Citrus Sinensis ID: 001718


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020-
MDSQQTNLFETASQPDTGTDAYTFLEFNTQGESDFDAYPEFRSPVSWPTPSDSLSVDPTTPVTPATPSDSRSAPPASDHHHHHNHHRHSDSLAATSSPSKRGANNSSNTSTSQIVEGMAGLSFEETGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNMMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGPGIVPNDISTSNPNADRRGSRARGYMPPGPPNGTHKPGLHPAGFPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGSHLQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPRLHGSWITRSVYSGWL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEcccccccccHHHHHHHHccccEEEEccccccccccEEcccccccccccccccccccccEEEEEEccccccccccccccccEEEEEEcccccEEEEEEEccccccccccccccEEEEEEcccccccccCEEEEEEEEcccEEEEEEEcccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHccccccccccccccccccHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEcccccccccccHHHHHccccEEEEEccccccccEEEcHHHHHccccccHHHHHHHcccccccccccccccHHHHccccHHHHcccccccccHHcccccccccccccccccEEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHccccHHcccccEEEEcccccccccccEEEEEEccccccccccccccccccEEEEEcccccEEEEccccHHcccHHHHHHHHHHHHcccEEEcccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*******************DAYTFLEFNTQGESDFDAY*********************************************************************************************GFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNMMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRH********************************LKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK*********************************************************************************************************************************************************************************YSGWL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSQQTNLFETASQPDTGTDAYTFLEFNTQGESDFDAYPEFRSPVSWPTPSDSLSVDPTTPVTPATPSDSRSAPPASDHHHHHNHHRHSDSLAATSSPSKRGANNSSNTSTSQIVEGMAGLSFEETGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNMMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGPGIVPNDISTSNPNADRRGSRARGYMPPGPPNGTHKPGLHPAGFPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGSHLQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPRLHGSWITRSVYSGWL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Regulator of nonsense transcripts 1 homolog Eliminates the production of nonsense-containing RNAs.probableQ9FJR0
Regulator of nonsense transcripts 1 RNA-dependent helicase and ATPase required for nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. Recruited by release factors to stalled ribosomes together with the SMG1C protein kinase complex to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) (located 50-55 or more nucleotides downstream from the termination codon) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Phosphorylated UPF1 is recognized by EST1B/SMG5, SMG6 and SMG7 which are thought to provide a link to the mRNA degradation machinery involving exonucleolytic and endonucleolytic pathways, and to serve as adapters to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation and allowing the recycling of NMD factors. UPF1 can also activate NMD without UPF2 or UPF3, and in the absence of the NMD-enhancing downstream EJC indicative for alternative NMD pathways. Plays a role in replication-dependent histone mRNA degradation at the end of phase S; the function is independent of UPF2. For the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. The ATPase activity of UPF1 is required for disassembly of mRNPs undergoing NMD. Essential for embryonic viability.probableQ92900
Regulator of nonsense transcripts 1 RNA-dependent helicase and ATPase required for nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. Recruited by release factors to stalled ribosomes together with the SMG1C protein kinase complex to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) (located 50-55 or more nucleotides downstream from the termination codon) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Phosphorylated UPF1 is recognized by EST1B/SMG5, SMG6 and SMG7 which are thought to provide a link to the mRNA degradation machinery involving exonucleolytic and endonucleolytic pathways, and to serve as adapters to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation. UPF1 can also activate NMD without UPF2 or UPF3, and in the absence of the NMD-enhancing downstream EJC indicative for alternative NMD pathways. Plays a role in replication-dependent histone mRNA degradation at the end of phase S; the function is independent of UPF2. For the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. The ATPase activity of UPF1 is required for disassembly of mRNPs undergoing NMD (By similarity). Essential for embryonic viability.probableQ9EPU0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WJY, chain A
Confidence level:very confident
Coverage over the Query: 231-835
View the alignment between query and template
View the model in PyMOL
Template: 2IYK, chain A
Confidence level:very confident
Coverage over the Query: 140-276
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 908-920
View the alignment between query and template
View the model in PyMOL