Citrus Sinensis ID: 001718

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020-

MDSQQTNLFETASQPDTGTDAYTFLEFNTQGESDFDAYPEFRSPVSWPTPSDSLSVDPTTPVTPATPSDSRSAPPASDHHHHHNHHRHSDSLAATSSPSKRGANNSSNTSTSQIVEGMAGLSFEETGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNMMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGPGIVPNDISTSNPNADRRGSRARGYMPPGPPNGTHKPGLHPAGFPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGSHLQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPRLHGSWITRSVYSGWL

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEcccccccccHHHHHHHHccccEEEEccccccccccEEcccccccccccccccccccccEEEEEEccccccccccccccccEEEEEEcccccEEEEEEEccccccccccccccEEEEEEcccccccccEEEEEEEEEcccEEEEEEEcccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHccccccccccccccccccHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEccccccccccHHHHHHccccEEEEEccccccccEEEcHHHHHccccccHHHHHHHcccccccccccccccHHHHcccHHHHHcccccccccHHcccccccccccccccccEEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHHHHccccHHcccccEEEEcccccccccccEEEEEEccccccccccccccccccEEEEEcccccEEEEccccHHcccHHHHHHHHHHHHcccEEEcccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccccccccHcccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccEEEEEEEcccccEEEcccccccccHHHHHHHEccccEEEEcccccccccEEEEEccccccEEEEEEEccccccEEEEEEccHHHHHHHHHccccccEEEEEccccccEEEEEEEccccccEEEEcccEEEEEEccccccccccccEEEEEEccccEEEEEEEccccccccccccEEEEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccccHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHcccEcEEEEEccHcccccHcEHHEEccccEEEEEccccccccEEEcHHHHHccccHHHHHHHHHHccccEEEEEEEcccHHHHccccHHHHcccccccccHHHHcccccccccccccccEEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHccccHHHEEEEcccHHHHHHHHHHHHHcccccHHHcccEEEEEEcccccccccEEEEEEEEccccccEEEcccccHEEEEEEEccccEEEEEcHHHHcccHHHHHHHHHHHHcccEEEcccHcccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccHcccc

mdsqqtnlfetasqpdtgtdaytflefntqgesdfdaypefrspvswptpsdslsvdpttpvtpatpsdsrsappasdhhhhhnhhrhsdslaatsspskrgannssntsTSQIVEGmaglsfeetgddvegfeygkadftehacrycgvsnpacvvrcnvpscrkwfcnsrgntsgshiVNHLVRAKHkevclhkdsplgeTILECyncgcrnvFLLGFISAKTESVVVLLCREpclnmmkesqskdnVTIRWDIGLNKKRVAYFvfpkednelrlvpgdelrlrysgdaahpawqSVGHVIKLTAQEEVALELRasqgvpvdinhgfsVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNtlprrfgapglpelnasQVFAVKSVLqrpisliqgppgtgktvTSAAIVYHMAKqgqgqvlvcapsnvAVDQLAEKISATGLKVVRLCAKSreavsspvehLTLHYQvrhldtseksELHKLQQLKDeqgelsssdEKKYKALKRATEREISQSADVicctcvgagdprlanFRFRQVLidestqatepecliplvLGAKQVVLVgdhcqlgpvIMCKKAARAGLAQSLFERLVLLglkpirlqvqyrmhpslsefpsnsfyegtlqngvtinerqssgidfpwpvpnrpmffyVQMGQEEISASGTSYLNRTEAANVEKIVTTFLrsgvvpsqigvitpyegQRAYIVNYMSRNGALRQQLYKEIEVASvdsfqgrekdYIILSCVrsnehqgigflndprrLNVALTRARYGivilgnpkvlskqplwngllthykeheclvegplnnlkQSMVQfqkpkkiyndrrlffgagpgivpndistsnpnadrrgsrargymppgppngthkpglhpagfpmprvplppfqggppsqpyaipsrgavhgpvgavhhvpppgsrgfgagrgsagapigshlqhqqntqqpigtigstfnfpslensnsqpsvggpltqpgfvnnmpvqgprlhgswitrsvysgwl

mdsqqtnlfetasqpdtgtdAYTFLEFNTQGESDFDAYPEFRSPVSWPTPSDSLSVDPTTPVTPATPSDSRSAPPASDHHHHHNHHRHSDSLAATSSPSKRGANNSSNTSTSQIVEGMAGLSFEETGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNmmkesqskdnvtiRWDIGLNKKRVAYfvfpkednelrlvPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRAsqgvpvdinHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRpisliqgppgtGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSreavsspvehlTLHYQVRHLDTSEKSELHKLQQlkdeqgelsssdekKYKALKRAtereisqsadvICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTflrsgvvpsqigvitpyEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSnehqgigflndprRLNVALTRARYGIvilgnpkvlskQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGpgivpndistsnpnADRRGSRARGYMPPGPPNGTHKPGLHPAGFPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGSHLQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQgprlhgswitrsvysgwl

MDSQQTNLFETASQPDTGTDAYTFLEFNTQGESDFDAYPEFRSPVSWPTPSDSLsvdpttpvtpatpsdsrsappasdhhhhhnhhrhsdsLAATSSPSKRGANNSSNTSTSQIVEGMAGLSFEETGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNMMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGPGIVPNDISTSNPNADRRGSRARGYMPPGPPNGTHKPGLHPAGFPMPRVPLPPFQGGPPSQPYAIPSRgavhgpvgavhhvpppgsrgfgagrgsagapIGSHLQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPRLHGSWITRSVYSGWL

*********************YTFLEFN*************************************************************************************************TGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNMMKE**SKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRH********************************************ADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGPGIV*****************************************************************************************************************************************************RLHGSWITRSVYS***

*******************DAYTFLEFNTQGESDFDAY***************************************************************************************************ADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNMMKESQSKDNVTIRWDIGLNKKRVAYFVFPK******LVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVE**********RFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREA*SSPVEHL*LHY************************************LKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQ****************TEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNL********************************************************************************************************************************************************************************************YSGWL

********FETASQPDTGTDAYTFLEFNTQGESDFDAYPEFRSPVSW****************************************************************SQIVEGMAGLSFEETGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNMMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSEKSELHKLQQL************KKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGPGIVPNDISTSNPNADRRGSRARGYMPPGPPNGTHKPGLHPAGFPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGS*********QPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGPRLHGSWITRSVYSGWL

***********ASQPDTGTDAYTFLEFNTQGESDFDAYPEFRSPVS*************************************************************************************GFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKDSPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLNMMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK********************************************************FPMPRVPLPPFQGGPPSQPYA*PS******************************************************************************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1021	2.2.26 [Sep-21-2011]
Q9FJR0		1254	Regulator of nonsense tra	yes	no	0.732	0.596	0.873	0.0
Q92900		1129	Regulator of nonsense tra	yes	no	0.712	0.643	0.595	0.0
Q9EPU0		1124	Regulator of nonsense tra	yes	no	0.587	0.533	0.702	0.0
Q98TR3		1097	Putative regulator of non	N/A	no	0.660	0.614	0.618	0.0
Q9HEH1		1093	Regulator of nonsense tra	N/A	no	0.590	0.551	0.661	0.0
Q9VYS3		1180	Regulator of nonsense tra	yes	no	0.619	0.535	0.621	0.0
Q09820		925	ATP-dependent helicase up	yes	no	0.588	0.649	0.597	0.0
P30771		971	ATP-dependent helicase NA	yes	no	0.581	0.611	0.590	0.0
O76512		1069	Regulator of nonsense tra	yes	no	0.573	0.548	0.575	0.0
Q54I89		1331	Regulator of nonsense tra	yes	no	0.593	0.455	0.571	0.0

>sp\|Q9FJR0\|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2	Back alignment and function desciption

 Score = 1354 bits (3504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/761 (87%), Positives = 706/761 (92%), Gaps = 13/761 (1%)

Query: 240  MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 299
            MMKESQSK+N+T+RWDIGLNKKRVAYFVFPKE+NELRLVPGDELRLRYSGDA HP+WQSV
Sbjct: 338  MMKESQSKENLTVRWDIGLNKKRVAYFVFPKEENELRLVPGDELRLRYSGDAVHPSWQSV 397

Query: 300  GHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 359
            GHVIKLTAQEEVALELRA+QGVP+D+NHGFSVDFVWKSTSFDRMQGAMK FAVDETSVSG
Sbjct: 398  GHVIKLTAQEEVALELRANQGVPIDVNHGFSVDFVWKSTSFDRMQGAMKNFAVDETSVSG 457

