Citrus Sinensis ID: 001684

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030

MEETADESNANKKCNNNNNTTNSKTRTFRGSANTNPHRHQYQYQYQYQYQYQQHHQLWQYSNHFGFCNQNQYQNYYPALLPLPPTIPLQLALAPPLPQNQSFVSKTHLQKPSCKLHNPSLATSSDTHAHVVNISPEGLCRRNKVAVKGNDGRRITGAKTQALVAARRPDAGGVEGAVISLLANHFLVQLDPSQRIFHYNVEMSPSPSKEVARLIKQKLVEENSSMLSGAYPAFDGRKNIYSPVEFENDRLEFFVSLPIPTSKSVLPSGELKELIHKQHQLKLFRINIKLVSKYDGKELSRYLSKEDNDWIPLPQDYLHALDVVLRENPSEKCIPVGRSLYSSSMGGAKEIGGGAVGLRGFFQSLRPTQQGLSLNVDSSVSAFHESVGVIPYLQKRLEFLKDLSQRKTRGLSGDQKKEVERALKNIRVFVCHRETVQRYRVYGLTEEVTENLWFADRDGKNIRLLSYFKDHYNYNIQFRNLPCLQISRSKPCYLPMELCMICEGQKFLGKLSDDQTARILKMGCQRPKERKAMIDGVMRGPVGPTSGNQGREFKLHVSREMTRLNGRILQPPKLKLGDGGHIRDLVPCRHDRQWNFLESHVFEGTRIERWALLSFGGSHDQKSAIPKFICQLSQRCEQLGIFLNKSTIISPQFEQTHVLNNVSLLESKLKKIHEAASNNLQLLICVMERKHKGYADLKRIAETSVGVVSQCCLYSNLGKLSSQFLANLALKINAKVGGCTVALYNSLPSQIPRLFFPDEPVIFMGADVTHPHPLDDFSPSVAAVVGSMNWPAANKYASRMRSQTHRQEIIQDLGVMVGELLDDFYHELNKLPRRIIFFRDGVSETQFYKVLQEELQSIREACSRFPGYSPPITFVVVQKRHHTRLFPYDNDPSSAHNQSSDENIPPGTVVDTVITHPREFDFYLCSHWGVKGTSRPTHYHILWDDNKFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRGRLYLERSESATLMGSSSAICRAAPPKAAPLPKLSENVKKLMFYC

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEcccccEEEEEEEEcccccHHHHHHHHHHHHHHHccccccccCCccccccEEcccccccccEEEEEEccccccccccccccHHHHHHccccccEEEEEEEEEEEEcHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccccCCccccEEEECcCEEECcccccCEEEEEEccccEEEccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccEEEEEccccccEEEEcccccccccccccccccccEEEHHHHHHHHcccccccccccCEECccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccEEEccccEEEEEEECcccCEEEcccccccccccccccccEEcccccccccccccEEEEEECccccccHHHHHHHHHHHHHHHHHccEEcccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHccccccEEECccccccccHHHHHHHHHHHHHccccccEEEcccccccccccccccccEEEEEcccccccccccccccEEEEEEEEccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccccccccccccccccccccccCEEcccccccccccEEEEccccccccccccCEEEEEccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEc

**************************************HQYQYQYQYQYQYQQHHQLWQYSNHFGFCNQNQYQNYYPALLPLPPTIPLQLALA*********************************************************************VAAR*****GVEGAVISLLANHFLVQLDPSQRIFHYNVEMSPSPSKEVARLIKQKLVEENSSMLSGAYPAFDGRKNIYSPVEFENDRLEFFVSLPIPTSKSV*************HQLKLFRINIKLVSKYDGKELSRYLSKEDNDWIPLPQDYLHALDVVLRENPSEKCIPVGRSLYSSSMGGAKEIGGGAVGLRGFFQSLRPTQQGLSLNVDSSVSAFHESVGVIPYLQKRLEFLKDLSQRKTRGLSGDQKKEVERALKNIRVFVCHRETVQRYRVYGLTEEVTENLWFADRDGKNIRLLSYFKDHYNYNIQFRNLPCLQISRSKPCYLPMELCMICEGQKFLGKLSDDQTARILKMGCQRPKERKAMIDGVMRGPVGPTSGNQGREFKLHVSREMTRLNGRILQPPKLKLGDGGHIRDLVPCRHDRQWNFLESHVFEGTRIERWALLSFGGSHDQKSAIPKFICQLSQRCEQLGIFLNKSTIISPQFEQTHVLNNVSLLESKLKKIHEAASNNLQLLICVMERKHKGYADLKRIAETSVGVVSQCCLYSNLGKLSSQFLANLALKINAKVGGCTVALYNSLPSQIPRLFFPDEPVIFMGADVTHPH*LDDFSPSVAAVVGSMNWPAANKYASRMRSQTHRQEIIQDLGVMVGELLDDFYHELNKLPRRIIFFRDGVSETQFYKVLQEELQSIREACSRFPGYSPPITFVVVQKRHHTRLFPYDN************NIPPGTVVDTVITHPREFDFYLCSHWGVKGTSRPTHYHILWDDNKFTSDELQKLVYNLCYTFVRCTKPVSLVPPAYYAHLAAYRGRLYLE***************************LSENVKKLMFYC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein argonaute 7	Involved in RNA-mediated post-transcriptional gene silencing (PTGS). Main component of the RNA-induced silencing complex (RISC) that binds to a short guide RNA such as a microRNA (miRNA) or small interfering RNA (siRNA). RISC uses the mature miRNA or siRNA as a guide for slicer-directed cleavage of homologous mRNAs to repress gene expression. Required for the processing of 21 nucleotide trans-acting siRNAs (ta-siRNAs) derived from TAS3a transcripts. Associates preferentially with the microRNA (miRNA) miR390 which guides the cleavage of TAS3 precursor RNA. Seems to act as miR390 specific slicer. Associates mainly with small RNAs of 21 nucleotide in length and with a 5' terminal adenosine. Acts in the RDR6/SGS3/DCL4/AGO7 trans-acting siRNA pathway involved in leaf developmental timing. Does not seems to act on leaf polarity. Required for the production of the 30-40nt bacterial-induced long siRNAs (lsiRNA). Involved in antiviral RNA silencing by contributing to efficient viral RNAs clearance. Targets less structured viral RNAs than AGO1 which is capable of targeting RNAs with more compact structures.	confident	Q9C793
Protein argonaute 7	Involved in the RNA silencing pathway. May bind to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them (By similarity). Regulates shoot apical meristem (SAM) initiation and maintenance and leaf polarization through the trans-acting siRNAS (ta-siRNAs) pathway which probably modulates the expression of the ARF2, ARF3, ARF4, ARF14 and ARF15 genes.	probable	Q75HC2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F1N, chain A
Confidence level:very confident
Coverage over the Query: 165-256,280-645,657-998,1009-1029
View the alignment between query and template
View the model in PyMOL