Citrus Sinensis ID: 001565

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050--
MSLLSRFFYKRPPDGLLEFIERVYVFDSCFSTEVVPDGMYQLYLHEILTELHEEFPDSAFLAFNFREGEKQSEFAEILCEYDVTVLDYPRQYEGCPLLPMSLIQHFLRVCEHWLLLGDHQNVILLHSERGGWPLLAFLLASLLIFRKLHSGERRTLEIVHREAPKGFLQLLSPLNPFPSQLRYLQYVARRNITPEWPPPERALSLDCVILRAIPNFDAQNGCRPIIRIFGRNFRSKGGLSTQMIFSMSKKRKTLRHYRQADCDVIKIDIQCLVQGDVVLECVHLDLDPEREVMMFRVMFNTAFIRSNILMLNSENLDILWDSKERYPKGFRAEVLFGDVESISPPRAPTSILNGEEKGGLPIEAFSRVRELFSGVEWVDNSDALWLLKQLSVFSDVKEFTRMQDRGSSYTSPVDSEEENNASSAGDSLDEAFDVFPEPLVDTKKLLLSNAGDSVTSLSKNEGPHDVILVSEPIDQVSNETVLSSLHQQSLVLTEGNPPCFPPSPSSPQSIAPTPPLPPHSSPASASGVIPLPMSAPPPSPPPPPPPPLPSSTNNSFLSPPPPPPPLPSSTNNNFISPPPPPPPPPCFSSKDFSPMPSETSRGPPPPPPPPPPPAFSGKDSSAVRSTSSIVPPPPPPPPPPSFYGKGSSTMPSTSSIGPPPPPPPPPPSFSGKGSSSLPSTSSIGSPPPPPPPPPSFSGRSSIVPSTTSKGPPPPPPPPPPPPAAGPNSSKALLSAPPHPSPTSRSSQPSFHPPPPPPPPPPPPPPSSLGKITNKLQLAPTSQPAVPPPPPPLPKSCSTSIPMAPPPPPSIGCKPINAPRPPPPPPPLGPARSGAVLPPPPPAPKLPTAPSPPSRGVMPSPPPPPGVKSSSVPPPPLPSVGKGKVTSGPASHGRGRLNSGVSHAPKKASLKPLHWVKVTRAMQGSLWADSQKQENHSRAPEIDISELESLFSAASDGSGTNKTGVRRGSNINKPEKVQLVELRRAYNCEIMLTKIKIPLPDMMNAVLALDSSALDIDQVENLIKFCPTKEEMELLKNYAGDKVMLGKCEQVPG
ccHHHHHHHcccccccEEEEccEEEEEcccccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHccccEEccccccccccccccHHHHHHHHHHccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHccccccccccHHHHHHHHHHcccccccccccccccccEEEEEcccccccccccccEEEEccccccccccccccEEEEccccccEEHHcccccccEEEEcccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccEEEccccHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHccccccccccccccccc
*SLLSRFFYKRPPDGLLEFIERVYVFDSCFSTEVVPDGMYQLYLHEILTELHEEFPDSAFLAFNFREGEKQSEFAEILCEYDVTVLDYPRQYEGCPLLPMSLIQHFLRVCEHWLLLGDHQNVILLHSERGGWPLLAFLLASLLIFRKLHSGERRTLEIVHREAPKGFLQLLSPLNPFPSQLRYLQYVARRNITPEWPPPERALSLDCVILRAIPNFDAQNGCRPIIRIFGRNFRSKGGLSTQMIFSMSKKRKTLRHYRQADCDVIKIDIQCLVQGDVVLECVHLDLDPEREVMMFRVMFNTAFIRSNILMLNSENLDILWDSKERYPKGFRAEVLFGDVESISP**************GLPIEAFSRVRELFSGVEWVDNSDALWLLKQLSVFSD************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LHWVKVTRAMQGSLWADSQK*******PEIDISELES***************************VQLVELRRAYNCEIMLTKIKIPLPDMMNAVLALDSSALDIDQVENLIKFCPTKEEMELLKNYAGDKVMLGKCEQ***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLSRFFYKRPPDGLLEFIERVYVFDSCFSTEVVPDGMYQLYLHEILTELHEEFPDSAFLAFNFREGEKQSEFAEILCEYDVTVLDYPRQYEGCPLLPMSLIQHFLRVCEHWLLLGDHQNVILLHSERGGWPLLAFLLASLLIFRKLHSGERRTLEIVHREAPKGFLQLLSPLNPFPSQLRYLQYVARRNITPEWPPPERALSLDCVILRAIPNFDAQNGCRPIIRIFGRNFRSKGGLSTQMIFSMSKKRKTLRHYRQADCDVIKIDIQCLVQGDVVLECVHLDLDPEREVMMFRVMFNTAFIRSNILMLNSENLDILWDSKERYPKGFRAEVLFGDVESISPPRAPTSILNGEEKGGLPIEAFSRVRELFSGVEWVDNSDALWLLKQLSVFSDVKEFTRMQDRGSSYTSPVDSEEENNASSAGDSLDEAFDVFPEPLVDTKKLLLSNAGDSVTSLSKNEGPHDVILVSEPIDQVSNETVLSSLHQQSLVLTEGNPPCFPPSPSSPQSIAPTPPLPPHSSPASASGVIPLPMSAPPPSPPPPPPPPLPSSTNNSFLSPPPPPPPLPSSTNNNFISPPPPPPPPPCFSSKDFSPMPSETSRGPPPPPPPPPPPAFSGKDSSAVRSTSSIVPPPPPPPPPPSFYGKGSSTMPSTSSIGPPPPPPPPPPSFSGKGSSSLPSTSSIGSPPPPPPPPPSFSGRSSIVPSTTSKGPPPPPPPPPPPPAAGPNSSKALLSAPPHPSPTSRSSQPSFHPPPPPPPPPPPPPPSSLGKITNKLQLAPTSQPAVPPPPPPLPKSCSTSIPMAPPPPPSIGCKPINAPRPPPPPPPLGPARSGAVLPPPPPAPKLPTAPSPPSRGVMPSPPPPPGVKSSSVPPPPLPSVGKGKVTSGPASHGRGRLNSGVSHAPKKASLKPLHWVKVTRAMQGSLWADSQKQENHSRAPEIDISELESLFSAASDGSGTNKTGVRRGSNINKPEKVQLVELRRAYNCEIMLTKIKIPLPDMMNAVLALDSSALDIDQVENLIKFCPTKEEMELLKNYAGDKVMLGKCEQVPG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Formin-like protein 14 probableQ9C6S1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3N0A, chain A
Confidence level:confident
Coverage over the Query: 21-30,44-370
View the alignment between query and template
View the model in PyMOL
Template: 2J1D, chain G
Confidence level:confident
Coverage over the Query: 904-954,974-1049
View the alignment between query and template
View the model in PyMOL
Template: 3V0D, chain A
Confidence level:probable
Coverage over the Query: 24-341
View the alignment between query and template
View the model in PyMOL
Template: 3V1V, chain A
Confidence level:probable
Coverage over the Query: 660-670
View the alignment between query and template
View the model in PyMOL
Template: 3V1V, chain A
Confidence level:probable
Coverage over the Query: 660-670
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 757-854
View the alignment between query and template
View the model in PyMOL
Template: 1DEQ, chain A
Confidence level:probable
Coverage over the Query: 578-606
View the alignment between query and template
View the model in PyMOL
Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 681-749
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 757-854
View the alignment between query and template
View the model in PyMOL
Template: 3DZY, chain A
Confidence level:probable
Coverage over the Query: 724-760
View the alignment between query and template
View the model in PyMOL