Query: 360  YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKT 419
            YIYH LLGHEVE QMVRNTLPRRFG PGLPELNASQV AVKSVLQ+PISLIQGPPGTGKT
Sbjct: 458  YIYHQLLGHEVEAQMVRNTLPRRFGVPGLPELNASQVNAVKSVLQKPISLIQGPPGTGKT 517

Query: 420  VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 479
            VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVE+L
Sbjct: 518  VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEYL 577

Query: 480  TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 539
            TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYK LKRATEREI+QSADVICCTC
Sbjct: 578  TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKNLKRATEREITQSADVICCTC 637

Query: 540  VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAAR 599
            VGA D RL+NFRFRQVLIDESTQATEPECLIPLVLG KQVVLVGDHCQLGPVIMCKKAAR
Sbjct: 638  VGAADLRLSNFRFRQVLIDESTQATEPECLIPLVLGVKQVVLVGDHCQLGPVIMCKKAAR 697

Query: 600  AGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 659
            AGLAQSLFERLV LG+KPIRLQVQYRMHP+LSEFPSNSFYEGTLQNGVTI ERQ++GIDF
Sbjct: 698  AGLAQSLFERLVTLGIKPIRLQVQYRMHPALSEFPSNSFYEGTLQNGVTIIERQTTGIDF 757

Query: 660  PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 719
            PWPVPNRPMFFYVQ+GQEEISASGTSYLNRTEAANVEK+VT FL+SGVVPSQIGVITPYE
Sbjct: 758  PWPVPNRPMFFYVQLGQEEISASGTSYLNRTEAANVEKLVTAFLKSGVVPSQIGVITPYE 817

Query: 720  GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 779
            GQRAYIVNYM+RNG+LRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR
Sbjct: 818  GQRAYIVNYMARNGSLRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 877

Query: 780  RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 839
            RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKP+
Sbjct: 878  RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPR 937

Query: 840  KIYNDRRLFFGAGPGIVPND-ISTSNPNAD---RRGSRARGYMPPGPPNGTHKPGLHPAG 895
            KIYNDRRLF+G G G++ ND   + NPNAD    RG     Y+P GPPNG  +PGLHPAG
Sbjct: 938  KIYNDRRLFYGGGAGMIGNDNFGSGNPNADRRGSRGRAGGSYLPSGPPNGA-RPGLHPAG 996

Query: 896  FPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGSH 955
            +P+PRVPL PF GGPPSQPYAIP+R    GPVGAV H P PG+ GFGAGRG++   +G H
Sbjct: 997  YPIPRVPLSPFPGGPPSQPYAIPTR----GPVGAVPHAPQPGNHGFGAGRGTS---VGGH 1049

Query: 956  LQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGF 996
            L HQQ TQ  +GTIG + NFP L++ NSQPS GGPL+QPG+
Sbjct: 1050 LPHQQATQHNVGTIGPSLNFP-LDSPNSQPSPGGPLSQPGY 1089

Eliminates the production of nonsense-containing RNAs.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -

>sp\|Q92900\|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2	Back alignment and function description

>sp\|Q9EPU0\|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2	Back alignment and function description

>sp\|Q98TR3\|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1	Back alignment and function description

>sp\|Q9HEH1\|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1	Back alignment and function description

>sp\|Q9VYS3\|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2	Back alignment and function description

>sp\|Q09820\|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2	Back alignment and function description

>sp\|P30771\|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1	Back alignment and function description

>sp\|O76512\|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1	Back alignment and function description

>sp\|Q54I89\|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1021
359474491		1267	PREDICTED: regulator of nonsense transcr	0.750	0.604	0.953	0.0
255575790		1280	nonsense-mediated mRNA decay protein, pu	0.750	0.598	0.949	0.0
356497066		1266	PREDICTED: regulator of nonsense transcr	0.743	0.599	0.924	0.0
449511522		1268	PREDICTED: regulator of nonsense transcr	0.749	0.603	0.926	0.0
357482277		1253	Regulator of nonsense transcripts-like p	0.745	0.607	0.927	0.0
356541331		1270	PREDICTED: regulator of nonsense transcr	0.740	0.595	0.917	0.0
224138824		1256	predicted protein [Populus trichocarpa]	0.736	0.598	0.918	0.0
224126379		1242	predicted protein [Populus trichocarpa]	0.735	0.604	0.926	0.0
50509972		1277	putative type 1 RNA helicase [Oryza sati	0.747	0.597	0.874	0.0
218199657		1277	hypothetical protein OsI_26082 [Oryza sa	0.747	0.597	0.874	0.0

>gi\|359474491\|ref\|XP_002279304.2\| PREDICTED: regulator of nonsense transcripts 1 homolog [Vitis vinifera] gi\|297742168\|emb\|CBI33955.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1515 bits (3922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/771 (95%), Positives = 752/771 (97%), Gaps = 5/771 (0%)

Query: 240  MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 299
            MMKESQSKDNVTIRWDIGLNKKR+AYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV
Sbjct: 323  MMKESQSKDNVTIRWDIGLNKKRIAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 382

Query: 300  GHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 359
            GHVIKLTAQEEVALELRASQGVPVD+NHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG
Sbjct: 383  GHVIKLTAQEEVALELRASQGVPVDVNHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 442

Query: 360  YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKT 419
            YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQ+PISLIQGPPGTGKT
Sbjct: 443  YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQKPISLIQGPPGTGKT 502

Query: 420  VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 479
            VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL
Sbjct: 503  VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 562

Query: 480  TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 539
            TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC
Sbjct: 563  TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 622

Query: 540  VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAAR 599
            VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLG KQVVLVGDHCQLGPVIMCKKAAR
Sbjct: 623  VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGVKQVVLVGDHCQLGPVIMCKKAAR 682

Query: 600  AGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 659
            AGLAQSLFERLVLLG+KPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF
Sbjct: 683  AGLAQSLFERLVLLGVKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 742

Query: 660  PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 719
            PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE
Sbjct: 743  PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 802

Query: 720  GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 779
            GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR
Sbjct: 803  GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 862

Query: 780  RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 839
            RLNVALTRARYGIVILGNPKVLSKQPLWN LLTHYKEHECLVEGPLNNLKQSMVQFQKPK
Sbjct: 863  RLNVALTRARYGIVILGNPKVLSKQPLWNSLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 922

Query: 840  KIYNDRRLFFGAGPGIVPND----ISTSNPNADRRGSRARG-YMPPGPPNGTHKPGLHPA 894
            KIYNDRRLFFG GPGIVPND    +++S+P+ADRR SR RG YMP GPPNGTHKPG+HPA
Sbjct: 923  KIYNDRRLFFGGGPGIVPNDNFGTVTSSSPSADRRSSRGRGSYMPSGPPNGTHKPGVHPA 982

Query: 895  GFPMPRVPLPPFQGGPPSQPYAIPSRGAVHGPVGAVHHVPPPGSRGFGAGRGSAGAPIGS 954
            GFPMPRVPLPPF GGPPSQPYAIP+RGAVHGPVGAV HVPPPGSRGFGAGRG+AGAPIGS
Sbjct: 983  GFPMPRVPLPPFHGGPPSQPYAIPTRGAVHGPVGAVPHVPPPGSRGFGAGRGNAGAPIGS 1042

Query: 955  HLQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGFVNNMPVQGP 1005
            HL HQQ +QQ +G +GSTFNFP+LEN NSQPSVGGPL+QPGFV NMPVQGP
Sbjct: 1043 HLPHQQGSQQAVGNLGSTFNFPALENPNSQPSVGGPLSQPGFVTNMPVQGP 1093

