Citrus Sinensis ID: 001557


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050----
MAGNDWVNSYLEAILDVGPGIDDAKSSLLLRERGRFSPTRYFVEQVITGFDETDLHRSWIRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRKAKRRLERERGRKEASADMSEDLSEGDKGDVSGELSAHGGSTRGRMPRISSVDTMENWAIQYKEKKLYIVLISLHGLIRGENMELGRDSDTGGQVKYVVELARALGSMPGVYRVDLLTRQVSAPDVDWTYAEPSEMLNRKNTENLMQGLGESSGAYIIRIPFGPKDKYVQKELLWPHIPEFVDAALTHIIQISKVLGEQVGSGQPIWPVAIHGHYADAGDAAALLSGALNVPMVFTGHSLGRDKLEQLLKQGRLSRDEINTTYKIMRRIEAEELSLDASEIVITSTRQEIEEQWRLYDGFDPVLERKLRARIKRGVSCHGRFMPRMVVIPPGIEFHHIVRHNGDVDGEVERDEGSPASPDPPIWSEIMHFFSNPRKPMILALARPDPKKNITTLVKAFGECRPLRELANLTLIMGNRDDIDEMSGTNAALLLSILKLIDKYDLYGQVAYPKHHKQSDVPDIYRLAAKTKGVFINPAFIEPFGLTLIEAAAYGLPIVATKNGGPVDIHRVLDNGLLVDPHDQQSIADALLKLVSDKQLWERCRQNGLKNIHQFSWPEHCKSYLSRISSCKQRQPRWQRSDDGLDNSESDSPGDSWRDIHDLSLNLKLSLEGDKNEGGSTLDNSLDTEENAVTGKNKLENAVLALSNRTIGGTQKADHNVASGKFPALRRRKYVFVIAADCDTTSDFLEIIKKVVEAAGKDNSAGFIGFVLSTALTILELHSLLVSGGLSPLAFDAFICNSGSELYYPSSSTEDNHGLPFLVDLDYRFHTEYRWGGEGLRKTLVRWAASVNDKKGEEGKIVEEDESRSTIHCYAFEVTNPQMIPPVKELRKLMRIQALRCHVIYCQNGTKLHVIPVLASRSQALRYLHVRWGIDLSNVVVIAGECGDTDYEGLLGGVHKTVILKGVGESARKLHANRNYSLEDVISFDSHNVIQVDEACDSYDIRASLEKLGVLKGQ
ccccHHHHHHHHHHHHccccccccccHHHHccccccccccHHHHHHHcccccccHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccccccccccccccccccccHHcccccHHHcccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccHHHHHHHHHccccccEEEccccccccHHHHHHHccccccccccccccccHHHHHHHHHHccccEEEEccHHHHHHHHccccccccHHHHHHHHcEEEEEEccccccccEEEEccccccccEEccccccccccccccccccccccccHHHHHHccccccccEEEEEccccccccHHHHHHHHHccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHccccccEECcccccccccHHHHHHHHHcccCEECccccccccHHHHHHHHccccEEEcccccccEEEEccccCEEcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccHHHHHcHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccccccccccEEEEcccccEEcccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHccccEEEEEEcccCEEEcccccccHHHHHHHHHHHHccccccEEEEEcccccccHHHHcccccEEEEEcccccHHHHHHcccccccccCECcccccHHHHHHHccHHHHHHHHHHHcccccc
*AGNDWVNSYLEAILDVGPGIDDAKSSLLLRERGRFSPTRYFVEQVITGFDETDLHRSWIRAAA********TRLENMCWRIWNLARKK**************************************************************DTMENWAIQYKEKKLYIVLISLHGLIRGENMELGRDSDTGGQVKYVVELARALGSMPGVYRVDLLTRQVSAPDVDWTYAEPSEMLNRKNTENLMQGLGESSGAYIIRIPFGPKDKYVQKELLWPHIPEFVDAALTHIIQISKVLGEQVGSGQPIWPVAIHGHYADAGDAAALLSGALNVPMVFTGHSLGRDKLEQLLKQGRLSRDEINTTYKIMRRIEAEELSLDASEIVITSTRQEIEEQWRLYDGFDPVLERKLRARIKRGVSCHGRFMPRMVVIPPGIEFHHIVRHNGDVDG*VERDEGSPASPDPPIWSEIMHFFSNPRKPMILALARPDPKKNITTLVKAFGECRPLRELANLTLIMGNRDDIDEMSGTNAALLLSILKLIDKYDLYGQVAYPKHHKQSDVPDIYRLAAKTKGVFINPAFIEPFGLTLIEAAAYGLPIVATKNGGPVDIHRVLDNGLLVDPHDQQSIADALLKLVSDKQLWERCRQNGLKNIHQFSWPEHCKSYLSRISSCKQRQPR*********************DIHDLSLNLK********************************************************KFPALRRRKYVFVIAADCDTTSDFLEIIKKVVEAAGKDNSAGFIGFVLSTALTILELHSLLVSGGLSPLAFDAFICNSGSELYYPSSSTEDNHGLPFLVDLDYRFHTEYRWGGEGLRKTLVRWAASV****************RSTIHCYAFEVTNPQMIPPVKELRKLMRIQALRCHVIYCQNGTKLHVIPVLASRSQALRYLHVRWGIDLSNVVVIAGECGDTDYEGLLGGVHKTVILKGVGESARKLHANRNYSLEDVISFDSHNVIQVDEACDSYDIRASLEKLGVLK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGNDWVNSYLEAILDVGPGIDDAKSSLLLRERGRFSPTRYFVEQVITGFDETDLHRSWIRAAATRSPQERNTRLENMCWRIWNxxxxxxxxxxxxxxxxxxxxxERERGRKEASADMSEDLSEGDKGDVSGELSAHGGSTRGRMPRISSVDTMENWAIQYKEKKLYIVLISLHGLIRGENMELGRDSDTGGQVKYVVELARALGSMPGVYRVDLLTRQVSAPDVDWTYAEPSEMLNRKNTENLMQGLGESSGAYIIRIPFGPKDKYVQKELLWPHIPEFVDAALTHIIQISKVLGEQVGSGQPIWPVAIHGHYADAGDAAALLSGALNVPMVFTGHSLGRDKLEQLLKQGRLSRDEINTTYKIMRRIEAEELSLDASEIVITSTRQEIEEQWRLYDGFDPVLERKLRARIKRGVSCHGRFMPRMVVIPPGIEFHHIVRHNGDVDGEVERDEGSPASPDPPIWSEIMHFFSNPRKPMILALARPDPKKNITTLVKAFGECRPLRELANLTLIMGNRDDIDEMSGTNAALLLSILKLIDKYDLYGQVAYPKHHKQSDVPDIYRLAAKTKGVFINPAFIEPFGLTLIEAAAYGLPIVATKNGGPVDIHRVLDNGLLVDPHDQQSIADALLKLVSDKQLWERCRQNGLKNIHQFSWPEHCKSYLSRISSCKQRQPRWQRSDDGLDNSESDSPGDSWRDIHDLSLNLKLSLEGDKNEGGSTLDNSLDTEENAVTGKNKLENAVLALSNRTIGGTQKADHNVASGKFPALRRRKYVFVIAADCDTTSDFLEIIKKVVEAAGKDNSAGFIGFVLSTALTILELHSLLVSGGLSPLAFDAFICNSGSELYYPSSSTEDNHGLPFLVDLDYRFHTEYRWGGEGLRKTLVRWAASVNDKKGEEGKIVEEDESRSTIHCYAFEVTNPQMIPPVKELRKLMRIQALRCHVIYCQNGTKLHVIPVLASRSQALRYLHVRWGIDLSNVVVIAGECGDTDYEGLLGGVHKTVILKGVGESARKLHANRNYSLEDVISFDSHNVIQVDEACDSYDIRASLEKLGVLKGQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sucrose-phosphate synthase 1 Plays a major role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation.confidentQ94BT0
Probable sucrose-phosphate synthase 1 Plays a role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation.probableO04932
Probable sucrose-phosphate synthase 4 Plays a role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation.probableQ6ZHZ1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.14Sucrose-phosphate synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S28, chain A
Confidence level:very confident
Coverage over the Query: 86-236,249-291,303-679
View the alignment between query and template
View the model in PyMOL
Template: 2R60, chain A
Confidence level:very confident
Coverage over the Query: 165-235,249-290,303-405,423-443,457-670
View the alignment between query and template
View the model in PyMOL
Template: 3GYG, chain A
Confidence level:probable
Coverage over the Query: 785-866,877-984
View the alignment between query and template
View the model in PyMOL
Template: 1S2O, chain A
Confidence level:probable
Coverage over the Query: 804-847,859-999
View the alignment between query and template
View the model in PyMOL