Citrus Sinensis ID: 001741


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------102
MGDNKGDTTKKQKSQQPQQLQQQQQQPQQQQLSSSPKNPLEESTEKGQHHHQQPPAVVVTGAPYISAPLYVPIGPTSSSPFEQQFEPVNPKRQRYNSSQWKLLPSPSQQQQQKQQAQMAILTTESSPSPTTLPITNPQSQAHTTTASSSDTASSPPHSPIPSLSAASGQETNRPELLGEQFHPQFRKGKYVSPVWKPNEMLWLARAWRIQYQGGGGSNGSGSSSRVDHHQPESTGQGEVAAAAQSTRAKTRADKDREVAEFLQRHGVNRDAKTSGTKWDNMLGEFRKVYEWERGGEREQVGKSYFRLSPYERKLHRLPASFDEEVFEELSQFMGSRMRSTSQSRAASSVFVSSDHDNRSTRALPPPPPFKEDELSLSARAKQLVMTSGGEAFFHGGRGSLLGFESSLDVGSKELRRIGRIRMTWEESVSLWAEEGEHQRGRIKLQGSSFLNADELTFFDDAMVACNMEAFEEGTLRGFSVDRFVPGQQVKVFGRRKSSSGSASASSAGFFERVQFPFTEPSIRFTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQEPPPEEFRFPIRKDVYRDLPQGKEIFFTTSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKFCSSEMVIVRKPSSSSISSPEPLQDQWPNVTGFVRNLCLWRGEETDQLKEGQLDPSSSIVEKLLWTYMDLPYLFGYYAVGYIVTFCALSRSQDRVVRTDLYSLDLSSPVERLKALIPCYRIAGLLPLLADRCFNSSSSIISNGGGGYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQLVAAVAGGVEARGRHAPEMGRPGLHGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELRPTAADCYHHLLQLQSSLSVAAASSSTAPY
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHcHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccHHHHHHHcHHHHHHccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccHHHHHHHHcccccccccccccHHHHHHcccccccEEccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccEEEEEccEEEEEEcccccccccccccHHHHHHHHccccccccEEEEEEEcccEEEEEEEEcccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEccccEEEEEEcccEEEEccHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccccccEEEEEccccccccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccc
cccccccccccccccccccHHHHHHcHHHccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccHHEccccccHHccccHHcEEEccccccccccccccccccccccccEEcccccccccccccccccccccccccccccHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHccHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccccccHccccccccccccccccccEccEEEEEccccccccccccccccccHHHcccHHHHHHHccEEEcHHHHHHHHHHcccccccEEEEEccccccccHHHHcccccccccHHHHccccccccEEEcEccccEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHEEEEccccccccHHHHHHHHccccccccccccccHHHHcccccccEEEEccccccccccEcHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHccccEEEEEccEEEEEccccccccccccccHHHHHHHHEEEcccccEEEEEEEcccEEEEEEEEEccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHEccccccEEEEccccEEEEEcccEEEEEEcccEEEccccHHHHHHHHHHHHHHHcccccccEEEEccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHEEEEccccccEEEEEHHHHcccccccccccHHHHcccHHccccccccccccccccEEEEEEHHHHHHcccccccHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHHHHHHHHHHccccc
mgdnkgdttkkqksqqpQQLQQQqqqpqqqqlssspknpleestekgqhhhqqppavvvtgapyisaplyvpigptssspfeqqfepvnpkrqrynssqwkllpspsqQQQQKQQAQMAILttesspspttlpitnpqsqahtttasssdtasspphspipslsaasgqetnrpellgeqfhpqfrkgkyvspvwkpneMLWLARAWRIQyqggggsngsgsssrvdhhqpestgqgEVAAAAQSTRAKTRADKDREVAEFLQRhgvnrdaktsgtkwdNMLGEFRKVYewerggereqvgksyfrlspyerklhrlpasfdEEVFEELSQFMGsrmrstsqsraassvfvssdhdnrstralpppppfkedelSLSARAKQLVMTsggeaffhggrgsllgfesslDVGSKELRRIGRIRMTWEESVSLWAEEgehqrgriklqgssflnadeltffDDAMVACNMEAfeegtlrgfsvdrfvpgqqvkvfgrrksssgsasassagffervqfpftepsirftpweyqdpsdyyvgclrvppttlpslfelswhlqepppeefrfpirkdvyrdlpqgkeifFTTSTElldcraitydilspivrgnnpslsfstaasrdsFIGLWDDCINRVVSKFcssemvivrkpssssisspeplqdqwpnvtGFVRNLclwrgeetdqlkegqldpssSIVEKLLWTYMDLPYLFGYYAVGYIVTFCALsrsqdrvvrtdlysldlsspveRLKALIPCYRIAGLLplladrcfnssssiisnggggykqypfsdferidlgsgniiemtpnTVTRFFSSKRKWAAVKQIYDFLdhriphaeaIYESSEKDLALvfkprgcklkptsCEQLVEALKYVTKALVALHDLSFmhkdlswdkvmrrsdrenewfvsgfdeaasapqiyPQLVAAVAGgveargrhapemgrpglhgvkvdvWGVGQlvktcglsnvPKMLRELQNRcldqnpelrptaADCYHHLLQLQSSLSVAAASSSTAPY
