Citrus Sinensis ID: 001701

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020----

MDDTKPSVTASNNSESNAGDNDATEARLTDLCKNGLSVDENTYKEIIKLFRETKHLLLANISAIGNGMPEEAERFWFAFVLYLVRRLSEKNGENLQQGSNDNEFNLCHILRVMKLNIVDFFKELPQFLVKSGPILSNIYGADWENRLEAKELQANFVHLSILSKSYKRIYREFFLPSDANGDKQSAAASTSGYISDYHRFGWLLFLALRIHAFSRFKDLVTCTNGLVSILAILIIHVPVRFRNFNIHDSSRFVKKSNKGVDLIASLCSIYDTSEDDLRKIMEKTNTLIADILKKKPCEASECKSENLENIDTDGLIYFENLMDDSSLSSSLNILEKDYDNATRNKGELDERVFINEDDSLLGSGSLSGGAVNITGAKRKFDSLASPVKTITSPLSPHRSSASHPNGIAGGATSKMVVTPVSTAMTTAKWLRTVICPLPSKPSAELERFLKSCDKDVTTDVMRRAHIILEAIFPSSGLGERCVTGSLQGANLMDNIWAEQRRLEALKLYYRVLEAMCTAEAQVLHAKNLTSLLTNERFHRCMLACSAELVLATHKTVTMLFPAVLERTGITAFDLSKVIESFIRHEESLPRELRRHLNSLEERLLESMVWEKGSSMYNSLTVARPVLSAEINRLGLLADPMPSLDAIATHINFSSGGLSPVHSLHKHETSPGQNGDIRSPKRPCTDYRSVLVERNNFTSPVKDRLLGLNNLKSKPLPPPLQSAFASPTRPNPGGGGETCAETGINIFFCKINKLAAVRINAMVERLQLSQQIRESVYCLFQQILNQRTSLFFNRHIDQIILCCFYGVAKISQLNLTFREIIYNYRKQPQCKPQVFRSVFVDWASARQSGRSEQDHVDIITFYNKIFVPAVKPLLVELGPAGTAMKTNRVSEVNHNNDGPCPGSPKVSVFPALPDMSPKKVSATHNVYVSPLRTSKMDALISHSSKSYYACVGESTHAYQSPSKDLTDINHRLNSNRRVRGTLNFDDVDVDVGLVSDSMVANSLYLQNGSAAASTCAVLKPEQPDP

cccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHEEEEEEEEEcccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccEEEEEcccccccccccccccccEEEEcccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccEEEECcccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccc

