Citrus Sinensis ID: 001565
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1052 | ||||||
| 255557693 | 820 | DNA binding protein, putative [Ricinus c | 0.451 | 0.579 | 0.801 | 0.0 | |
| 225427486 | 1269 | PREDICTED: uncharacterized protein LOC10 | 0.447 | 0.371 | 0.770 | 0.0 | |
| 449453312 | 1256 | PREDICTED: formin-like protein 14-like [ | 0.419 | 0.351 | 0.839 | 0.0 | |
| 296088480 | 1082 | unnamed protein product [Vitis vinifera] | 0.449 | 0.437 | 0.769 | 0.0 | |
| 449506096 | 529 | PREDICTED: formin-like protein 14-like [ | 0.419 | 0.833 | 0.839 | 0.0 | |
| 186479105 | 1230 | formin-like protein 14 [Arabidopsis thal | 0.430 | 0.368 | 0.755 | 0.0 | |
| 302595094 | 1033 | type II formin [Arabidopsis thaliana] | 0.430 | 0.438 | 0.755 | 0.0 | |
| 357484593 | 612 | Formin-like protein, partial [Medicago t | 0.451 | 0.776 | 0.773 | 0.0 | |
| 12321294 | 1201 | unknown protein [Arabidopsis thaliana] | 0.399 | 0.349 | 0.743 | 0.0 | |
| 356508230 | 1206 | PREDICTED: uncharacterized protein LOC10 | 0.460 | 0.401 | 0.719 | 0.0 |
| >gi|255557693|ref|XP_002519876.1| DNA binding protein, putative [Ricinus communis] gi|223540922|gb|EEF42480.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 832 bits (2148), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 395/493 (80%), Positives = 438/493 (88%), Gaps = 18/493 (3%)
Query: 1 MSLLSRFFYKRPPDGLLEFIERVYVFDSCFSTEVVPDGMYQLYLHEILTELHEEFPDSAF 60
MSLLSRFFYKRPPDGLLEF++RVYVFDSCFSTEV+PD +YQ+YLHEI+ ELHEEFPDS+F
Sbjct: 1 MSLLSRFFYKRPPDGLLEFVDRVYVFDSCFSTEVLPDELYQIYLHEIVAELHEEFPDSSF 60
Query: 61 LAFNFREGEKQSEFAEILCEYDVTVLDYPRQYEGCPLLPMSLIQHFLRVCEHWLLLGDHQ 120
LAFNFREGEK+S+FAEILC+YDVTV+DYPRQYEGCPLLP+SLIQHFLRVCE WL LG+HQ
Sbjct: 61 LAFNFREGEKRSQFAEILCQYDVTVMDYPRQYEGCPLLPLSLIQHFLRVCETWLSLGNHQ 120
Query: 121 NVILLHSERGGWPLLAFLLASLLIFRKLHSGERRTLEIVHREAPKGFLQLLSPLNPFPSQ 180
N+IL+H ERGGWP+LAFLLAS LIF KLHSGERRTLE+VHREAPKGFLQLLSPLNPFPSQ
Sbjct: 121 NIILIHCERGGWPILAFLLASFLIFSKLHSGERRTLELVHREAPKGFLQLLSPLNPFPSQ 180
Query: 181 LRYLQYVARRNITPEWPPPERALSLDCVILRAIPNFDAQNGCRPIIRIFGRNFRSKGGLS 240
LRYLQYVARRNI PEWPPPERALSLDC+ILRAIP+FD++ GCRPIIRIFGRN +K GLS
Sbjct: 181 LRYLQYVARRNIAPEWPPPERALSLDCIILRAIPSFDSEKGCRPIIRIFGRNLHTKSGLS 240
Query: 241 TQMIFSMSKKRK-TLRHYRQADCDVIKIDIQCLVQGDVVLECVHLDLDPEREVMMFRVMF 299
TQM+FSMSK++K TLRHY QADCDVIKIDIQCLVQGDVVLECVHLDLDPEREVMMFRVMF
Sbjct: 241 TQMLFSMSKRKKTTLRHYCQADCDVIKIDIQCLVQGDVVLECVHLDLDPEREVMMFRVMF 300
Query: 300 NTAFIRSNILMLNSENLDILWDSKERYPKGFRAEVLFGDVESISPPRAPTSILNGEEKGG 359
NTAFIRSNILMLNSENLDILWDSKERYPKGFRAEVLFGD ESISPP+APT+ILNGEEKGG
Sbjct: 301 NTAFIRSNILMLNSENLDILWDSKERYPKGFRAEVLFGDAESISPPKAPTTILNGEEKGG 360
Query: 360 LPIEAFSRVRELFSGVEWVDNSD--ALWLLKQLSVFSDVKEFTRMQDRGSSYTSPVDSEE 417
LPIEAFSRV+ELFSGVEWVDN++ ALWLLKQLSV +D +EF+R+Q++ SSYTSP+DSEE
Sbjct: 361 LPIEAFSRVQELFSGVEWVDNNEDAALWLLKQLSVLTDAREFSRLQNKSSSYTSPIDSEE 420
Query: 418 ENNASSAGDSLDEAFDVFPEPLVDTKKLLLSNAG--DSVTSLSKNEGPHDVILVSEPIDQ 475
E NASS DS DEAFD+ P+ D+ L + + G DS +L E P Q
Sbjct: 421 EYNASSTADSSDEAFDLNPKNSADSVLLPIESGGLPDSGNAL---ESPA----------Q 467
Query: 476 VSNETVLSSLHQQ 488
S ETV SSLHQQ
Sbjct: 468 FSLETVPSSLHQQ 480
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225427486|ref|XP_002263093.1| PREDICTED: uncharacterized protein LOC100264917 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449453312|ref|XP_004144402.1| PREDICTED: formin-like protein 14-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296088480|emb|CBI37471.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449506096|ref|XP_004162651.1| PREDICTED: formin-like protein 14-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|186479105|ref|NP_174461.3| formin-like protein 14 [Arabidopsis thaliana] gi|166215071|sp|Q9C6S1.3|FH14_ARATH RecName: Full=Formin-like protein 14; Short=AtFH14 gi|332193274|gb|AEE31395.1| formin-like protein 14 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|302595094|gb|ADL59580.1| type II formin [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357484593|ref|XP_003612584.1| Formin-like protein, partial [Medicago truncatula] gi|355513919|gb|AES95542.1| Formin-like protein, partial [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|12321294|gb|AAG50715.1|AC079041_8 unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356508230|ref|XP_003522862.1| PREDICTED: uncharacterized protein LOC100809152 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1052 | ||||||
| TAIR|locus:2034471 | 1230 | AFH14 "Formin Homology 14" [Ar | 0.436 | 0.373 | 0.725 | 2.1e-254 | |
| TAIR|locus:2160329 | 722 | AT5G07770 [Arabidopsis thalian | 0.127 | 0.185 | 0.561 | 3.1e-33 | |
| TAIR|locus:2177801 | 464 | FH19 "formin homolog 19" [Arab | 0.129 | 0.293 | 0.456 | 5.9e-23 | |
| TAIR|locus:2009869 | 299 | AT1G42980 "AT1G42980" [Arabido | 0.065 | 0.230 | 0.685 | 1.2e-18 | |
| UNIPROTKB|E7ERH1 | 780 | TNS1 "Tensin-1" [Homo sapiens | 0.221 | 0.298 | 0.268 | 1.8e-10 | |
| UNIPROTKB|Q9GLM4 | 1715 | TNS1 "Tensin-1" [Bos taurus (t | 0.221 | 0.135 | 0.272 | 3.9e-10 | |
| UNIPROTKB|E1BNT5 | 1767 | TNS1 "Tensin-1" [Bos taurus (t | 0.221 | 0.131 | 0.272 | 4.1e-10 | |
| UNIPROTKB|E9PGF5 | 1714 | TNS1 "Tensin-1" [Homo sapiens | 0.221 | 0.135 | 0.268 | 5e-10 | |
| UNIPROTKB|E9PF55 | 1721 | TNS1 "Tensin-1" [Homo sapiens | 0.221 | 0.135 | 0.268 | 5.1e-10 | |
| UNIPROTKB|Q9HBL0 | 1735 | TNS1 "Tensin-1" [Homo sapiens | 0.221 | 0.134 | 0.268 | 5.1e-10 |
| TAIR|locus:2034471 AFH14 "Formin Homology 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1822 (646.4 bits), Expect = 2.1e-254, Sum P(3) = 2.1e-254
Identities = 344/474 (72%), Positives = 394/474 (83%)
Query: 1 MSLLSRFFYKRPPDGLLEFIERVYVFDSCFSTEVVPDGMYQLYLHEILTELHEEFPDSAF 60
MSLLSRFFYKRPPDGLLEF +RVYVFDSCF TEV+ D +YQ++LHE++ +LHEEFP+S+F
Sbjct: 1 MSLLSRFFYKRPPDGLLEFADRVYVFDSCFCTEVLADSLYQIFLHEVINDLHEEFPESSF 60
Query: 61 LAFNFREGEKQSEFAEILCEYDVTVLDYPRQYEGCPLLPMSLIQHFLRVCEHWLLLGDHQ 120
LAFNFREGEK+S FAE LCEYDVTVL+YPRQYEGCP+LP+SLIQHFLRVCE WL G+ Q
Sbjct: 61 LAFNFREGEKKSVFAETLCEYDVTVLEYPRQYEGCPMLPLSLIQHFLRVCESWLARGNRQ 120
Query: 121 NVILLHSERGGWPXXXXXXXXXXIFRKLHSGERRTLEIVHREAPKGFLQLLSPLNPFPSQ 180
+VILLH ERGGWP IFRK+HSGERRTLEIVHREAPKG LQLLSPLNPFPSQ
Sbjct: 121 DVILLHCERGGWPLLAFILASFLIFRKVHSGERRTLEIVHREAPKGLLQLLSPLNPFPSQ 180
Query: 181 LRYLQYVARRNITPEWPPPERALSLDCVILRAIPNFDAQNGCRPIIRIFGRNFRSKGGLS 240
LRYLQYVARRNI EWPPPERALSLDCVI+R IPNFD+Q+GCRPIIRIFGRN+ SK GLS
Sbjct: 181 LRYLQYVARRNINSEWPPPERALSLDCVIIRGIPNFDSQHGCRPIIRIFGRNYSSKSGLS 240