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255575790\|ref\|XP_002528794.1\| nonsense-mediated mRNA decay protein, putative [Ricinus communis] gi\|223531797\|gb\|EEF33616.1\| nonsense-mediated mRNA decay protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356497066\|ref\|XP_003517385.1\| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|449511522\|ref\|XP_004163978.1\| PREDICTED: regulator of nonsense transcripts 1 homolog [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357482277\|ref\|XP_003611424.1\| Regulator of nonsense transcripts-like protein [Medicago truncatula] gi\|355512759\|gb\|AES94382.1\| Regulator of nonsense transcripts-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356541331\|ref\|XP_003539131.1\| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|224138824\|ref\|XP_002326699.1\| predicted protein [Populus trichocarpa] gi\|222834021\|gb\|EEE72498.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224126379\|ref\|XP_002329539.1\| predicted protein [Populus trichocarpa] gi\|222870248\|gb\|EEF07379.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|50509972\|dbj\|BAD30435.1\| putative type 1 RNA helicase [Oryza sativa Japonica Group] gi\|222637078\|gb\|EEE67210.1\| hypothetical protein OsJ_24327 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|218199657\|gb\|EEC82084.1\| hypothetical protein OsI_26082 [Oryza sativa Indica Group]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1021
TAIR\|locus:2171007		1254	LBA1 "LOW-LEVEL BETA-AMYLASE 1	0.732	0.596	0.856	0.0
UNIPROTKB\|E1C0J4		1117	UPF1 "Uncharacterized protein"	0.658	0.601	0.657	3.9e-296
ZFIN\|ZDB-GENE-040426-2836		1100	upf1 "upf1 regulator of nonsen	0.650	0.603	0.661	5.1e-294
UNIPROTKB\|E1C0J3		1128	UPF1 "Uncharacterized protein"	0.658	0.595	0.646	4.5e-293
UNIPROTKB\|Q92900		1129	UPF1 "Regulator of nonsense tr	0.645	0.583	0.651	4.1e-292
UNIPROTKB\|E1BEK9		1127	UPF1 "Uncharacterized protein"	0.645	0.584	0.653	4.1e-292
UNIPROTKB\|E2RL81		1130	UPF1 "Uncharacterized protein"	0.645	0.583	0.653	4.1e-292
MGI\|MGI:107995		1124	Upf1 "UPF1 regulator of nonsen	0.587	0.533	0.706	6.6e-292
FB\|FBgn0030354		1180	Upf1 "Upf1" [Drosophila melano	0.643	0.556	0.607	1.8e-262
UNIPROTKB\|G4ND47		1105	MGG_00976 "Regulator-nonsense	0.619	0.572	0.634	2.3e-262

TAIR\|locus:2171007 LBA1 "LOW-LEVEL BETA-AMYLASE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 3377 (1193.8 bits), Expect = 0., Sum P(2) = 0.
 Identities = 652/761 (85%), Positives = 690/761 (90%)

Query:   240 MMKESQSKDNVTIRWDIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSV 299
             MMKESQSK+N+T+RWDIGLNKKRVAYFVFPKE+NELRLVPGDELRLRYSGDA HP+WQSV
Sbjct:   338 MMKESQSKENLTVRWDIGLNKKRVAYFVFPKEENELRLVPGDELRLRYSGDAVHPSWQSV 397

Query:   300 GHVIKLTAQEEVALELRASQGVPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDETSVSG 359
             GHVIKLTAQEEVALELRA+QGVP+D+NHGFSVDFVWKSTSFDRMQGAMK FAVDETSVSG
Sbjct:   398 GHVIKLTAQEEVALELRANQGVPIDVNHGFSVDFVWKSTSFDRMQGAMKNFAVDETSVSG 457

Query:   360 YIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPGTGKT 419
             YIYH LLGHEVE QMVRNTLPRRFG PGLPELNASQV AVKSVLQ+PISLIQGPPGTGKT
Sbjct:   458 YIYHQLLGHEVEAQMVRNTLPRRFGVPGLPELNASQVNAVKSVLQKPISLIQGPPGTGKT 517

Query:   420 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHL 479
             VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVE+L
Sbjct:   518 VTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEYL 577

Query:   480 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTC 539
             TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYK LKRATEREI+QSADVICCTC
Sbjct:   578 TLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKNLKRATEREITQSADVICCTC 637

Query:   540 VGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCKKAAR 599
             VGA D RL+NFRFRQVLIDESTQATEPECLIPLVLG KQVVLVGDHCQLGPVIMCKKAAR
Sbjct:   638 VGAADLRLSNFRFRQVLIDESTQATEPECLIPLVLGVKQVVLVGDHCQLGPVIMCKKAAR 697

Query:   600 AGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQSSGIDF 659
             AGLAQSLFERLV LG+KPIRLQVQYRMHP+LSEFPSNSFYEGTLQNGVTI ERQ++GIDF
Sbjct:   698 AGLAQSLFERLVTLGIKPIRLQVQYRMHPALSEFPSNSFYEGTLQNGVTIIERQTTGIDF 757

Query:   660 PWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYE 719
             PWPVPNRPMFFYVQ+GQEEISASGTSYLNRTEAANVEK+VT FL+SGVVPSQIGVITPYE
Sbjct:   758 PWPVPNRPMFFYVQLGQEEISASGTSYLNRTEAANVEKLVTAFLKSGVVPSQIGVITPYE 817

Query:   720 GQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 779
             GQRAYIVNYM+RNG+LRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR
Sbjct:   818 GQRAYIVNYMARNGSLRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPR 877

Query:   780 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPK 839
             RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKP+
Sbjct:   878 RLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQSMVQFQKPR 937

Query:   840 KIYNDRRLFFGAGPGIVPND-ISTSNPNADRRGSRARG---YMPPGPPNGTHKPGLHPAG 895
             KIYNDRRLF+G G G++ ND   + NPNADRRGSR R    Y+P GPPNG  +PGLHPAG
Sbjct:   938 KIYNDRRLFYGGGAGMIGNDNFGSGNPNADRRGSRGRAGGSYLPSGPPNGA-RPGLHPAG 996

Query:   896 FPMPRVPLPPFQGGPPSQPYAIPSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGSH 955
             +P+PRVPL PF GGPPSQPYAIP+R                               +G H
Sbjct:   997 YPIPRVPLSPFPGGPPSQPYAIPTRGPVGAVPHAPQPGNHGFGAGRGTS-------VGGH 1049

Query:   956 LQHQQNTQQPIGTIGSTFNFPSLENSNSQPSVGGPLTQPGF 996
             L HQQ TQ  +GTIG + NFP L++ NSQPS GGPL+QPG+
Sbjct:  1050 LPHQQATQHNVGTIGPSLNFP-LDSPNSQPSPGGPLSQPGY 1089

GO:0003677 "DNA binding" evidence=IEA

GO:0003724 "RNA helicase activity" evidence=ISS

GO:0004386 "helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM;IDA

GO:0008270 "zinc ion binding" evidence=IEA

GO:0016787 "hydrolase activity" evidence=IEA

GO:0010182 "sugar mediated signaling pathway" evidence=RCA;IMP

GO:0016246 "RNA interference" evidence=IGI

GO:0005886 "plasma membrane" evidence=IDA

GO:0000184 "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay" evidence=IMP

GO:0005829 "cytosol" evidence=IDA;RCA

GO:0009506 "plasmodesma" evidence=IDA

GO:0042742 "defense response to bacterium" evidence=IMP

GO:0009755 "hormone-mediated signaling pathway" evidence=RCA

GO:0048825 "cotyledon development" evidence=RCA

GO:0000932 "cytoplasmic mRNA processing body" evidence=IDA

GO:0009744 "response to sucrose stimulus" evidence=IGI

UNIPROTKB\|E1C0J4 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-2836 upf1 "upf1 regulator of nonsense transcripts homolog (yeast)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C0J3 UPF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q92900 UPF1 "Regulator of nonsense transcripts 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BEK9 UPF1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RL81 UPF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:107995 Upf1 "UPF1 regulator of nonsense transcripts homolog (yeast)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

FB\|FBgn0030354 Upf1 "Upf1" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|G4ND47 MGG_00976 "Regulator-nonsense transcripts 1" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9FJR0	RENT1_ARATH	3, ., 6, ., 4, ., -	0.8738	0.7326	0.5964	yes	no
Q92900	RENT1_HUMAN	3, ., 6, ., 4, ., -	0.5951	0.7120	0.6439	yes	no
Q9EPU0	RENT1_MOUSE	3, ., 6, ., 4, ., -	0.7029	0.5876	0.5338	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4.12	LOW CONFIDENCE prediction!
3rd Layer	3.6.4	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00015835001	SubName- Full=Chromosome chr2 scaffold_11, whole genome shotgun sequence; (1267 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00018278001	SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (1205 aa)	•	•	•	•	0.985
	GSVIVG00034829001	SubName- Full=Chromosome chr4 scaffold_73, whole genome shotgun sequence; (202 aa)		•	•	•	0.715
	GSVIVG00006013001	RecName- Full=DNA polymerase; EC=2.7.7.7; (1126 aa)	•	•		•	0.675
	GSVIVG00018636001	SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (144 aa)		•	•	•	0.630
	GSVIVG00027322001	SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (112 aa)		•		•	0.601
	GSVIVG00022233001	SubName- Full=Chromosome chr6 scaffold_25, whole genome shotgun sequence; (812 aa)		•	•	•	0.601
	GSVIVG00014203001	SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (151 aa)			•	•	0.584
	GSVIVG00018190001	SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (321 aa)		•		•	0.547
	GSVIVG00025575001	SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (307 aa)			•		0.540
	GSVIVG00029522001	SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (129 aa)	•		•		0.538

