Citrus Sinensis ID: 001728


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020
MKPPANGFLPSSAEGERKTINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKENDFIPNYPNLPSKLICMLHSVTLHADPETDEVYAQMTLQPVNKYEKEAILASDMGLKQNRQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYSMQPPAQEIVARDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKSQLLLGIRRANRQQPALSSSVISSDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVSLGMRFRMMFETEESGVRRYMGTITSISDLDPLRWKNSQWRNLQVGWDESTAGERPSRVSLWETEPVVTPFYICPPPFFRPKFPKQPGMPDDESDIENAFKRAMPWLGDDFGMKDATSSIFPGLSLVQWMSMQQNNQFPAAQSGFFPSMVSSTGLHSNFGTDDPSKLLNFQASALAAPNLQFSKANPQNQVNQLPQSPIAWTQQQQLQHLLQNPLNQQQQQHPQLHQQRQQQQQLLHPQQSQQQQQQQQNHHHHNQQPPPPPQLQPSPTPPHSQSQSQSPVPQRPQQQPQQQQQQPQQQIFLPTHVNNGVLVPNANQNVQQPTVYSQLQQPQLLTSNTQAPQGILSNNKNSYQLTSLPQDSQFQQQMEQSTGPLQRQQQQSQLQQSSLQFLQQSLAQRAQQQPQVQQLAQQSMSDQQLQSQLQQKLQQQQQQQLLSPAGSLLQPQLLQQQLAHQQNQQLSQLPPSQNHQQQLSNNLSASVLVQPQQLPMNQPQNQNRPLTGTRAHSNHTDGDAPSCSTSPSSNNCQISPSNFLNRNQQGPAMLMGDSVVEPSSNLVQELHSKSDARIKHELPISKGPEHLKYNGSMTDQVEASSSGTSYCLDPGNIQQNFSLPTYCLDGDTQSHPRNSLPFVANIDGMAPDTLLSRGYDSQKDLHNLLSNYGGTPRDIETELSTAAISSQSFAVPNIPFKPACSNEVGINEAGVLGNGLWANQTQRMRTFTKVCYAIYSL
cccccccccccccccccccccHHHHHHcccccccccccccEEEEcccccHHHccccccccccccccccccccccEEEEEEEEEEcccccccEEEEEEEEEcccccHHHcccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEccccccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccccccccEEEEHHHHHHHHccccccccEEEEEEcccccccEEEEEEEEECccccccccccccccEEEEEcccccccccccccccccECccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHcccccHHcHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccc
*******************INSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVA*******DFIPNYPNLPSKLICMLHSVTLHADPETDEVYAQMTLQPVNK****AILAS**********TEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYSMQPPAQEIVARDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKSQLLLGIRR*****************MHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVSLGMRFRMMFETEESGVRRYMGTITSISDLDPLRWKNSQWRNLQVGWDESTAGERPSRVSLWETEPVVTPFYICPPPFFR*******************FKRAMPWLGDDFGMKDATSSIFPGLSLVQWMSM**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YCLDPGNIQQNFSLPTYCLDGDTQSHPRNSLPFVANIDGMAPDTLLSRGYDSQKDLHNLLSNYG************A*****SFAVPNIPFKPACSNEVGINEAGVLGNGLWANQTQRMRTFTKVCYAIYSL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPPANGFLPSSAEGERKTINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKENDFIPNYPNLPSKLICMLHSVTLHADPETDEVYAQMTLQPVNKYEKEAILASDMGLKQNRQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYSMQPPAQEIVARDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKSQLLLGIRRANRQQPALSSSVISSDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVSLGMRFRMMFETEESGVRRYMGTITSISDLDPLRWKNSQWRNLQVGWDESTAGERPSRVSLWETEPVVTPFYICPPPFFRPKFPKQPGMPDDESDIENAFKRAMPWLGDDFGMKDATSSIFPGLSLVQWMSMQQNNQFPAAQSGFFPSMVSSTGLHSNFGTDDPSKLLNFQASALAAPNLQFSKANPQNQVNQLPQSPIAWTQQQQLQHLLQNPLNQQQQQHPQLHQQRQQQQQLLHPQQSQQQQQQQQNHHHHNQQPPPPPQLQPSPTPPHSQSQSQSPVPQRPQQQPQQQQQQPQQQIFLPTHVNNGVLVPNANQNVQQPTVYSQLQQPQLLTSNTQAPQGILSNNKNSYQLTSLPQDSQFQQQMEQSTGPLQRQQQQSQLQQSSLQFLQQSLAQRAQQQPQVQQLAQQSMSDQQLQSQLQQKLQQQQQQQLLSPAGSLLQPQLLQQQLAHQQNQQLSQLPPSQNHQQQLSNNLSASVLVQPQQLPMNQPQNQNRPLTGTRAHSNHTDGDAPSCSTSPSSNNCQISPSNFLNRNQQGPAMLMGDSVVEPSSNLVQELHSKSDARIKHELPISKGPEHLKYNGSMTDQVEASSSGTSYCLDPGNIQQNFSLPTYCLDGDTQSHPRNSLPFVANIDGMAPDTLLSRGYDSQKDLHNLLSNYGGTPRDIETELSTAAISSQSFAVPNIPFKPACSNEVGINEAGVLGNGLWANQTQRMRTFTKVCYAIYSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Auxin response factor 19 Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).probableQ0D9R7
Auxin response factor 16 Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).probableA3B9A0
Auxin response factor 19 Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Involved in ethylene responses. Regulates lateral root formation through direct regulation of LBD16 and/or LBD29. Functionally redundant with ARF7.probableQ8RYC8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WID, chain A
Confidence level:confident
Coverage over the Query: 120-236
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 627-702
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 627-702
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 627-702
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 627-702
View the alignment between query and template
View the model in PyMOL
Template: 3LJ5, chain A
Confidence level:probable
Coverage over the Query: 453-591,617-803
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 627-702
View the alignment between query and template
View the model in PyMOL