Query: 241 TQMIFSMSKKRKTLRHYRQADCDVIKIDIQCLVQGDVVLECVHLDLDPEREVMMFRVMFN 300
T+M++SMS K+K LRHYRQA+CDVIKIDIQC VQGDVVLECVH+DLDPEREVMMFRVMFN
Sbjct: 241 TEMVYSMSDKKKPLRHYRQAECDVIKIDIQCWVQGDVVLECVHMDLDPEREVMMFRVMFN 300
Query: 301 TAFIRSNILMLNSENLDILWDSKERYPKGFRAEVLFGDVESISPPRAPTSILNGEEKGGL 360
TAFIRSNILMLNS+NLDILW++K+ YPKGFRAEVLFG+VE+ SP + PT I+NG+E GGL
Sbjct: 301 TAFIRSNILMLNSDNLDILWEAKDHYPKGFRAEVLFGEVENASPQKVPTPIVNGDETGGL 360
Query: 361 PIEAFSRVRELFSGVEWVDNSD--ALWLLKQLSVFSDVKEFTRMQDRGSSYTSPVDSEEE 418
PIEAFSRV+ELFSGV+ +N D ALWLLKQL+ +D KEFTR + +GS Y + DSEEE
Sbjct: 361 PIEAFSRVQELFSGVDLAENGDDAALWLLKQLAAINDAKEFTRFRHKGSFYFNSPDSEEE 420
Query: 419 NNASSAGDSLDEAFDVFPEPLV-------DTKKLLLSNAGDSVTSLSKNEGPHD 465
N SSA DS DE F+ P + DT + LS A +S +E PH+
Sbjct: 421 TNTSSAADSSDEGFEAIQRPRIHIPFDNDDTDDITLSVAHES------SEEPHE 468
|
|
| TAIR|locus:2160329 AT5G07770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2177801 FH19 "formin homolog 19" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009869 AT1G42980 "AT1G42980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ERH1 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GLM4 TNS1 "Tensin-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BNT5 TNS1 "Tensin-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PGF5 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PF55 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9HBL0 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1052 | |||
| pfam10409 | 129 | pfam10409, PTEN_C2, C2 domain of PTEN tumour-suppr | 2e-43 | |
| pfam02181 | 372 | pfam02181, FH2, Formin Homology 2 Domain | 5e-43 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-36 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-33 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-29 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-29 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-27 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-25 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-25 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-23 | |
| smart00498 | 392 | smart00498, FH2, Formin Homology 2 Domain | 1e-21 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-21 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 8e-20 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 1e-19 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 8e-18 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-14 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-14 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-14 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 5e-14 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-13 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-13 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-13 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 4e-13 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-13 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-13 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-13 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 6e-13 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-12 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 4e-12 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 3e-11 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 4e-11 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 5e-11 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 8e-11 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 8e-11 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-10 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-10 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-10 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-10 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-10 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 2e-10 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-10 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-10 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-10 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 4e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-10 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 6e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-10 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 1e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-09 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-09 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-09 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-09 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-09 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-09 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 5e-09 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-08 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-08 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-08 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-08 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 2e-08 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-08 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 2e-08 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 2e-08 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-08 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 3e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-08 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 4e-08 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-08 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 4e-08 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 5e-08 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 5e-08 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 6e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-07 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-07 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-07 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 4e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-07 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 4e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 4e-07 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 4e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-07 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 5e-07 | |