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1021
COG1112		767	COG1112, COG1112, Superfamily I DNA and RNA helica	1e-101
TIGR00376		637	TIGR00376, TIGR00376, DNA helicase, putative	8e-87
pfam13087		195	pfam13087, AAA_12, AAA domain	4e-82
pfam13086		220	pfam13086, AAA_11, AAA domain	3e-71
pfam09416		152	pfam09416, UPF1_Zn_bind, RNA helicase (UPF2 intera	2e-63
pfam13245		73	pfam13245, AAA_19, Part of AAA domain	2e-11
TIGR01447		586	TIGR01447, recD, exodeoxyribonuclease V, alpha sub	5e-09
pfam13604		195	pfam13604, AAA_30, AAA domain	1e-08
pfam04851		100	pfam04851, ResIII, Type III restriction enzyme, re	7e-08
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	2e-07
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	1e-06
TIGR01448		720	TIGR01448, recD_rel, helicase, putative, RecD/TraA	9e-06
PRK10875		615	PRK10875, recD, exonuclease V subunit alpha; Provi	9e-05
COG1061		442	COG1061, SSL2, DNA or RNA helicases of superfamily	3e-04
TIGR00643		630	TIGR00643, recG, ATP-dependent DNA helicase RecG	0.002
TIGR00959		428	TIGR00959, ffh, signal recognition particle protei	0.003
COG1199		654	COG1199, DinG, Rad3-related DNA helicases [Transcr	0.003
smart00382		148	smart00382, AAA, ATPases associated with a variety	0.004

>gnl\|CDD\|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair]	Back alignment and domain information

 Score =  334 bits (858), Expect = e-101
 Identities = 170/598 (28%), Positives = 263/598 (43%), Gaps = 32/598 (5%)

Query: 248 DNVTIRWDIGLNKKRVAYFVFP-KEDNELR-------LVPGDELRLRYSGDAAHPAWQSV 299
             + I +   L K        P  E  E+R       L   + + LR   +     +  +
Sbjct: 182 AGLLIEYLKRLRKVLDKIIPPPLFEKEEVRVDIVENLLELSESILLRRELELLS-KFALI 240

Query: 300 GHVIKLTAQEEVALELRASQG---VPVDINHGFSVDFVWKSTSFDRMQGAMKTFAVDE-T 355
              + L +  E+            V +++          +  +  R+      F + +  
Sbjct: 241 LKRL-LESLFEILRGKDLPIKLLDVELELVEINKELDNEQKLAVKRLLSLNDLFLIHQGP 299

Query: 356 SVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQGPPG 415
             +G      +   +   +  N L     A     ++       ++V++  +  I  P  
Sbjct: 300 FGTGKTRSVTILELIIELLENNKLKILPTAESNAAVDNLLRRLKRTVIKVELLRIGHPSR 359

Query: 416 TGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSP 475
             K +    +   + K       + A     +D++  ++   G +++R  AK RE +   
Sbjct: 360 VLKKLKLDTLEELLEKHEIPGNKIAA-----LDKVIRELREEGERIIREIAKLRERLERK 414

Query: 476 VEHLTLHYQVRHLDTSEKSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVI 535
                 H  V            K + L     E      K+ + LK+    +I ++ADV+
Sbjct: 415 RLDKISHLNVALRGILPALN--KSEALWISLEEKQKKILKELRRLKKKAVTKILEAADVV 472

Query: 536 CCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGAKQVVLVGDHCQLGPVIMCK 595
             T   AG   L  + F  V+IDE++QATEP  LI L   AK+V+LVGDH QL P +  K
Sbjct: 473 LSTLSIAGFSILKKYEFDYVIIDEASQATEPSALIALSR-AKKVILVGDHKQLPPTVFFK 531

Query: 596 KAARAGLAQSLFERLVLLGL-KPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINERQS 654
           +++  GL+ SLFERL+  G      L+VQYRMHP +  F S  FY G L+   +      
Sbjct: 532 ESSPEGLSASLFERLIDNGPEVVYLLRVQYRMHPDIIAFSSKVFYNGRLEVHTSFLAFTL 591

Query: 655 SGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGV 714
              + P  V + P+ FY  +G EE   S  S LN  EA  V+ IV   L+ G+  + IGV
Sbjct: 592 LDGEIPEVVISNPLEFYDTLGAEEFFES-KSKLNELEAEIVKVIVDELLKDGLEENDIGV 650

Query: 715 ITPYEGQRAYIVNYMSRNGALRQQLYKEIEVASVDSFQGREKDYIILSCVRSN-EHQGIG 773
           I+PY  Q + I   ++  G       K +EV +VD FQGREKD IILS VRSN +   IG
Sbjct: 651 ISPYRAQVSLIRRLLNEAG-------KGVEVGTVDGFQGREKDVIILSLVRSNDDKGEIG 703

Query: 774 FLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVEGPLNNLKQS 831
           FL DPRRLNVALTRA+  ++++G+   L   PL+  L+   K    L E  L +L+ +
Sbjct: 704 FLGDPRRLNVALTRAKRKLIVVGSSSTLESDPLYKRLINDLKRKGLLAELNLLDLRLT 761

Length = 767

>gnl\|CDD\|232945 TIGR00376, TIGR00376, DNA helicase, putative	Back alignment and domain information

>gnl\|CDD\|221913 pfam13087, AAA_12, AAA domain	Back alignment and domain information

>gnl\|CDD\|221912 pfam13086, AAA_11, AAA domain	Back alignment and domain information

>gnl\|CDD\|192286 pfam09416, UPF1_Zn_bind, RNA helicase (UPF2 interacting domain)	Back alignment and domain information

>gnl\|CDD\|222005 pfam13245, AAA_19, Part of AAA domain	Back alignment and domain information

>gnl\|CDD\|233417 TIGR01447, recD, exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>gnl\|CDD\|222258 pfam13604, AAA_30, AAA domain	Back alignment and domain information

>gnl\|CDD\|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|233418 TIGR01448, recD_rel, helicase, putative, RecD/TraA family	Back alignment and domain information

>gnl\|CDD\|236783 PRK10875, recD, exonuclease V subunit alpha; Provisional	Back alignment and domain information

>gnl\|CDD\|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG	Back alignment and domain information

>gnl\|CDD\|233210 TIGR00959, ffh, signal recognition particle protein	Back alignment and domain information

