Citrus Sinensis ID: 001639

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------104
MPRRRDDDDDEMDAEEDEYDEQVMDDEIDEEEEEEDDRSSRKRRRSQFIDDVAEEDDEEEEEDYDDDEDYGGGGGAARKPKAKRRSGSEFFDLEAQVDSDEEEDEEEGEDDFIVDGGAELPDEDGGRGIHRRPLLPREDEQEDVEALERRIQARYARSSHTEYDEETTDVEQQALLPSVRDPKLWMVKCAIGREREAAVCLMQKCIDKGSELQIRSVIALDHLKNYIYIEADKEAHVKEACKGLRNIYSQKVMLVPIREMTDVLAVESKAIDLSRDTWVRMKIGNYKGDLAKVVDVDNVRQRVTVKLIPRIDLQALANKLEGREVAKKKPFVPPPRFMNVDEARELHIRVERRRDPMTGDYFENIGGMLFKDGFLYKTVSMKSISAQNIQPTFDELEKFRTPGENGESDIASLSTLFANRKKGHFMKGDAVIVIKGDLKNLKGWVEKVDEENVHIRPEMKGLPKTLAVNSKELCKYFEPGNHVKVVSGTQAGATGMVLKVEQHVLIILSDTTKEDIRVFADDVVESSEVTTGITKIGDYELRDLVLLDNNSFGVIIRVESEAFQVLKGVPDRPEVALVKLREIKCKLEKKSNVQDRNKNTVAVKDVVRIVEGPCKGKQGPVEHIYRGILFIHDRHHLEHAGFICAKSSSCVVVGGSRANGDRNGDAYSRFNSLRTPPRIPQSPGRYSRGGPPAGGRNRGGRGGHDALVGTTVKVRLGPYKGYRGRVVDVKGQSVRVELESQMKVVTVDRSMISDNVVVSTPYRDTPRYGMGSETPMHPSRTPLHPYMTPMRDAGATPIHDGMRTPMRDRAWNPYTPMSPPRDNWEDGNPGSWGTSPQYQPGSPPSRAYEAPTPGSGWASTPGGNYSDAGTPRDSSSTYVNAPSPYLPSTPGGQPMTPNSASYLPGTPGGQPMTPGTGGLDAMSPVIGADNEGPWFMPDILVRRSGEESVVGVIREVLPDGSCRVVLGSSGNGDTITALPNEIEIVPPRKTDKIKIMGGPHRGATGKLIGVDGTDGIVKVDVSLDVKILDMAILAKLAQP
cccccccccccccccccccccccccccccccHHcccccccHHHHcccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccccccccccEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccEEEEEEccHHHHHHHHHHcccEEccEEEEEcHHHHHccccccccccccccccEEEEEccccccccEEEEEECccccEEEEEEEEcccHHHHHHHccccccccccccccccccccHHHHHHccccEEEccccccccEEEEEccCEEEccEEEEEEEcccEEEccccccHHHHHHcccccccccccHHHHHHHHHcccccccccccEEEEEcccccccEEEEEEECccEEEEECcccccccEEEEcccccEEEcccccEEEEEEccccccEEEEEEEEccEEEEEEcccccEEEEEcccccccccccccccccccEEEEEEEEEccccEEEEEEEccccEEEEccccccccEEEEcHHHHHHccccccccccccccEEEcccEEEEEcccccccCEEEEEEEccEEEEEEccEEcccCEEEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccEEEECcccEEEEEEccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccEEEEEEEccccEEEEEEcccccccEEEcccccCEEccccccccEEEEcccccccEEEEEEECcccEEEEEcccccEEEEcHHHHHccccc
*******************************************************************************************DLE*QVDS***********DFIVD************************************************************LPSVRDPKLWMVKCAIGREREAAVCLMQKCIDKGSELQIRSVIALDHLKNYIYIEADKEAHVKEACKGLRNIYSQKVMLVPIREMTDVLAVESKAIDLSRDTWVRMKIGNYKGDLAKVVDVDNVRQRVTVKLIPRIDLQAL********************FMNVDEARELHIRVERRRDPMTGDYFENIGGMLFKDGFLYKTVSMKSISAQNIQPTFDELEKFRTPGENGE*****LSTLFANRKKGHFMKGDAVIVIKGDLKNLKGWVEKVDEENVHIRPEMKGLPKTLAVNSKELCKYFEPGNHVKVVSGTQAGATGMVLKVEQHVLIILSDTTKEDIRVFADDVVESSEVTTGITKIGDYELRDLVLLDNNSFGVIIRVESEAFQVLKGVPDRPEVALVKLREIKCKLEK*******NKNTVAVKDVVRIVEGPCKGKQGPVEHIYRGILFIHDRHHLEHAGFICAKSSSCVVVGG**************************************************ALVGTTVKVRLGPYKGYRGRVVDVKGQSVRVELESQMKVVTVDRSMIS***************************************************************************************************************************************************************************VIGADNEGPWFMPDILVRRSGEESVVGVIREVLPDGSCRVVLGSSGNGDTITALPNEIEIVPPRKTDKIKIMGGPHRGATGKLIGVDGTDGIVKVDVSLDVKILDMAILAKLAQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRRRDDDDDEMDAEEDEYDEQVMDDEIDEEEEEEDDRSSRKRRRSQFIDDVAEEDDEEEEEDYDDDEDYGGGGGAARKPKAKRRSGSEFFDLEAQVDSDEEEDEEEGEDDFIVDGGAELPDEDGGRGIHRRPLLPxxxxxxxxxxxxxxxxxxxxxSSHTEYDEETTDVEQQALLPSVRDPKLWMVKCAIGREREAAVCLMQKCIDKGSELQIRSVIALDHLKNYIYIEADKEAHVKEACKGLRNIYSQKVMLVPIREMTDVLAVESKAIDLSRDTWVRMKIGNYKGDLAKVVDVDNVRQRVTVKLIPRIDLQALANKLEGREVAKKKPFVPPPRFMNVDEARELHIRVERRRDPMTGDYFENIGGMLFKDGFLYKTVSMKSISAQNIQPTFDELEKFRTPGENGESDIASLSTLFANRKKGHFMKGDAVIVIKGDLKNLKGWVEKVDEENVHIRPEMKGLPKTLAVNSKELCKYFEPGNHVKVVSGTQAGATGMVLKVEQHVLIILSDTTKEDIRVFADDVVESSEVTTGITKIGDYELRDLVLLDNNSFGVIIRVESEAFQVLKGVPDRPEVALVKLREIKCKLEKKSNVQDRNKNTVAVKDVVRIVEGPCKGKQGPVEHIYRGILFIHDRHHLEHAGFICAKSSSCVVVGGSRANGDRNGDAYSRFNSLRTPPRIPQSPGRYSRGGPPAGGRNRGGRGGHDALVGTTVKVRLGPYKGYRGRVVDVKGQSVRVELESQMKVVTVDRSMISDNVVVSTPYRDTPRYGMGSETPMHPSRTPLHPYMTPMRDAGATPIHDGMRTPMRDRAWNPYTPMSPPRDNWEDGNPGSWGTSPQYQPGSPPSRAYEAPTPGSGWASTPGGNYSDAGTPRDSSSTYVNAPSPYLPSTPGGQPMTPNSASYLPGTPGGQPMTPGTGGLDAMSPVIGADNEGPWFMPDILVRRSGEESVVGVIREVLPDGSCRVVLGSSGNGDTITALPNEIEIVPPRKTDKIKIMGGPHRGATGKLIGVDGTDGIVKVDVSLDVKILDMAILAKLAQP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative transcription elongation factor SPT5 homolog 1 May regulate transcription elongation by RNA polymerase II. May enhance transcriptional pausing at sites proximal to the promoter, which may in turn facilitate the assembly of an elongation competent RNA polymerase II complex.confidentQ9STN3
Transcription elongation factor SPT5 Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates transcription elongation by RNA polymerase II. DSIF enhances transcriptional pausing at sites proximal to the promoter, which may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF may also promote transcriptional elongation within coding regions. DSIF is required for the transcriptional induction of heat shock response genes and regulation of genes which control anterior-posterior patterning during embryonic development.probableQ9V460
Transcription elongation factor SPT5 Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites.probableO55201

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P8B, chain B
Confidence level:confident
Coverage over the Query: 182-329
View the alignment between query and template
View the model in PyMOL
Template: 2EXU, chain A
Confidence level:confident
Coverage over the Query: 148-267
View the alignment between query and template
View the model in PyMOL
Template: 2DO3, chain A
Confidence level:confident
Coverage over the Query: 464-528
View the alignment between query and template
View the model in PyMOL
Template: 2E70, chain A
Confidence level:probable
Coverage over the Query: 704-754
View the alignment between query and template
View the model in PyMOL
Template: 2CKK, chain A
Confidence level:probable
Coverage over the Query: 928-1022
View the alignment between query and template
View the model in PyMOL
Template: 2E6Z, chain A
Confidence level:probable
Coverage over the Query: 424-476
View the alignment between query and template
View the model in PyMOL
Template: 1DX0, chain A
Confidence level:probable
Coverage over the Query: 830-834
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3h0g, chain Aprobable Alignment | Template Structure