| PRK08691 | 709 | PRK08691, PRK08691, DNA polymerase III subunits ga | 5e-07 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 7e-07 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 9e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 9e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-06 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 1e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-06 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 2e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-06 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 4e-06 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 4e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-06 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 4e-06 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 5e-06 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 6e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 6e-06 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 6e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 7e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 7e-06 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 7e-06 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 7e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 7e-06 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 7e-06 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 7e-06 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 7e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-06 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 8e-06 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 8e-06 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 9e-06 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 9e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-05 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 1e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 2e-05 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 2e-05 | |
| pfam06070 | 777 | pfam06070, Herpes_UL32, Herpesvirus large structur | 2e-05 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 3e-05 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 3e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-05 | |
| PRK08691 | 709 | PRK08691, PRK08691, DNA polymerase III subunits ga | 3e-05 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 3e-05 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 3e-05 | |
| pfam06003 | 264 | pfam06003, SMN, Survival motor neuron protein (SMN | 3e-05 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 3e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 4e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 4e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 4e-05 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 4e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 4e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-05 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 4e-05 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 5e-05 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 5e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 6e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 6e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 6e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 6e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 6e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 9e-05 | |
| PHA03377 | 1000 | PHA03377, PHA03377, EBNA-3C; Provisional | 9e-05 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 9e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-04 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 1e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 1e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 1e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 1e-04 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 1e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 2e-04 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 2e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 2e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 2e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 2e-04 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 2e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 2e-04 | |
| PHA03377 | 1000 | PHA03377, PHA03377, EBNA-3C; Provisional | 2e-04 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 2e-04 | |
| PRK11901 | 327 | PRK11901, PRK11901, hypothetical protein; Reviewed | 2e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-04 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 3e-04 | |
| pfam06070 | 777 | pfam06070, Herpes_UL32, Herpesvirus large structur | 3e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 3e-04 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 3e-04 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 4e-04 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 4e-04 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 4e-04 | |
| pfam08580 | 626 | pfam08580, KAR9, Yeast cortical protein KAR9 | 4e-04 | |
| PRK12799 | 421 | PRK12799, motB, flagellar motor protein MotB; Revi | 4e-04 | |
| PRK12727 | 559 | PRK12727, PRK12727, flagellar biosynthesis regulat | 4e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 4e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-04 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 5e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 5e-04 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 5e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 6e-04 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 6e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 6e-04 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 6e-04 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 6e-04 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 6e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 7e-04 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 7e-04 | |
| PHA03377 | 1000 | PHA03377, PHA03377, EBNA-3C; Provisional | 7e-04 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 7e-04 | |
| pfam03326 | 500 | pfam03326, Herpes_TAF50, Herpesvirus transcription | 7e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 8e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 8e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 9e-04 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 9e-04 | |