>gnl\|CDD\|224120 COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1021
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	100.0
TIGR00376		637	DNA helicase, putative. The gene product may repre	100.0
KOG1803		649	consensus DNA helicase [Replication, recombination	100.0
KOG1805		1100	consensus DNA replication helicase [Replication, r	100.0
KOG1807		1025	consensus Helicases [Replication, recombination an	100.0
COG1112		767	Superfamily I DNA and RNA helicases and helicase s	100.0
PF09416		152	UPF1_Zn_bind: RNA helicase (UPF2 interacting domai	100.0
KOG1801		827	consensus tRNA-splicing endonuclease positive effe	100.0
KOG1804		775	consensus RNA helicase [RNA processing and modific	100.0
PF13087		200	AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP	100.0
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	99.97
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	99.97
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	99.97
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	99.97
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	99.97
PRK10875		615	recD exonuclease V subunit alpha; Provisional	99.96
PRK11054		684	helD DNA helicase IV; Provisional	99.96
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	99.96
KOG1806		1320	consensus DEAD box containing helicases [Replicati	99.95
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	99.95
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	99.94
COG0210		655	UvrD Superfamily I DNA and RNA helicases [DNA repl	99.93
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	99.91
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	99.9
TIGR00609		1087	recB exodeoxyribonuclease V, beta subunit. All pro	99.9
COG1074		1139	RecB ATP-dependent exoDNAse (exonuclease V) beta s	99.89
PRK13826		1102	Dtr system oriT relaxase; Provisional	99.89
PRK13889		988	conjugal transfer relaxase TraA; Provisional	99.89
PRK13909		910	putative recombination protein RecB; Provisional	99.88
PRK10876		1181	recB exonuclease V subunit beta; Provisional	99.87
TIGR02784		1141	addA_alphas double-strand break repair helicase Ad	99.85
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	99.79
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	99.78
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	99.78
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	99.7
COG3973		747	Superfamily I DNA and RNA helicases [General funct	99.7
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	99.66
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	99.59
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	99.55
COG0507		696	RecD ATP-dependent exoDNAse (exonuclease V), alpha	99.54
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	99.49
COG3972		660	Superfamily I DNA and RNA helicases [General funct	99.46
PF13361		351	UvrD_C: UvrD-like helicase C-terminal domain; PDB:	99.31
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	99.3
PF13245		76	AAA_19: Part of AAA domain	99.24
PRK10536		262	hypothetical protein; Provisional	98.92
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	98.92
TIGR02773		1158	addB_Gpos ATP-dependent nuclease subunit B. DNA re	98.86
smart00487		201	DEXDc DEAD-like helicases superfamily.	98.72
KOG1804		775	consensus RNA helicase [RNA processing and modific	98.65
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	98.57
PF13538		104	UvrD_C_2: UvrD-like helicase C-terminal domain; PD	98.57
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	98.51
KOG2108		853	consensus 3'-5' DNA helicase [Replication, recombi	98.48
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	98.37
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	98.33
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	98.32
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	98.3
PHA02558		501	uvsW UvsW helicase; Provisional	98.23
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	98.22
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	98.15
PRK10689		1147	transcription-repair coupling factor; Provisional	98.14
PRK05580		679	primosome assembly protein PriA; Validated	98.11
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	98.03
PTZ00424		401	helicase 45; Provisional	98.02
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.02
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	97.97
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	97.96
PRK02362		737	ski2-like helicase; Provisional	97.94
PRK00254		720	ski2-like helicase; Provisional	97.9
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	97.86
PRK01172		674	ski2-like helicase; Provisional	97.85
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	97.83
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	97.83
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	97.81
PTZ00110		545	helicase; Provisional	97.74
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	97.71
COG1702		348	PhoH Phosphate starvation-inducible protein PhoH,	97.7
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	97.69
PRK13766		773	Hef nuclease; Provisional	97.68
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	97.63
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	97.6
PRK08181		269	transposase; Validated	97.57
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	97.57
PRK09401		1176	reverse gyrase; Reviewed	97.57
COG1204		766	Superfamily II helicase [General function predicti	97.55
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	97.54
PHA02653		675	RNA helicase NPH-II; Provisional	97.52
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	97.52
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	97.5
PRK06526		254	transposase; Provisional	97.48
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	97.47
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	97.44
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	97.44
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.42
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	97.42
PRK14974		336	cell division protein FtsY; Provisional	97.41
PRK04296		190	thymidine kinase; Provisional	97.38
PRK14701		1638	reverse gyrase; Provisional	97.38
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	97.36
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	97.35
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	97.34
TIGR00595		505	priA primosomal protein N'. All proteins in this f	97.34
PRK13767		876	ATP-dependent helicase; Provisional	97.33
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	97.31
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	97.29
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	97.25
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	97.24
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	97.23
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	97.2
COG1198		730	PriA Primosomal protein N' (replication factor Y)	97.18
COG4096		875	HsdR Type I site-specific restriction-modification	97.16
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	97.15
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	97.14
PRK08084		235	DNA replication initiation factor; Provisional	97.12
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	97.1
KOG0354		746	consensus DEAD-box like helicase [General function	97.1
KOG2108		853	consensus 3'-5' DNA helicase [Replication, recombi	97.06
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	97.04
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	97.03
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	96.98
PF13173		128	AAA_14: AAA domain	96.93
PHA03311		828	helicase-primase subunit BBLF4; Provisional	96.87
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	96.87
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	96.82
PRK12377		248	putative replication protein; Provisional	96.82
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	96.77
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	96.75
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	96.74
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	96.73
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	96.69
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.68
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	96.64
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	96.64
PRK00771		437	signal recognition particle protein Srp54; Provisi	96.64
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	96.64
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	96.63
PRK07952		244	DNA replication protein DnaC; Validated	96.63
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	96.61
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	96.6
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	96.58
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	96.54
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	96.53
COG4889		1518	Predicted helicase [General function prediction on	96.51
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	96.49
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	96.46
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	96.45
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	96.37
PRK04914		956	ATP-dependent helicase HepA; Validated	96.34
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	96.31
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	96.29
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	96.26
COG1201		814	Lhr Lhr-like helicases [General function predictio	96.25
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	96.24
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	96.22
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	96.17
TIGR00064		272	ftsY signal recognition particle-docking protein F	96.06
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	96.06
smart00382		148	AAA ATPases associated with a variety of cellular	96.04
PRK14087		450	dnaA chromosomal replication initiation protein; P	96.02
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	96.01
PHA03333		752	putative ATPase subunit of terminase; Provisional	96.01
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	96.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	96.0
PRK14088		440	dnaA chromosomal replication initiation protein; P	96.0
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	95.92
COG1205		851	Distinct helicase family with a unique C-terminal	95.91
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	95.91
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	95.89
COG2256		436	MGS1 ATPase related to the helicase subunit of the	95.88
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	95.83
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	95.79
PRK12422		445	chromosomal replication initiation protein; Provis	95.78
PRK00149		450	dnaA chromosomal replication initiation protein; R	95.75
KOG2028		554	consensus ATPase related to the helicase subunit o	95.74
COG1484		254	DnaC DNA replication protein [DNA replication, rec	95.74
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	95.71
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	95.69
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	95.67
PRK10416		318	signal recognition particle-docking protein FtsY;	95.67
KOG0987		540	consensus DNA helicase PIF1/RRM3 [Cell cycle contr	95.67
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	95.61
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	95.61
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	95.54
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	95.51
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	95.48
PRK08116		268	hypothetical protein; Validated	95.47
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	95.47
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	95.44
PRK05973		237	replicative DNA helicase; Provisional	95.43
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	95.43
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	95.39
cd03115		173	SRP The signal recognition particle (SRP) mediates	95.36
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	95.34
PF00004		132	AAA: ATPase family associated with various cellula	95.31
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	95.29
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	95.27
PRK06893		229	DNA replication initiation factor; Validated	95.27
PRK09183		259	transposase/IS protein; Provisional	95.24
PRK09112		351	DNA polymerase III subunit delta'; Validated	95.24
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	95.24
PRK08533		230	flagellar accessory protein FlaH; Reviewed	95.22
PRK09200		790	preprotein translocase subunit SecA; Reviewed	95.19
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	95.18
TIGR02774		1076	rexB_recomb ATP-dependent nuclease subunit B. DNA	95.16
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	95.15
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	95.14
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	95.13
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	95.12
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	95.11
PRK13833		323	conjugal transfer protein TrbB; Provisional	95.1
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	95.06
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	95.03
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	95.0
PRK10867		433	signal recognition particle protein; Provisional	94.96
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	94.96
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	94.93
PRK04328		249	hypothetical protein; Provisional	94.9
PRK06067		234	flagellar accessory protein FlaH; Validated	94.9
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	94.86
PF02689		818	Herpes_Helicase: Helicase; InterPro: IPR003840 Thi	94.85
PRK14086		617	dnaA chromosomal replication initiation protein; P	94.84
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	94.83
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	94.82
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	94.8
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	94.8
KOG0780		483	consensus Signal recognition particle, subunit Srp	94.78
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	94.75
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	94.72
PRK09694		878	helicase Cas3; Provisional	94.69
PRK13341		725	recombination factor protein RarA/unknown domain f	94.69
PRK10436		462	hypothetical protein; Provisional	94.69
PF05729		166	NACHT: NACHT domain	94.64
PRK08903		227	DnaA regulatory inactivator Hda; Validated	94.62
TIGR02533		486	type_II_gspE general secretory pathway protein E.	94.6
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	94.6
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	94.6
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	94.59
PRK08727		233	hypothetical protein; Validated	94.58
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	94.54
PRK06851		367	hypothetical protein; Provisional	94.54
TIGR00959		428	ffh signal recognition particle protein. This mode	94.51
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	94.5
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	94.49
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	94.49
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	94.47
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	94.46
PRK06921		266	hypothetical protein; Provisional	94.46
