Citrus Sinensis ID: 001573

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050-

MDLPRVKRLKVSRGEDDYMPGNIIEIELHNFMTFDHLICKPGSRLNLVIGPNGSGKSSLVCAIALALGGDTQLLGRATSIGAYVKRGEESGYIKISLRGDTKEEHLTIMRKIDTRNKSEWFFNGKVVPKGEVLEITKRFNIQVNNLTQFLPQDRVCEFAKLSPVKLLEETEKAVGDPQLPVQHCALVEKSSKLKTIECTVKRNGDTLNQLKALNVEQEKDVERVRQRAELLEKVESMKKKLPWLKYDMKKAEYIAAKEQEKDAKKKLDEAANTLHEFSKPIEGKKQEKAILDGDCKKLSSLINENSKRRMDFLEKVDQVGVQVQGKYKEMQELRRQEQSRQQRILKAREELAAAELDLQTVPAYEPPHDKIEKLGSQILELGVQANQKRLQKSEKEKILNQNKLTLRQCSDRLKDMEDKNNKLLHALRNSGAENIFEAYCWLQQHRHELNKEAYGPVLLEVNVSNRAHANYLEDHVGHYIWKSFITQDAGDRDFLAKNLKPFDVPILNYVSNESSRKEPFQISEEMRALGISARLDQVFDAPHAVKEVLISQFGLDSSYIGSKETDQKADNVAKLGILDFWTPENHYRWSISRYGGHVSASVEPVNQSRLLLCSVDGNEIERLRSKKKKLEESVDELEESLKSMQTEQRLIEDEAAKLQKEREEIINIVQIEKRKRREMENHINLRKRKLESIEKEDDINTALAKLVDQAADLNIQQFKYAIEIKNLLVEIVSCKWSYAEKHMASIEFDAKIRELEFNLKQHEKLALQASLHYEDCKKEVEHCRKHLSDAKRQAESIAFITPELEKEFLEMPTTIEELEAAIQDNISQANSIFFLNQNILQEYEHRQRQIEDLSTKQEADKKELKRFLAEIDALKEKWLPTLRNLVAQINETFSRNFQEMAVAGEVSLDEHESDFDKFGILIKVKFRQSGQLEVLSAHHQSGGERSVSTILYLVSLQDLTNCPFRVVDEINQGMDPINERKMFQQLVRAASQPNTPQCFLLTPKLLPDLEYSEACSILNIMNGPWIEQPSKVWSSGECWGTVTGLVGESRC

cccccccccccccccccccccCEEEEEEEcccccccEEEccccccEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEccccccEEEEEEEEEccccEEEEEccccccHHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHccccccccccccccccccccccccHHHHHHccccccHHHcccccHHHHHHHHHHHcccCEECccHHHHHHHHHHccccccEEEcccccEEEEEEECccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHcccc

*****************YMPGNIIEIELHNFMTFDHLICKPGSRLNLVIGPNGSGKSSLVCAIALALGGDTQLLGRATSIGAYVKRGEESGYIKISLRGDTKEEHLTIMRKIDTRNKSEWFFNGKVVPKGEVLEITKRFNIQVNNLTQFLPQDRVCEFAKLSPVKLLEETEKAVGDPQLPVQHCALVEKSSKLKTIECTVKRNGDTLNQL****************RAELLEKVESMKKKLPWLKYDMKKAEYIA***********************************************************************************************************************************************************************LLHALRNSGAENIFEAYCWLQQHRHELNKEAYGPVLLEVNVSNRAHANYLEDHVGHYIWKSFITQDAGDRDFLAKNLKPFDVPILNYVS***************RALGISARLDQVFDAPHAVKEVLISQFGLDSSYIGSKETDQKADNVAKLGILDFWTPENHYRWSISRYGGHVSASVEPVNQSRLLLCSV*************************************************IINIVQ****************************INTALAKLVDQAADLNIQQFKYAIEIKNLLVEIVSCKWSYAEKHMASIEFDAKIRELEFNLKQHEKLALQASLHYEDCKKEVEHCRKHLSDA*R*AESIAFITPELEKEFLEMPTTIEELEAAIQDNISQANSIFFLNQNILQEYEHRQRQIE************LKRFLAEIDALKEKWLPTLRNLVAQINETFSRNFQEMAVAGEVSLDEHESDFDKFGILIKVKFRQSGQLEVL*********RSVSTILYLVSLQDLTNCPFRVVDEINQGMDPINERKMFQQLVRAASQPNTPQCFLLTPKLLPDLEYSEACSILNIMNGPWIEQPSKVWSSGECWGTVTGLV*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDLPRVKRLKVSRGEDDYMPGNIIEIELHNFMTFDHLICKPGSRLNLVIGPNGSGKSSLVCAIALALGGDTQLLGRATSIGAYVKRGEESGYIKISLRGDTKEEHLTIMRKIDTRNKSEWFFNGKVVPKGEVLEITKRFNIQVNNLTQFLPQDRVCEFAKLSPVKLLEETEKAVGDPQLPVQHCALVEKSSKLKTIECTVKRNGDTxxxxxxxxxxxxxxxxxxxxxxxxxxxxESMKKKLPWLKYDMKKAExxxxxxxxxxxxxxxxxxxxxLHEFSKPIEGKKQEKAILDGDCKKLSSLINENSKRRMDFLEKVDQVGVQVQGKYKExxxxxxxxxxxxxxxxxxxxxLAAAELDLQTVPAYEPPHDKIEKLGSQILELGVQANQKRLQKSEKEKIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNIFEAYCWLQQHRHELNKEAYGPVLLEVNVSNRAHANYLEDHVGHYIWKSFITQDAGDRDFLAKNLKPFDVPILNYVSNESSRKEPFQISEEMRALGISARLDQVFDAPHAVKEVLISQFGLDSSYIGSKETDQKADNVAKLGILDFWTPENHYRWSISRYGGHVSASVEPVNQSRLLLCSVDGNExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDINTALAKLVDQAADLNIQQFKYAIEIKNLLVEIVSCKWSYAEKHMASIEFDAKIRELEFNLKQHEKLALQASLHxxxxxxxxxxxxxxxxxxxxxAESIAFITPELEKEFLEMPTTIEELEAAIQDNISQANSIFFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWLPTLRNLVAQINETFSRNFQEMAVAGEVSLDEHESDFDKFGILIKVKFRQSGQLEVLSAHHQSGGERSVSTILYLVSLQDLTNCPFRVVDEINQGMDPINERKMFQQLVRAASQPNTPQCFLLTPKLLPDLEYSEACSILNIMNGPWIEQPSKVWSSGECWGTVTGLVGESRC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Structural maintenance of chromosomes protein 5	Core component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Required for recruitment of telomeres to PML nuclear bodies. Required for sister chromatid cohesion during prometaphase and mitotic progression; the function seems to be independent of SMC6.	probable	Q8IY18
Structural maintenance of chromosomes protein 5	Core component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination and mediates sumoylation of shelterin complex (telosome) components. Required for sister chromatid cohesion during prometaphase and mitotic progression; the function seems to be independent of SMC6.	probable	Q8CG46
Structural maintenance of chromosomes protein 5	Core component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination and mediates sumoylation of shelterin complex (telosome) components. Required for recruitment of telomeres to PML nuclear bodies. Required for sister chromatid cohesion during prometaphase and mitotic progression; the function seems to be independent of SMC6.	probable	Q5ZJY5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W1W, chain A
Confidence level:probable
Coverage over the Query: 21-69,80-170
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 670-736
View the alignment between query and template
View the model in PyMOL

Template: 3AUY, chain A
Confidence level:probable
Coverage over the Query: 23-316
View the alignment between query and template
View the model in PyMOL

Template: 3KTA, chain B
Confidence level:probable
Coverage over the Query: 883-1020
View the alignment between query and template
View the model in PyMOL

Template: 3EUJ, chain A
Confidence level:probable
Coverage over the Query: 21-230,248-294,308-319,340-351
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 670-736
View the alignment between query and template
View the model in PyMOL