| pfam05110 | 1154 | pfam05110, AF-4, AF-4 proto-oncoprotein | 9e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.001 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.001 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.001 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.001 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.001 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.001 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 0.001 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 0.001 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 0.001 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 0.001 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.001 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.001 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.001 | |
| pfam05110 | 1154 | pfam05110, AF-4, AF-4 proto-oncoprotein | 0.001 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 0.001 | |
| PHA03201 | 318 | PHA03201, PHA03201, uracil DNA glycosylase; Provis | 0.001 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 0.001 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 0.001 | |
| pfam10428 | 419 | pfam10428, SOG2, RAM signalling pathway protein | 0.001 | |
| pfam10428 | 419 | pfam10428, SOG2, RAM signalling pathway protein | 0.001 | |
| pfam13254 | 414 | pfam13254, DUF4045, Domain of unknown function (DU | 0.001 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.002 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.002 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 0.002 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.002 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.002 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.002 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.002 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.002 | |
| pfam03251 | 458 | pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd prote | 0.002 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 0.003 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.003 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.003 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.003 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 0.003 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 0.003 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 0.003 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.003 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.003 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.003 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.003 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.003 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 0.003 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 0.003 | |
| pfam10428 | 419 | pfam10428, SOG2, RAM signalling pathway protein | 0.003 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 0.003 | |
| pfam06409 | 350 | pfam06409, NPIP, Nuclear pore complex interacting | 0.003 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 0.003 | |
| pfam01044 | 850 | pfam01044, Vinculin, Vinculin family | 0.003 | |
| pfam12737 | 418 | pfam12737, Mating_C, C-terminal domain of homeodom | 0.003 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.004 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.004 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.004 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 0.004 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 0.004 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.004 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.004 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.004 | |
| pfam08580 | 626 | pfam08580, KAR9, Yeast cortical protein KAR9 | 0.004 | |
| PRK12727 | 559 | PRK12727, PRK12727, flagellar biosynthesis regulat | 0.004 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.004 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.004 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 0.004 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 0.004 | |
| PRK06305 | 451 | PRK06305, PRK06305, DNA polymerase III subunits ga | 0.004 | |
| PLN02712 | 667 | PLN02712, PLN02712, arogenate dehydrogenase | 0.004 |
| >gnl|CDD|220736 pfam10409, PTEN_C2, C2 domain of PTEN tumour-suppressor protein | Back alignment and domain information |
|---|
Score = 153 bits (388), Expect = 2e-43
Identities = 53/141 (37%), Positives = 73/141 (51%), Gaps = 12/141 (8%)
Query: 198 PPERALSLDCVILRAIPNFDAQNGCRPIIRIFGRNFRSKGGLSTQMIFSMSKKRKTLRHY 257
PP + L L +IL IPNF + GCRP IRI+ + + + S SKK + L+ Y
Sbjct: 1 PPPKPLFLKSIILHGIPNFKSGGGCRPYIRIYNND---------KKV-STSKKYEILKKY 50
Query: 258 RQADCDVIKIDIQCLVQGDVVLECVHLDLDPEREVMMFRVMFNTAFIRSNILMLNSENLD 317
+Q DC +I VQGDV++E H E MFR FNT+FI N L LD
Sbjct: 51 QQKDC-IILFPKGLPVQGDVLIEFYHKG-LKLSEEKMFRFWFNTSFIEDNRLTFPKNELD 108
Query: 318 ILWDSKERYPKGFRAEVLFGD 338
K+R+P F+ E++F +
Sbjct: 109 KADKDKKRFPPDFKVELVFSE 129
|
This is the C2 domain-like domain, in greek key form, of the PTEN protein, phosphatidyl-inositol triphosphate phosphatase, and it is the C-terminus. This domain may well include a CBR3 loop which means it plays a central role in membrane binding. This domain associates across an extensive interface with the N-terminal phosphatase domain DSPc (pfam00782) suggesting that the C2 domain productively positions the catalytic part of the protein onto the membrane. Length = 129 |
| >gnl|CDD|216919 pfam02181, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214697 smart00498, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236333 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236333 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177614 PHA03377, PHA03377, EBNA-3C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177614 PHA03377, PHA03377, EBNA-3C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237015 PRK11901, PRK11901, hypothetical protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219916 pfam08580, KAR9, Yeast cortical protein KAR9 | Back alignment and domain information |
|---|
| >gnl|CDD|183756 PRK12799, motB, flagellar motor protein MotB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|177614 PHA03377, PHA03377, EBNA-3C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|217495 pfam03326, Herpes_TAF50, Herpesvirus transcription activation factor (transactivator) | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|218440 pfam05110, AF-4, AF-4 proto-oncoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|218440 pfam05110, AF-4, AF-4 proto-oncoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|165468 PHA03201, PHA03201, uracil DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220749 pfam10428, SOG2, RAM signalling pathway protein | Back alignment and domain information |