***************************LTDLCKNGLSVDENTYKEIIKLFRETKHLLLANISAIGNGMPEEAERFWFAFVLYLVRRLS*************NEFNLCHILRVMKLNIVDFFKELPQFLVKSGPILSNIYGADWENRLEAKELQANFVHLSILSKSYKRIYREFFLP**************SGYISDYHRFGWLLFLALRIHAFSRFKDLVTCTNGLVSILAILIIHVPVRFRNFNIHDSSRFVKKSNKGVDLIASLCSIYDTSEDDLRKIMEKTNTLIADILKKKPCEASECKSENLENIDTDGLIYFENLMDDSSLSSSLNILEKDYDNATRNKGELDERVFINEDDSL******************************************************MVVTPVSTAMTTAKWLRTVICPL******ELERFLKSCDKDVTTDVMRRAHIILEAIFPSSGLGERCVTGSLQGANLMDNIWAEQRRLEALKLYYRVLEAMCTAEAQVLHAKNLTSLLTNERFHRCMLACSAELVLATHKTVTMLFPAVLERTGITAFDLSKVIESFIRHEESLPRELRRHLNSLEERLLESMVWEKGSSMYNSLTVARPVLS************MPS*D**********************************************************************************************AETGINIFFCKINKLAAVRINAMVERLQLSQQIRESVYCLFQQILNQRTSLFFNRHIDQIILCCFYGVAKISQLNLTFREIIYNYRKQPQCKPQVFRSVFVDWA***********HVDIITFYNKIFVPAVKPLLVELGPA*********************************************VYV*********ALISH*SKSYYACVGES********************NRRVRGTLNFDDV**************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDDTKPSVTASNNSESNAGDNDATEARLTDLCKNGLSVDENTYKEIIKLFRETKHLLLANISAIGNGMPEEAERFWFAFVLYLVRRLSEKNGENLQQGSNDNEFNLCHILRVMKLNIVDFFKELPQFLVKSGPILSNIYGADWENRLEAKELQANFVHLSILSKSYKRIYREFFLPSDANGDKQSAAASTSGYISDYHRFGWLLFLALRIHAFSRFKDLVTCTNGLVSILAILIIHVPVRFRNFNIHDSSRFVKKSNKGVDLIASLCSIYDTSEDDLRKIMEKTNTLIADILKKKPCEASECKSENLENIDTDGLIYFENLMDDSSLSSSxxxxxxxxxxxxxxxxxxxxxVFINEDDSLLGSGSLSGGAVNITGAKRKFDSLASPVKTITSPLSPHRSSASHPNGIAGGATSKMVVTPVSTAMTTAKWLRTVICPLPSKPSAELERFLKSCDKDVTTDVMRRAHIILEAIFPSSGLGERCVTGSLQGANLMDNIWAEQRRLEALKLYYRVLEAMCTAEAQVLHAKNLTSLLTNERFHRCMLACSAELVLATHKTVTMLFPAVLERTGITAFDLSKVIESFIRHEESLPRELRRHLNSLEERLLESMVWEKGSSMYNSLTVARPVLSAEINRLGLLADPMPSLDAIATHINFSSGGLSPVHSLHKHETSPGQNGDIRSPKRPCTDYRSVLVERNNFTSPVKDRLLGLNNLKSKPLPPPLQSAFASPTRPNPGGGGETCAETGINIFFCKINKLAAVRINAMVERLQLSQQIRESVYCLFQQILNQRTSLFFNRHIDQIILCCFYGVAKISQLNLTFREIIYNYRKQPQCKPQVFRSVFVDWASARQSGRSEQDHVDIITFYNKIFVPAVKPLLVELGPAGTAMKTNRVSEVNHNNDGPCPGSPKVSVFPALPDMSPKKVSATHNVYVSPLRTSKMDALISHSSKSYYACVGESTHAYQSPSKDLTDINHRLNSNRRVRGTLNFDDVDVDVGLVSDSMVANSLYLQNGSAAASTCAVLKPEQPDP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Retinoblastoma-related protein	Regulator of biological processes that recruits a histone deacetylase to control gene transcription. May play a role in the entry into mitosis, negatively regulating the cell proliferation. Formation of stable complexes with geminiviridae replication-associated proteins may create a cellular environment which favors viral DNA replication.	confident	B9GLX8
Retinoblastoma-related protein 1	Controls the progression of the cell cycle from G1 to S phase. Acts through the modulation of E2F action in response to D-type cyclins. Negative regulator of cell proliferation during leaf and gametophyte development. At later stages of development, restricts the progression through additional endocycles. Regulates the root stem cell pool size. Interaction with mastrevirus RepA or nanovirus Clink protein disrupts the RBR/E2F interaction and releases the transcription of replicative enzymes needed by the virus by increasing the E2F DNA-binding activity.	confident	Q9LKZ3
Retinoblastoma-related protein	Regulator of biological processes that recruits a histone deacetylase to control gene transcription. May play a role in the entry into mitosis, negatively regulating the cell proliferation. Formation of stable complexes with geminiviridae replication-associated proteins may create a cellular environment which favors viral DNA replication.	confident	A7P514

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R7G, chain A
Confidence level:very confident
Coverage over the Query: 426-624
View the alignment between query and template
View the model in PyMOL

Template: 4ELJ, chain A
Confidence level:very confident
Coverage over the Query: 23-89,102-131,144-285,307-361,374,400-401,419-625
View the alignment between query and template
View the model in PyMOL

Template: 4ELL, chain A
Confidence level:very confident
Coverage over the Query: 428-622,666-676,740-840,851-879,901-909
View the alignment between query and template
View the model in PyMOL

Template: 2QDJ, chain A
Confidence level:confident
Coverage over the Query: 24-60,71-89,103-131,144-258,284-361
View the alignment between query and template
View the model in PyMOL