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	94.45
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	94.44
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	94.44
PRK06835		329	DNA replication protein DnaC; Validated	94.43
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	94.4
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	94.39
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	94.36
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	94.34
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	94.31
PHA03368		738	DNA packaging terminase subunit 1; Provisional	94.26
PRK14873		665	primosome assembly protein PriA; Provisional	94.24
TIGR02237		209	recomb_radB DNA repair and recombination protein R	94.2
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	94.18
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	94.15
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	94.13
PLN03025		319	replication factor C subunit; Provisional	94.12
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	94.1
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	94.02
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	93.96
cd01394		218	radB RadB. The archaeal protein radB shares simila	93.95
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	93.94
PRK05707		328	DNA polymerase III subunit delta'; Validated	93.9
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	93.88
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	93.87
PRK05642		234	DNA replication initiation factor; Validated	93.86
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	93.83
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	93.8
PRK00411		394	cdc6 cell division control protein 6; Reviewed	93.79
PRK07471		365	DNA polymerase III subunit delta'; Validated	93.78
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	93.74
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	93.73
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	93.69
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	93.68
KOG0781		587	consensus Signal recognition particle receptor, al	93.68
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	93.61
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	93.55
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	93.52
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	93.5
PRK12326		764	preprotein translocase subunit SecA; Reviewed	93.44
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	93.41
PF02374		305	ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_	93.39
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	93.35
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	93.33
KOG4284		980	consensus DEAD box protein [Transcription]	93.22
PF02492		178	cobW: CobW/HypB/UreG, nucleotide-binding domain; I	93.21
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	93.21
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	93.15
PHA00350		399	putative assembly protein	93.14
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	93.12
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	93.09
PRK12402		337	replication factor C small subunit 2; Reviewed	93.08
PRK08058		329	DNA polymerase III subunit delta'; Validated	93.07
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	93.05
PRK11823		446	DNA repair protein RadA; Provisional	93.03
PRK08939		306	primosomal protein DnaI; Reviewed	93.02
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	93.01
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	93.01
PRK09302		509	circadian clock protein KaiC; Reviewed	92.99
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	92.99
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	92.91
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	92.9
PRK08769		319	DNA polymerase III subunit delta'; Validated	92.88
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	92.88
cd00983		325	recA RecA is a bacterial enzyme which has roles in	92.86
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	92.76
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	92.64
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	92.57
PRK06851		367	hypothetical protein; Provisional	92.47
PRK04195		482	replication factor C large subunit; Provisional	92.46
PRK09302		509	circadian clock protein KaiC; Reviewed	92.43
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	92.41
PRK13768		253	GTPase; Provisional	92.39
COG0507		696	RecD ATP-dependent exoDNAse (exonuclease V), alpha	92.39
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	92.28
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	92.27
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	92.24
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	92.24
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	92.24
PF12846		304	AAA_10: AAA-like domain	92.22
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	92.21
PHA00729		226	NTP-binding motif containing protein	92.16
PTZ00112		1164	origin recognition complex 1 protein; Provisional	92.15
CHL00181		287	cbbX CbbX; Provisional	92.11
PRK07399		314	DNA polymerase III subunit delta'; Validated	92.05
PHA02544		316	44 clamp loader, small subunit; Provisional	92.0
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	91.97
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	91.9
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	91.84
PRK13531		498	regulatory ATPase RavA; Provisional	91.82
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	91.81
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	91.79
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	91.71
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	91.7
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	91.7
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	91.67
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	91.66
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	91.6
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	91.58
cd03114		148	ArgK-like The function of this protein family is u	91.51
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	91.49
PRK09354		349	recA recombinase A; Provisional	91.49
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	91.45
KOG1131		755	consensus RNA polymerase II transcription initiati	91.4
PF00265		176	TK: Thymidine kinase; InterPro: IPR001267 Thymidin	91.3
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	91.29
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	91.24
PRK03992		389	proteasome-activating nucleotidase; Provisional	91.1
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	91.09
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	91.08
COG3857		1108	AddB ATP-dependent nuclease, subunit B [DNA replic	91.06
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	91.03
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	90.98
PF13555		62	AAA_29: P-loop containing region of AAA domain	90.95
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	90.92
cd02117		212	NifH_like This family contains the NifH (iron prot	90.91
PRK09435		332	membrane ATPase/protein kinase; Provisional	90.9
PRK08233		182	hypothetical protein; Provisional	90.85
PRK13342		413	recombination factor protein RarA; Reviewed	90.77
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	90.77
PRK00440		319	rfc replication factor C small subunit; Reviewed	90.73
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	90.7
cd02034		116	CooC The accessory protein CooC, which contains a	90.68
PRK05541		176	adenylylsulfate kinase; Provisional	90.64
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	90.62
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	90.62
PRK08118		167	topology modulation protein; Reviewed	90.58
TIGR00767		415	rho transcription termination factor Rho. Members	90.57
smart00350		509	MCM minichromosome maintenance proteins.	90.57
COG2019		189	AdkA Archaeal adenylate kinase [Nucleotide transpo	90.51
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	90.49
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	90.42
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	90.41
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	90.4
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	90.39
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	90.38
COG3854		308	SpoIIIAA ncharacterized protein conserved in bacte	90.35
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	90.32
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	90.32
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	90.29
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	90.28
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	90.27
PRK12608		380	transcription termination factor Rho; Provisional	90.25
PHA02244		383	ATPase-like protein	90.2
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	90.14
PRK00889		175	adenylylsulfate kinase; Provisional	90.1
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	90.08
PRK14530		215	adenylate kinase; Provisional	90.04
PTZ00301		210	uridine kinase; Provisional	89.97
PF07726		131	AAA_3: ATPase family associated with various cellu	89.92
PRK03839		180	putative kinase; Provisional	89.91
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	89.88
COG0714		329	MoxR-like ATPases [General function prediction onl	89.84
PRK06762		166	hypothetical protein; Provisional	89.82
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	89.79
PRK00131		175	aroK shikimate kinase; Reviewed	89.76
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	89.64
PRK14531		183	adenylate kinase; Provisional	89.63
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	89.63
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	89.6
COG5192		1077	BMS1 GTP-binding protein required for 40S ribosome	89.57
PRK12904		830	preprotein translocase subunit SecA; Reviewed	89.53
PRK06620		214	hypothetical protein; Validated	89.51
PRK07667		193	uridine kinase; Provisional	89.51
COG1202		830	Superfamily II helicase, archaea-specific [General	89.5
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	89.49
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	89.46
TIGR00665		434	DnaB replicative DNA helicase. This model describe	89.34
PRK13764		602	ATPase; Provisional	89.33
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	89.28
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	89.28
PRK05298		652	excinuclease ABC subunit B; Provisional	89.22
PRK14532		188	adenylate kinase; Provisional	89.21
PRK08154		309	anaerobic benzoate catabolism transcriptional regu	89.16
PRK04040		188	adenylate kinase; Provisional	89.12
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	89.09
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	89.02
PRK13851		344	type IV secretion system protein VirB11; Provision	89.02
cd00550		254	ArsA_ATPase Oxyanion-translocating ATPase (ArsA).	88.96
PRK06696		223	uridine kinase; Validated	88.93
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	88.91
PRK14493		274	putative bifunctional molybdopterin-guanine dinucl	88.9
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	88.87
KOG1533		290	consensus Predicted GTPase [General function predi	88.86
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	88.84
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	88.84
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	88.83
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	88.77
COG3911		183	Predicted ATPase [General function prediction only	88.76
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	88.69
cd02037		169	MRP-like MRP (Multiple Resistance and pH adaptatio	88.69
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	88.68
PRK13107		908	preprotein translocase subunit SecA; Reviewed	88.65
PLN02200		234	adenylate kinase family protein	88.63
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	88.62
PRK02496		184	adk adenylate kinase; Provisional	88.62
PRK14527		191	adenylate kinase; Provisional	88.49
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	88.49
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	88.49
PRK06964		342	DNA polymerase III subunit delta'; Validated	88.48
PRK07261		171	topology modulation protein; Provisional	88.33
PRK05480		209	uridine/cytidine kinase; Provisional	88.33
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	88.25
PF00406		151	ADK: Adenylate kinase; InterPro: IPR000850 Adenyla	88.21
PRK14528		186	adenylate kinase; Provisional	88.18
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	88.17
cd02040		270	NifH NifH gene encodes component II (iron protein)	88.16
PF01656		195	CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai	88.14
cd03116		159	MobB Molybdenum is an essential trace element in t	88.14
PRK14494		229	putative molybdopterin-guanine dinucleotide biosyn	88.08
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	88.05
PHA02624		647	large T antigen; Provisional	88.0
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	87.99
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	87.96
PRK04301		317	radA DNA repair and recombination protein RadA; Va	87.91
PRK00279		215	adk adenylate kinase; Reviewed	87.9
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	87.86
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	87.78
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	87.76
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	87.74
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	87.7
COG0610		962	Type I site-specific restriction-modification syst	87.7
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	87.68
PRK06547		172	hypothetical protein; Provisional	87.67
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	87.57
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	87.57
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	87.56
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	87.55
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	87.48
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	87.4
TIGR01287		275	nifH nitrogenase iron protein. This model describe	87.34
PRK13235		274	nifH nitrogenase reductase; Reviewed	87.32
TIGR02016		296	BchX chlorophyllide reductase iron protein subunit	87.31
PHA00547		337	hypothetical protein	87.28
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	87.28
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	87.25
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	87.24
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	87.12
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	87.09
COG4178		604	ABC-type uncharacterized transport system, permeas	87.04
CHL00072		290	chlL photochlorophyllide reductase subunit L	86.92
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	86.91
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	86.89
PRK13947		171	shikimate kinase; Provisional	86.86
CHL00195		489	ycf46 Ycf46; Provisional	86.82
PRK13765		637	ATP-dependent protease Lon; Provisional	86.79
PRK05439		311	pantothenate kinase; Provisional	86.77
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	86.77
TIGR02236		310	recomb_radA DNA repair and recombination protein R	86.71
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	86.68
TIGR03575		340	selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti	86.63
cd02035		217	ArsA ArsA ATPase functionas as an efflux pump loca	86.59
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	86.49