|---|
| >gnl|CDD|220749 pfam10428, SOG2, RAM signalling pathway protein | Back alignment and domain information |
|---|
| >gnl|CDD|222010 pfam13254, DUF4045, Domain of unknown function (DUF4045) | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|217453 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd protein | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220749 pfam10428, SOG2, RAM signalling pathway protein | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|191511 pfam06409, NPIP, Nuclear pore complex interacting protein (NPIP) | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|216263 pfam01044, Vinculin, Vinculin family | Back alignment and domain information |
|---|
| >gnl|CDD|221745 pfam12737, Mating_C, C-terminal domain of homeodomain 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219916 pfam08580, KAR9, Yeast cortical protein KAR9 | Back alignment and domain information |
|---|
| >gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180523 PRK06305, PRK06305, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215382 PLN02712, PLN02712, arogenate dehydrogenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1052 | |||
| KOG2283 | 434 | consensus Clathrin coat dissociation kinase GAK/PT | 100.0 | |
| PF10409 | 134 | PTEN_C2: C2 domain of PTEN tumour-suppressor prote | 99.95 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 99.95 | |
| smart00498 | 432 | FH2 Formin Homology 2 Domain. FH proteins control | 99.86 | |
| PF02181 | 370 | FH2: Formin Homology 2 Domain; InterPro: IPR015425 | 99.82 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.65 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 99.62 | |
| KOG1925 | 817 | consensus Rac1 GTPase effector FHOS [Signal transd | 99.54 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.47 | |
| KOG1720 | 225 | consensus Protein tyrosine phosphatase CDC14 [Defe | 99.44 | |
| KOG1922 | 833 | consensus Rho GTPase effector BNI1 and related for | 99.39 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.18 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.17 | |
| KOG1719 | 183 | consensus Dual specificity phosphatase [Defense me | 99.1 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.04 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.03 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 99.01 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 98.98 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 98.93 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 98.77 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 98.73 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 98.73 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 98.46 | |
| KOG2836 | 173 | consensus Protein tyrosine phosphatase IVA1 [Signa | 98.27 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 98.2 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.11 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.07 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 97.94 | |
| KOG0790 | 600 | consensus Protein tyrosine phosphatase Corkscrew a | 97.8 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 97.78 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 97.72 | |
| KOG2386 | 393 | consensus mRNA capping enzyme, guanylyltransferase | 97.59 | |
| KOG0792 | 1144 | consensus Protein tyrosine phosphatase PTPMEG, con | 97.54 | |
| KOG1716 | 285 | consensus Dual specificity phosphatase [Defense me | 97.47 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 97.26 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 97.26 | |
| PLN02727 | 986 | NAD kinase | 97.24 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 97.16 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 97.07 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 97.04 | |
| KOG0791 | 374 | consensus Protein tyrosine phosphatase, contains f | 97.03 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 96.96 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 96.95 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 96.93 | |
| KOG1718 | 198 | consensus Dual specificity phosphatase [Defense me | 95.69 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 95.62 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 95.61 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 95.47 | |
| KOG0789 | 415 | consensus Protein tyrosine phosphatase [Signal tra | 94.64 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 94.63 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 94.46 | |
| KOG0793 | 1004 | consensus Protein tyrosine phosphatase [Signal tra | 94.41 | |
| KOG1572 | 249 | consensus Predicted protein tyrosine phosphatase [ | 94.41 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 93.41 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 92.87 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 89.74 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 84.8 |
| >KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.5e-57 Score=520.85 Aligned_cols=307 Identities=21% Similarity=0.351 Sum_probs=257.9
Q ss_pred hhhhccCCCCCceeeeeCcEEEEecCCCCCCCCcccccccHHHHHHHHhhhCCCCcEEEEeecCCCccchhhhhhcccCc
Q 001565 4 LSRFFYKRPPDGLLEFIERVYVFDSCFSTEVVPDGMYQLYLHEILTELHEEFPDSAFLAFNFREGEKQSEFAEILCEYDV 83 (1052)
Q Consensus 4 ~rr~~~rk~~LDLtYIT~RIiam~~~fPae~~~E~~YRN~i~dV~~~L~~~h~~~~y~V~NLs~~~~~s~~~~~~s~f~~ 83 (1052)
.||..+++.||||+|||+||||| +||++++ |+.|||+|+||+.||+++|++ ||+|||||.|+. |+..+|++
T Consensus 3 k~r~~~~~~DLDltYIT~rIIam--sfPa~~~-es~yRN~l~dV~~fL~s~H~~-~y~vyNL~~er~-----yd~~~f~g 73 (434)
T KOG2283|consen 3 KRRYNEGGFDLDLTYITSRIIAM--SFPAEGI-ESLYRNNLEDVVLFLDSKHKD-HYKVYNLSSERL-----YDPSRFHG 73 (434)
T ss_pred cchhhhccccccceeeeeeEEEE--eCCCCcc-hhhhcCCHHHHHHHHhhccCC-ceEEEecCcccc-----CCcccccc
Confidence 47888899999999999999999 8999999 889999999999999999998 999999995443 36789999
Q ss_pred EEeeCCCCCCCCCCChHHHHHHHHHHHHHHHhhCCCccEEEEEecCCCcchHHHHHHHHHHHhcCCccHHHHHHHHHHhc
Q 001565 84 TVLDYPRQYEGCPLLPMSLIQHFLRVCEHWLLLGDHQNVILLHSERGGWPLLAFLLASLLIFRKLHSGERRTLEIVHREA 163 (1052)
