~llSS~~IyN~~~~i~~~~l~~L~~~~~~~~~~~~~~~~--- 194 (1070)
+ +|..+.+++|||||+++.+. +..+|++||+|++||||++|||+.+.|++.++++|+++++++..+..+.+.
T Consensus 80 ~----~~~~~~~~~lDteG~~~~~~~~~~~~~~i~~l~~llSs~~i~N~~~~~~~~~l~~L~~~~~~~~~~~~~~~~~~~ 155 (277)
T d1f5na2 80 P----KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDEN 155 (277)
T ss_dssp S----SSTTCEEEEEEECCBCCGGGCCCTTHHHHHHHHHHHCSEEEEEEESCSSHHHHHTTHHHHTHHHHCBSCCC----
T ss_pred C----CCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf 5----788746999824543454446504579999999997287999321557689999989999999999986323211
Q ss_pred --CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEECCCC
Q ss_conf --999977434457703222003322222246657968899985057878980023324899999845899834861688
Q 001482 195 --GKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRP 272 (1070)
Q Consensus 195 --~~~~~~~~~~~~P~~~wlvRD~~~~~~~~g~~~t~~~yLe~~L~~~~~~~~~~~~~n~~r~~i~~~F~~~~cf~l~~P 272 (1070)
+.....++..+||.|+|+||||++++..++...|+.+||+.+|...++.+......|.+|++|++||+++.||+||||
T Consensus 156 ~~~~~~~~~~~~~~p~l~~vvRD~~~~~~~~~~~~t~~eyLe~~l~~~~~~~~~~~~~N~~R~~i~~~F~dv~cf~Lp~P 235 (277)
T d1f5na2 156 ENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRP 235 (277)
T ss_dssp ---CCGGGGHHHHCCEEEEEEETCCCCCCCSSSCCCHHHHHHHHTCCCCCCSHHHHHHHHHHHHHHHHCSCEEEEECCCC
T ss_pred CCCCCCCHHHCCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf 13434411112668835998421322122467746688999999740568406667663699999986688737867887
Q ss_pred CCCHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf 9891330000289847896889999999999973269865549
Q 001482 273 LSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVG 315 (1070)
Q Consensus 273 ~~~~~~l~~l~~~~~~~l~~~F~~~~~~l~~~i~~~~~pK~~~ 315 (1070)
+.. ..++++..++.++|+|+|+++++.|+++|+++++||.++
T Consensus 236 ~~~-~~l~~l~~~~~~~L~~~F~~~v~~L~k~I~~~~~~K~ln 277 (277)
T d1f5na2 236 VHR-RKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLS 277 (277)
T ss_dssp SCG-GGGGGGGGSCGGGSCHHHHHHHHHHHHHHHHHCCCCEET
T ss_pred CCH-HHHCHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf 603-440233138820048989999999999996328886369
|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|