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=6.2e-179  Score=1504.77  Aligned_cols=787  Identities=69%  Similarity=1.104  Sum_probs=729.3

Q ss_pred             cccccccccCCCccCcccCCcCCCcccccccCCCCCCceEEcCCCCcCceeeCCCCCCCcchhhhhhhhcccceeeecCC
Q 001718          118 MAGLSFEETGDDVEGFEYGKADFTEHACRYCGVSNPACVVRCNVPSCRKWFCNSRGNTSGSHIVNHLVRAKHKEVCLHKD  197 (1021)
Q Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~c~yc~~~~~~~~~~c~~~~~~~~fcn~~~~~~~sh~~~~l~~~~~~~~~~~~~  197 (1021)
                      +.++.|||-..+.+ ..+ +.++|+|+|+||||++|.||++|++  |+|||||+|++|++||||+||||++||+|+||+|
T Consensus        38 ~~e~~fee~~~~~~-~~~-~~~~~~~~c~Ycgi~~p~~v~kc~~--c~Kwfcn~r~gtsgshIv~hlvra~hk~v~lh~d  113 (935)
T KOG1802|consen   38 VGEVLFEECLVEKN-RAR-EQKLPEHACAYCGISEPACVIKCNT--CGKWFCNSRGGTSGSHIVNHLVRAKHKEVSLHKD  113 (935)
T ss_pred             cchhhhhhhccccc-ccc-ccccchhhhhhccCCCchheeeccc--cCceeecCCCCCchhHHHHHHHHhhhheeEeccC
Confidence            88999998555432 334 4599999999999999999999999  9999999999999999999999999999999999


Q ss_pred             CCCCccceeeecccccccccccceeccCCceEEEEechhhhH--------------------------------------
Q 001718          198 SPLGETILECYNCGCRNVFLLGFISAKTESVVVLLCREPCLN--------------------------------------  239 (1021)
Q Consensus       198 ~~~~~~~~~cy~~~~~n~f~lg~~~~~~~~~~~~~~r~~~~~--------------------------------------  239 (1021)
                      +++|||+||||+||++|||+|||||+|+|+|||++||+||++                                      
T Consensus       114 s~lget~lecyncg~~nvf~lGFi~~ksd~VVvllcr~pcas~s~~kd~Nwd~~qw~~li~dr~~l~wivk~pseqe~~~  193 (935)
T KOG1802|consen  114 SPLGETVLECYNCGSRNVFLLGFIPAKSDSVVVLLCRQPCASRSNLKDMNWDLSQWQPLIEDRCLLSWIVKVPSEQEQLR  193 (935)
T ss_pred             CCCCcceEEeeccCcchhhhhcccccccCceEEEEecCcccccccCCCcCCChhhccchhhhhcccchhccCCcchhhhh
Confidence            999999999999999999999999999999999999999986                                      


Q ss_pred             -----------------------------------------------------------------HhhhccccccEEEEE
Q 001718          240 -----------------------------------------------------------------MMKESQSKDNVTIRW  254 (1021)
Q Consensus       240 -----------------------------------------------------------------~~~e~~~~~~~~~~~  254 (1021)
                                                                                       .+||||++++++|||
T Consensus       194 aR~iT~qqi~~~eelwr~np~at~~dl~kP~~d~~~~hv~~ry~da~~y~~vf~pliklea~ydk~~Kes~~q~~~tvRW  273 (935)
T KOG1802|consen  194 ARKITAQQIVKLEELWRKNPSATLEDLDKPGEDEEPPHVQLRYEDAYEYQNVFSPLIKLEADYDKRLKESQTQENGTVRW  273 (935)
T ss_pred             hccccHHHHHHHHhhhccCCccchhhcCCcccccCCCcccccccchHHHhhhcchhhhhhhhhhhhhhhhcccccceEEe
Confidence                                                                             699999999999999


Q ss_pred             EecCCCeEEEEEEccCCCCCCCCCCCCEEEEEeCCCCCCCcceEEEEEEEecC--ccEEEEEeccCCCCCcccCCCceEE
Q 001718          255 DIGLNKKRVAYFVFPKEDNELRLVPGDELRLRYSGDAAHPAWQSVGHVIKLTA--QEEVALELRASQGVPVDINHGFSVD  332 (1021)
Q Consensus       255 ~~~l~~k~~~~~~~~~~~~~~~~~~GD~v~l~~~~~~~~~~~~~~g~V~~i~~--~~~v~l~l~~~~~~p~~~~~~~~v~  332 (1021)
                      ++|||+|+++||.+++-+.++++..||+++|+|+++ ....|.++|+|+++++  ++|+.||++.....|.+.+++|.|+
T Consensus       274 ~~gLnkk~~a~f~~~k~~~e~kl~~GdE~~L~y~~~-~~~~w~~~g~v~~~pd~~~dE~~lEl~~~~~~p~e~~~~Ftvd  352 (935)
T KOG1802|consen  274 DIGLNKKRLAYFTLPKLDSELKLAIGDEIRLTYSGG-LVLPWNGIGSVLKIPDNNGDEVKLELEFSQDPPIEVTHGFTVD  352 (935)
T ss_pred             eeccccceEEEEecCCCcchhccccCCeeEEEecCC-cCCcccccceEEecCCCCcceeEEEeecCCCCCcccccceEEE
Confidence            999999999999999998899999999999999998 5566999999999998  6999999999999999999999999


Q ss_pred             EeeccchHHHHHHHHHHHHHhhhchhhhHHhhhcCCchhhhhhcccCCCCCCCCCCCCCCHHHHHHHHHHhcCCcEEEEC
Q 001718          333 FVWKSTSFDRMQGAMKTFAVDETSVSGYIYHHLLGHEVEVQMVRNTLPRRFGAPGLPELNASQVFAVKSVLQRPISLIQG  412 (1021)
Q Consensus       333 ~~~~~~s~~R~~~AL~~~~~~~~~~~~~i~~~llg~~~~~~~~~~~lp~~~~~~~~~~LN~sQ~~AV~~al~~~l~LIqG  412 (1021)
                      |+|+.++|+||+.||+.|+.|+.+++.|+|+.+||+++++..++..+|+.|..|++++||.+|..||+++|+++++||||
T Consensus       353 ~vwk~ts~drm~~alk~la~D~~~vs~y~y~klLgh~~~~~~~k~~LP~~~s~~~lpkLN~SQ~~AV~~VL~rplsLIQG  432 (935)
T KOG1802|consen  353 FVWKSTSFDRMQLALKLLAVDEKKVSGYLYHKLLGHPVEDSSLKKLLPRRFSVPNLPKLNASQSNAVKHVLQRPLSLIQG  432 (935)
T ss_pred             EEEcCccHHHHHHHHHHhhhccccchhhhhhHHhcCcchhhhhcccCchhhcCCCchhhchHHHHHHHHHHcCCceeeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcHHHHHHHHHHHHHHcCCCcEEEEcCcHHHHHHHHHHHHhcCCeEEEeccccccccCCcchhhhHHHHHhhccchh
Q 001718          413 PPGTGKTVTSAAIVYHMAKQGQGQVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLDTSE  492 (1021)
Q Consensus       413 PPGTGKTtTla~iI~~L~k~~~~rILV~ApSN~AvDeL~eRL~~~gl~ivRlg~~sre~i~~~~~~l~l~~~i~~l~~~~  492 (1021)
                      |||||||.|+++||++|+++...+||||||||.|||+|+++|++.+++|||+.+++||.++++++++++|.+++.+..  
T Consensus       433 PPGTGKTvtsa~IVyhl~~~~~~~VLvcApSNiAVDqLaeKIh~tgLKVvRl~aksRE~~~S~vs~L~lh~~~~~~~~--  510 (935)
T KOG1802|consen  433 PPGTGKTVTSATIVYHLARQHAGPVLVCAPSNIAVDQLAEKIHKTGLKVVRLCAKSREDIESDVSFLSLHEQLRNMDK--  510 (935)
T ss_pred             CCCCCceehhHHHHHHHHHhcCCceEEEcccchhHHHHHHHHHhcCceEeeeehhhhhhccCCccHHHHHHHHhccCc--
Confidence            999999999999999999998889999999999999999999999999999999999999999999999999999876  