Q Consensus 84 ~V~~yP~~d~g~P~p~L~~L~~~c~~~~~WL~~d~~~NVvvVHCk~GkgRt~g~mia~yLly~~~~~~~~~Al~~~~k~~ 163 (1052)
+|..|+|.|||+| +|++|+.||++|++||++|++ ||||||||+||||+ |+||||||+|++++.++++||++|..+
T Consensus 74 ~V~~~~~~Dh~~P--~L~~l~~~c~~~~~WL~~d~~-nVvvvHCk~Gkgrt-g~~icA~L~~~~~~~ta~eald~~~~k- 148 (434)
T KOG2283|consen 74 RVARFGFDDHNPP--PLELLCPFCKSMDNWLSEDPK-NVVVVHCKAGKGRT-GVMICAYLIYSGISATAEEALDYFNEK- 148 (434)
T ss_pred ceeecCCCCCCCC--cHHHHHHHHHCHHHHHhcCcc-ceEEEEccCCCcce-EEEEeHHHHhhhhcCCHHHHHHHHhhh-
Confidence 9999999999998 899999999999999999999 99999999999998 999999999999999999999999622
Q ss_pred CccccccCCCCCCCchHHHHHHHHHHhhCCCCCCCCCC--ceeEEEEEEeecCccCC-CCccceEEEeeccCcccCCCCC
Q 001565 164 PKGFLQLLSPLNPFPSQLRYLQYVARRNITPEWPPPER--ALSLDCVILRAIPNFDA-QNGCRPIIRIFGRNFRSKGGLS 240 (1052)
Q Consensus 164 ~~~~~~~~s~~n~~PSQ~RYV~Yf~~ll~~~~~pp~~~--~l~L~~IiL~~iP~f~~-~~GcrP~l~Iy~~~~~~~~~~~ 240 (1052)
|+..+.+..+++|||+|||+||++++......++.+ .++|+.++|..||+|.+ .+||+++++||++
T Consensus 149 --R~~~~~~~~~~~PSq~RYv~Y~~~~l~~~~~~~~~~~~~~f~~~~~~~~ip~~~~~~~~~~~~~~v~~~--------- 217 (434)
T KOG2283|consen 149 --RFDEGKSKGVTIPSQRRYVGYFSRVLLNGPLPPRSNSCPLFLHSFILISIPNFNSSRDGCRPAFPVYQG--------- 217 (434)
T ss_pred --hccccccCCccCchhhHHHHHHHHHhhcCCcCcccccCceEeeeeeeeecCcccccCCCCCccceeeec---------
Confidence 233343344489999999999999654445567777 99999999999999544 4999999999998
Q ss_pred ccEEEeccccccccceecccCCcEEEEeecccccCCeEEEEEeCCCCC-------CcceeEEEEEeecccccC--CeEEE
Q 001565 241 TQMIFSMSKKRKTLRHYRQADCDVIKIDIQCLVQGDVVLECVHLDLDP-------EREVMMFRVMFNTAFIRS--NILML 311 (1052)
Q Consensus 241 ~~~lfst~~~~~~~r~y~~~d~~~i~i~i~~~V~GDV~I~~~h~~~~~-------~~~~~mFr~~FnT~FI~~--n~L~l 311 (1052)
.+.+|++..+. .++.|.. +++ |+|++++.++ ++|||.+... ..+...|.++|||+|+.. ..+.+
T Consensus 218 k~~~~~~~s~~-~~~~~~~-~g~-~~i~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 290 (434)
T KOG2283|consen 218 KKKVYSFSSDG-IMRLGEL-DGK-IVIPLGLRVD----VKCYHKRTSSGNRGILKDKEFKGCQIQFYTGPFPEDETVVRF 290 (434)
T ss_pred ceeeEEeccCC-ccccccc-ccc-eecccccccc----eEEEeeccccCCcceeeccccceEEEeccCCCccccceeeec
Confidence 47788888877 8888887 665 7899988887 9999976432 336678999999999874 45667
Q ss_pred ecCCCCccccccCCCCCCcEEEEEEecCCCCC
Q 001565 312 NSENLDILWDSKERYPKGFRAEVLFGDVESIS 343 (1052)
Q Consensus 312 ~k~eLD~~~~~k~~fp~dF~Vel~F~~~~~~~ 343 (1052)
.+.+++.. ...+.+..-|.+.+.-.+.....
T Consensus 291 ~~~~~~~~-~~~e~~~~~~~~~~~~~~~~~~~ 321 (434)
T KOG2283|consen 291 FQADLPIY-VSNEFVFNFFQVSLEVENTPNDD 321 (434)
T ss_pred ccccCCcc-ccccccccccceeeecccCcccc
Confidence 77777763 33466677777777654444333
|
|
| >PF10409 PTEN_C2: C2 domain of PTEN tumour-suppressor protein; InterPro: IPR014020 Tensins constitute an eukaryotic family of lipid phosphatases that are defined by the presence of two adjacent domains: a lipid phosphatase domain and a C2-like domain | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00498 FH2 Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >PF02181 FH2: Formin Homology 2 Domain; InterPro: IPR015425 Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [] | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1052 | ||||
| 2j1d_G | 483 | Crystallization Of Hdaam1 C-Terminal Fragment Lengt | 7e-07 | ||
| 2z6e_A | 419 | Crystal Structure Of Human Daam1 Fh2 Length = 419 | 8e-07 | ||
| 3n0a_A | 361 | Crystal Structure Of Auxilin (40-400) Length = 361 | 1e-06 |
| >pdb|2J1D|G Chain G, Crystallization Of Hdaam1 C-Terminal Fragment Length = 483 | Back alignment and structure |
|
| >pdb|2Z6E|A Chain A, Crystal Structure Of Human Daam1 Fh2 Length = 419 | Back alignment and structure |
| >pdb|3N0A|A Chain A, Crystal Structure Of Auxilin (40-400) Length = 361 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1052 | |||
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 1e-43 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 1e-41 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 6e-41 | |
| 3obv_E | 457 | Protein diaphanous homolog 1; autoinhibition, acti | 1e-38 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 9e-37 | |
| 1ux5_A | 411 | BNI1 protein; structural protein, FH2 actin cytosk | 1e-29 | |
| 1v9d_A | 340 | Diaphanous protein homolog 1; helix bundle, protei | 2e-28 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 4e-19 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 4e-17 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 8e-17 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 1e-16 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 2e-13 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 3e-11 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-18 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 5e-18 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-17 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-17 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 8e-17 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 1e-15 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-10 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-15 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-14 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-12 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-12 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-11 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-11 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-11 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-10 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-07 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 2e-10 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 2e-09 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 1e-08 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 4e-08 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 7e-08 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 8e-08 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 1e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 6e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-09 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 6e-09 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-09 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-08 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-08 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-08 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 4e-08 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-07 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-07 