Q ss_pred             HHHHHHHHHhhhhhccCChhHHHHHHHHHHHHHHHHhhccceeeecccccCCCCcccCCCCEEEEECCCCCCchhhhhhh
Q 001718          493 KSELHKLQQLKDEQGELSSSDEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPL  572 (1021)
Q Consensus       493 ~~~l~kl~~lk~~~~~ls~~~~k~~~~l~~~~~~~iL~~a~VI~~T~~~a~~~~L~~~~Fd~VIIDEAsQ~se~e~LipL  572 (1021)
                       .+++++.+++++.++++..++++|+.+++..+++++..|+||||||++|++.+|.+++|..||||||.|++||++||||
T Consensus       511 -pELq~l~klkde~gelS~sD~~k~~~lk~~~e~ell~~AdVIccTcv~Agd~rl~~~kfr~VLiDEaTQatEpe~LiPl  589 (935)
T KOG1802|consen  511 -PELQKLLKLKDEGGELSSSDEKKYRKLKRAAEKELLNQADVICCTCVGAGDRRLSKFKFRTVLIDEATQATEPECLIPL  589 (935)
T ss_pred             -HHHHHHHhhhhhcccccchhhHHHHHHHHHHHHHHHhhcCEEEEecccccchhhccccccEEEEecccccCCcchhhhh
Confidence             8899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCceEEEeCCccCCCceeecHHHHHhcchHHHHHHHHHcCCcceEeeEeeccCCCCCCccccccccCccccccccccc
Q 001718          573 VLGAKQVVLVGDHCQLGPVIMCKKAARAGLAQSLFERLVLLGLKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTINER  652 (1021)
Q Consensus       573 ~~~~krlILVGD~~QLpPvv~s~~a~~~gl~~SLFeRL~~~g~~~i~L~~qYRm~p~I~~f~s~~FY~g~L~~~~~~~~r  652 (1021)
                      +++++++||||||+||+|++++++++.++|.+||||||+..|..+++|.+||||||.|++|++++||+|.|+++++..+|
T Consensus       590 vlG~kq~VlVGDh~QLgpvi~~kK~a~Agl~qsLferli~lg~~P~~L~vQYRmhP~lSefpsn~fY~G~LqnGVT~~~R  669 (935)
T KOG1802|consen  590 VLGAKQLVLVGDHKQLGPVIMCKKAATAGLSQSLFERLISLGIKPIRLQVQYRMHPALSEFPSNMFYEGELQNGVTEIER  669 (935)
T ss_pred             hhcceeEEEeccccccCceeeeHHHHHhHHHHHHHHHHHhccCCceEEEEeeeeChhhhhcchhhhccchhhcCcchhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCCCCCCCeEEEEeCCceeecccCCCccCHHHHHHHHHHHHHHHHcCCCCCcEEEEcccchHHHHHHHHHHhc
Q 001718          653 QSSGIDFPWPVPNRPMFFYVQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIVNYMSRN  732 (1021)
Q Consensus       653 ~~~~~~~~~p~~~~p~~f~~~~g~ee~~~~~~S~~N~~EA~~V~~iV~~Ll~~gv~~~dIgIITPY~aQ~~~L~~~L~~~  732 (1021)
                      ...+++++||.++.|++|+...|.|++..+|+||.|+.||..++++|+.|++.|+.+++|||||||++|+.+|.++|...
T Consensus       670 ~~~g~~~pwp~p~~pl~fy~~~g~eeisasGtSf~Nr~Ea~~~ekii~~l~~~gv~~~qIGVITpYegQr~~i~~ym~~~  749 (935)
T KOG1802|consen  670 SPLGVDFPWPQPDKPLFFYVCYGQEEISASGTSFLNRTEAANCEKIITKLLKSGVKPSQIGVITPYEGQRSYIVNYMQTN  749 (935)
T ss_pred             ccCCCCCCCCCCCCccceEEeccceeeeccccceecHHHHHHHHHHHHHHHHcCCCHHHeeeecccchhHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhhhccCCeEEeecccCCCccccEEEEEccccCCCCCcCCCCCcCceeeechhhccceEEEeccccccCChhHHHHHH
Q 001718          733 GALRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLT  812 (1021)
Q Consensus       733 ~~~~~~~~~~V~V~TVdsfQG~E~DvVIlS~Vrsn~~~~iGFl~d~RrLnVALTRAK~~LiIVGn~~~Ls~~~~W~~ll~  812 (1021)
                      +.+...++..|+|+|||+|||+|+|+||+||||+|...+|||+.|+|||||||||||++|+||||+.+|+++++|.++|.
T Consensus       750 gsl~~~ly~~veVasVDaFQGrEKdfIIlSCVRsn~~qgIGFl~d~RRlNVaLTRaK~glvivGN~~~L~k~~LW~~li~  829 (935)
T KOG1802|consen  750 GSLHKDLYKEVEVASVDAFQGREKDFIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGLVIVGNPKVLRKHPLWGHLIT  829 (935)
T ss_pred             CccccchhheeEEEeeccccCcccceEEEEEeecccccccccccCchhhhhhhhhcccceEEecCHHHhhhchHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCceecCCCcchhhhhhhcccCccccccccccccCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 001718          813 HYKEHECLVEGPLNNLKQSMVQFQKPKKIYNDRRLFFGAGPGIVPNDI-STSNPNADRRGSRARGYMPPGPPNGTHKPGL  891 (1021)
Q Consensus       813 ~~~~~~~l~~~~l~~l~~s~~~~~~p~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  891 (1021)
                      |+++++++++|++++++++++++.+|.++.+.++...+........+. ...++...+..++...|.+.....+...   
T Consensus       830 h~~eke~l~eg~ln~l~~~~~~l~kp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~y~~~~n~~~~~~---  906 (935)
T KOG1802|consen  830 HYKEKEVLVEGPLNNLKPSLLQLLKPQKLKNFKEKQKGFMNKSKIKDKSHSFNPSASNRPSRLSSYLNSGNLFGMSK---  906 (935)
T ss_pred             HhhcccceeecchhhhhhhhhhhcCCchhhhhhhhhhhhhhhcccccccccCCcchhccccccchhccccCcccccC---
Confidence            999999999999999999999999999999887665433222222221 1233333333444444544433333221   


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCC
Q 001718          892 HPAGFPMPRVPLPPFQGGPPSQPYA  916 (1021)
Q Consensus       892 ~~~~~~~~~~~~p~~~~~p~~~~~~  916 (1021)
                       ++.......+-|.....||.++++
T Consensus       907 -~~~~~~~~~~~~~~~~~~~~~~~~  930 (935)
T KOG1802|consen  907 -LAQYFNKNVPIPANMVGPPSQKAA  930 (935)
T ss_pred             -hhhccccCCCCchhhcCCCccccc
Confidence             233344455555556666555553

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG1807 consensus Helicases [Replication, recombination and repair]	Back alignment and domain information

>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PF09416 UPF1_Zn_bind: RNA helicase (UPF2 interacting domain); InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation	Back alignment and domain information

>KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification]	Back alignment and domain information

>KOG1804 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair]	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>TIGR00609 recB exodeoxyribonuclease V, beta subunit	Back alignment and domain information

>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>PRK13909 putative recombination protein RecB; Provisional	Back alignment and domain information

>PRK10876 recB exonuclease V subunit beta; Provisional	Back alignment and domain information

>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair]	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>COG3972 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>TIGR02773 addB_Gpos ATP-dependent nuclease subunit B	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG1804 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PHA03311 helicase-primase subunit BBLF4; Provisional	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>KOG0987 consensus DNA helicase PIF1/RRM3 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02774 rexB_recomb ATP-dependent nuclease subunit B	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PF02689 Herpes_Helicase: Helicase; InterPro: IPR003840 This entry consists of DNA helicases from a number of different organisms	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA00350 putative assembly protein	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>COG3857 AddB ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair]	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA)	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>KOG1533 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>COG3911 Predicted ATPase [General function prediction only]	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase	Back alignment and domain information

>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>PHA02624 large T antigen; Provisional	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>TIGR01287 nifH nitrogenase iron protein	Back alignment and domain information

>PRK13235 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>TIGR02016 BchX chlorophyllide reductase iron protein subunit X	Back alignment and domain information

>PHA00547 hypothetical protein	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>CHL00072 chlL photochlorophyllide reductase subunit L	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic	Back alignment and domain information

>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

Homologous Structure Templates