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-05 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-09 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 7e-09 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 8e-09 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 9e-09 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 5e-08 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 6e-08 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 6e-08 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-04 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-08 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 4e-08 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 5e-08 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 8e-08 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 8e-08 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 8e-08 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 1e-07 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-07 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 4e-07 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 6e-07 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 7e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 6e-08 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 3e-07 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 4e-07 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 1e-06 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 1e-06 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 1e-06 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 4e-06 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 7e-06 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 8e-06 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 3e-05 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 6e-05 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 5e-04 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 1e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-05 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 4e-05 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-05 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 3e-07 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 3e-07 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 5e-06 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 2e-05 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 2e-05 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 4e-05 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 8e-05 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 1e-04 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 3e-04 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 4e-04 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 9e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 8e-07 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 3e-06 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 9e-06 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 1e-05 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 5e-05 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 5e-05 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 7e-05 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 2e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 5e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 5e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 6e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 1e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 3e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 4e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 4e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 4e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 6e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 8e-04 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 1e-05 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 4e-05 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 2e-04 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 3e-05 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 5e-05 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 8e-05 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 2e-04 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 4e-05 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 3e-04 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 3e-04 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 6e-04 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 8e-04 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 5e-05 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 3e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 5e-05 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 7e-05 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 4e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 4e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 8e-04 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 6e-05 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 4e-04 | |
| 1zvo_C | 512 | Myeloma immunoglobulin D delta; immunoglobulin fol | 4e-04 | |
| 1zvo_C | 512 | Myeloma immunoglobulin D delta; immunoglobulin fol | 5e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 5e-04 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 6e-04 |
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 | Back alignment and structure |
|---|
Score = 162 bits (409), Expect = 1e-43
Identities = 73/360 (20%), Positives = 135/360 (37%), Gaps = 43/360 (11%)
Query: 21 ERVYVFDSCFSTEVVPDGMYQLYLHEILTELHEEFPDSAFLAFNFREGEKQSEFAEILCE 80
R+ V F + V G ++ + +I + L + + +N ++ +
Sbjct: 29 SRIIVM--SFPLDSVDIG-FRNQVDDIRSFL-DSRHLDHYTVYNLSPKSYRTA------K 78
Query: 81 YDVTVLDYPRQYEGCPLLPMSLIQHFLRVCEHWLLLGDHQNVILLHSERGGWPLLAFLLA 140
+ V + P L + R +WLL + +NV ++H G + L+
Sbjct: 79 FHSRVSECSWPIRQAPSL--HNLFAVCRNMYNWLLQ-NPKNVCVVHC-LDGRAASSILVG 134
Query: 141 SLLIFRKLHSGERRTLEIVHREAPKGFLQLLSPLNPFPSQLRYLQYVARRNITPEWPPPE 200
++ IF L+S + +++ + P L PS RYL Y+ + P
Sbjct: 135 AMFIFCNLYSTPGPAVRLLYAKRPGIGLS--------PSHRRYLGYMCDLLADKPYRPHF 186
Query: 201 RALSLDCVILRAIPNFD-AQNGCRPIIRIFGRNFRSKGGLSTQMIFSMSKKRKTLRHYRQ 259
+ L++ + + +P F+ +NGCRP + I++ + ++ YR
Sbjct: 187 KPLTIKSITVSPVPFFNKQRNGCRPYCDVLIGE---------TKIYTTCADFERMKEYRV 237
Query: 260 ADCDVIKIDIQCLVQGDVVLECVHLDLDPEREV-------MMFRVMFNTAFI--RSNILM 310
D I I + VQGDVV+ HL + +F++ F+T FI + +L
Sbjct: 238 QDG-KIFIPLSITVQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLK 296
Query: 311 LNSENLDILWDSKERYPKGFRAEVLFGDVESISPPRAPTSILNGEEKGGLPIEAFSRVRE 370
LD D E+YP+ F+ + + K P FS +E
Sbjct: 297 FTKPELDA-CDVPEKYPQLFQVTLDVELQPHDKVMELTPPWEHYCTKDVNPSILFSSHQE 355
|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 | Back alignment and structure |
|---|
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D Length = 457 | Back alignment and structure |
|---|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A Length = 483 | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A Length = 411 | Back alignment and structure |
|---|
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 Length = 340 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 512 | Back alignment and structure |
|---|
| >1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 512 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1052 | ||||
| d1d5ra1 | 141 | b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshph | 1e-31 | |
| d1v9da_ | 332 | a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 | 1e-25 | |
| d1ux5a_ | 411 | a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces | 2e-25 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 2e-14 |
| >d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 118 bits (298), Expect = 1e-31
Identities = 30/147 (20%), Positives = 45/147 (30%), Gaps = 26/147 (17%)
Query: 202 ALSLDCVILRAIPNFDAQNGCRPIIRIFGRNFRSKGGLSTQMIFSMSKKRKTLRHYRQAD 261
AL ++ IP F C P + I+S S T R
Sbjct: 5 ALLFHKMMFETIPMFS-GGTCNPQFVVCQ---------LKVKIYS-SNSGPTRRED---K 50
Query: 262 CDVIKIDIQCLVQGDVVLECVHLDLDPEREVMMFRVMFNTAFIRSN----------ILML 311
+ V GD+ +E H ++ MF NT FI +L L
Sbjct: 51 FMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEEVDNDKEYLVLTL 110
Query: 312 NSENLDILWDSK--ERYPKGFRAEVLF 336
+LD K + F+ ++ F
Sbjct: 111 TKNDLDKANKDKANRYFSPNFKVKLYF 137
|
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 332 | Back information, alignment and structure |
|---|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 411 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1052 | |||
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 100.0 | |
| d1d5ra1 | 141 | Pten tumor suppressor (Phoshphoinositide phosphata | 99.96 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.88 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.85 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.81 | |
| d1ux5a_ | 411 | Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.79 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.73 | |
| d1v9da_ | 332 | Diaphanous protein homolog 1, dia1 {Mouse (Mus mus | 99.54 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.17 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.0 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 98.69 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 98.61 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 98.57 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.39 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 97.95 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 97.89 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 97.88 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 97.83 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 97.74 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.64 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 97.63 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.59 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 97.51 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 97.46 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 97.42 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 97.33 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 94.18 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 93.28 |
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.6e-37 Score=279.66 Aligned_cols=171 Identities=18% Similarity=0.309 Sum_probs=151.7
Q ss_pred HHHCCCCCCCCEEEEECCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHCCCCCE
Q ss_conf 12003799996245508379970678899978300023599999998430999969999313797452344531014837
Q 001565 5 SRFFYKRPPDGLLEFIERVYVFDSCFSTEVVPDGMYQLYLHEILTELHEEFPDSAFLAFNFREGEKQSEFAEILCEYDVT 84 (1052)
Q Consensus 5 r~~~~rk~~lDLtyIT~RIivm~~~fPae~~~E~~yRN~i~dV~~~L~~~h~~~~y~V~NLs~~~~~~~~~~~~s~f~~~ 84 (1052)
|||.=...+|||+|||+||||| +||+++. |..|||++.+|+.+|+++|.+ +|+||||++++.+ +.+.|+.+
T Consensus 1 ~~~~~~~~~lDlt~It~riiv~--~~P~~~~-e~~~~~~i~~v~~~l~~~~~~-~~~v~nl~~~~~y-----~~~~~~~~ 71 (174)
T d1d5ra2 1 RRYQEDGFDLDLTYIYPNIIAM--GFPAERL-EGVYRNNIDDVVRFLDSKHKN-HYKIYNLCAERHY-----DTAKFNCR 71 (174)
T ss_dssp CCCCBTTTTBSEEEEETTEEEE--CCCBSSC-CTTCCCBHHHHHHHHHHHSSS-CEEEEEEESSCCC-----CTTSCSSC
T ss_pred CCCCCCCCCCCEEEEECCEEEE--ECCCCCC-HHHHCCCHHHHHHHHHHCCCC-CEEEEECCCCCCC-----CHHHCCCE
T ss_conf 9754478256614995899999--2899871-776538999999999750577-3789863567779-----85883974
Q ss_pred EEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCC
Q ss_conf 86377899999997289999999999999950998539999935799543789999999980388628899999998368
Q 001565 85 VLDYPRQYEGCPLLPMSLIQHFLRVCEHWLLLGDHQNVILLHSERGGWPLLAFLLASLLIFRKLHSGERRTLEIVHREAP 164 (1052)
Q Consensus 85 V~d~p~~d~g~P~p~L~~L~~~c~~i~~WL~~d~~~NVvvVHCk~Gkgrt~g~miaayLiy~~~~~~~~~AL~~~~k~~~ 164 (1052)
|.+++|.|+++| +++.|+.||+.+++|+..+.+ |+|+|||++|+||+ |+++||||+|++.+.++++|+++|..++.
T Consensus 72 ~~~~~~~d~~~P--s~~~i~~~~~~~~~~~~~~~~-~~v~VHC~~G~gRS-g~~~~ayL~~~~~~~~~~~al~~~~~~R~ 147 (174)
T d1d5ra2 72 VAQYPFEDHNPP--QLELIKPFCEDLDQWLSEDDN-HVAAIHCKAGKGRT-GVMICAYLLHRGKFLKAQEALDFYGEVRT 147 (174)
T ss_dssp EEEEEECTTSCC--CHHHHHHHHHHHHHHHTTTSC-SEEEEECSSSSHHH-HHHHHHHHHHHTSCSSHHHHHHHHHHHHC
T ss_pred EEEECCCCCCCC--CHHHHHHHHHHHHHHHCCCCC-CEEEEEECCCCCHH-HHHHHHHHHHHCCCCCHHHHHHHHHHHHC
T ss_conf 999378899996--999999999999987503899-87999959991351-99999999997178999999999999857
Q ss_pred CCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf 33013488999883588999999994079
Q 001565 165 KGFLQLLSPLNPFPSQLRYLQYVARRNIT 193 (1052)
Q Consensus 165 ~~~~q~~s~~n~~PSQ~RYv~Yf~~l~~~ 193 (1052)
.+- .++ .+|||+|||+||++++++
T Consensus 148 ~~~-~~v----~~psQ~ryl~yf~~~L~~ 171 (174)
T d1d5ra2 148 RDK-KGV----TIPSQRRYVYYYSYLLKN 171 (174)
T ss_dssp SSS-CSS----CSHHHHHHHHHHHHHHHH
T ss_pred CCC-CCC----CCHHHHHHHHHHHHHHHH
T ss_conf 899-987----899999999999999986
|
| >d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|