mgdnkgdttkkqksqqpQQLQQQQQQPQQQQLSSSPKNPLEESTEKGQHHHQQPPAVVVTGAPYISAPLYVPIGPTSSSPFEQQFEPVNPKRQRYNSSQWKLLPSPSQQQQQKQQAQMAILTTESSPSPTTLPITNPQSQAHTTTASSSDTASSPPHSPIPSLSAASGQETNRPELlgeqfhpqfrkgkyvspvWKPNEMLWLARAWRIQYQGGGGSNGSGSSSRVDHHQPESTGQGEVAAAAQSTraktradkdREVAEflqrhgvnrdaktsgtkwdnmlGEFRKVyewerggereqvgksyfrlsPYERKLhrlpasfdEEVFEELSQFMGSRMRSTSQSRAASSvfvssdhdnrstralpppppfKEDELSLSARAKQLVMTSGGEAFFHGGRGSLLGFESSLDVGSKELRRIGRIRMTWEESVSLWAEEGEHQRGRIKLQGSSFLNADELTFFDDAMVACNMEAFEEGTLRGFSVDRFVPGQQVkvfgrrksssgsasassagffervqFPFTEPSIRFTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQEPPPEEFRFPIRKDVYRDLPQGKEIFFTTSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKFCSSEMVIVRkpssssisspeplqdqwpnVTGFVRNLCLWRGEEtdqlkegqldpsSSIVEKLLWTYMDLPYLFGYYAVGYIVTFCALSRSQDRVVRTDLysldlsspverLKALIPCYRIAGLLPLLADRCFNSSSSIISNGGGGYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSfmhkdlswdkVMRRSDRENEWFVSGFDEAASAPQIYPQLVAAVAGGVEARGRHApemgrpglhgVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELRPTAADCYHHLLQLQSslsvaaassstapy
MGDNKGDTTkkqksqqpqqlqqqqqqpqqqqlssspkNPLEESTEKGQHHHQQPPAVVVTGAPYISAPLYVPIGPTSSSPFEQQFEPVNPKRQRYNssqwkllpspsqqqqqkqqaqMAilttesspspttlpitNpqsqahtttasssdtasspphspipslsaasGQETNRPELLGEQFHPQFRKGKYVSPVWKPNEMLWLARAWRIQYQggggsngsgsssRVDHHQPESTGQGEVAAAAQSTRAKTRADKDREVAEFLQRHGVNRDAKTSGTKWDNMLGEFRKVYEWERGGEREQVGKSYFRLSPYERKLHRLPASFDEEVFEELSQFMGSRMRSTSQSRAASSVFVSSDHDNRSTRALPPPPPFKEDELSLSARAKQLVMTSGGEAFFHGGRGSLLGFESSLDVGSKELRRIGRIRMTWEESVSLWAEEGEHQRGRIKLQGSSFLNADELTFFDDAMVACNMEAFEEGTLRGFSVDRFVPGQQVKVFGRRKsssgsasassagFFERVQFPFTEPSIRFTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQepppeeFRFPIRKDVYRDLPQGKEIFFTTSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKFCSSEMVIVRKPssssissPEPLQDQWPNVTGFVRNLCLWRGEETDQLKEGQLDPSSSIVEKLLWTYMDLPYLFGYYAVGYIVTFCALSRSQDRVVRTDLYSLDLSSPVERLKALIPCYRIAGLLPLLADRCFnssssiisnggggYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQLvaavaggveargrhaPEMGRPGLHGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELRPTAADCYHHllqlqsslsvaaassstaPY
********************************************************VVVTGAPYISAPLYVPI*************************************************************************************************************PQFRKGKYVSPVWKPNEMLWLARAWRIQYQ***************************************************************TKWDNMLGEFRKVYEWERGGEREQVGKSYFRLSPYERKLH************************************************************************GGEAFFHGGRGSLLGFESSLDVGSKELRRIGRIRMTWEESVSLWAEEGEHQRGRIKLQGSSFLNADELTFFDDAMVACNMEAFEEGTLRGFSVDRFVPGQQVKVF***************GFFERVQFPFTEPSIRFTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQEPPPEEFRFPIRKDVYRDLPQGKEIFFTTSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKFCSSEMVIV*****************WPNVTGFVRNLCLW******************IVEKLLWTYMDLPYLFGYYAVGYIVTFCALSRSQDRVVRTDLYSLDLSSPVERLKALIPCYRIAGLLPLLADRC**************YKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQLVAAVAGGVEARGR****MGRPGLHGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELRPTAADCYHHLLQL****************
******************************************************************************************************************************************************************************************************EMLWLARA*************************************************REVAEFLQRHGVNRDAKTSGTKWDNMLGEFRKVYEWER**********YFRLSPYERKLHRLPASFDEEVFEELS***********************************************************************************LRRIGRIRMTWEESVS************IKLQGSSFLNADELTFFDDAMVACNMEAFEEGTLRGFSVDRFVPGQ*************************VQFPFTE*SIRFTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQEPPPEEFRFPIRKDVYRDLPQGKEIFFTTSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKFCSSEMVIV***************DQWPNVTGFVRNLCLWRGEET************SIVEKLLWTYMDLPYLFGYYAVGYIVTFCALSRSQDRVVRTDLYSLDLSSPVERLKALIPCYRIAGLLPLLADRCF*****************PFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIY*Q**AAVAGGVEARGRHAPEMGRPGLHGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELRPTAADCYHHLLQ*****************
******************************************************PAVVVTGAPYISAPLYVPIGPTSSSPFEQQFEPVNPKRQRYNSSQ*********************LTTESSPSPTTLPIT************************************NRPELLGEQFHPQFRKGKYVSPVWKPNEMLWLARAWRIQYQ********************************************EVAEFLQRHGVNRDAKTSGTKWDNMLGEFRKVYEWERGGEREQVGKSYFRLSPYERKLHRLPASFDEEVFEELSQF*****************************ALPPPPPFKEDELSLSARAKQLVMTSGGEAFFHGGRGSLLGFESSLDVGSKELRRIGRIRMTWEESVSLWAEEGEHQRGRIKLQGSSFLNADELTFFDDAMVACNMEAFEEGTLRGFSVDRFVPGQQVKV***************AGFFERVQFPFTEPSIRFTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQEPPPEEFRFPIRKDVYRDLPQGKEIFFTTSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKFCSSEMVI****************DQWPNVTGFVRNLCLWRGEETDQLKEGQLDPSSSIVEKLLWTYMDLPYLFGYYAVGYIVTFCALSRSQDRVVRTDLYSLDLSSPVERLKALIPCYRIAGLLPLLADRCFNSSSSIISNGGGGYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQLVAAVAGGVEARGRHAPEMGRPGLHGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELRPTAADCYHHLLQLQSSL************
*****************************************************PPAVVVTGAPYISAPLYVPIGPTSSSPFEQQFEPVNPKRQRYNSSQWKLLPS********************************************************************PELLGEQFHPQFRKGKYVSPVWKPNEMLWLARAWRIQYQG*************************************RADKDREVAEFLQRHGVNRDAKTSGTKWDNMLGEFRKVYEWERGGEREQVGKSYFRLSPYERKLHRLPASFDEEVFEELSQFMGS***********************STRALPPPPPFKEDELSLSARAKQLVMTSGGEAFFHGGRGSLLGFESSLDVGSKELRRIGRIRMTWEESVSLWAEEGEHQRGRIKLQGSSFLNADELTFFDDAMVACNMEAFEEGTLRGFSVDRFVPGQQVKVFGRR****************RVQFPFTEPSIRFTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQEPPPEEFRFPIRKDVYRDLPQGKEIFFTTSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKFCSSEMVIVRKPSSSSISSPEPLQDQWPNVTGFVRNLCLWRGEETDQLKEGQLDPSSSIVEKLLWTYMDLPYLFGYYAVGYIVTFCALSRSQDRVVRTDLYSLDLSSPVERLKALIPCYRIAGLLPLLADRCFNSSSSIISNGGGGYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQLVAAVAGG*************PGLHGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELRPTAADCYHHLLQLQSSLSVAAA*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDNKGDTTKKQKSQQPQQLQQQQQQPQQQQLSSSPKNPLEESTEKGQHHHQQPPAVVVTGAPYISAPLYVPIGPTSSSPFEQQFEPVNPKRQRYNSSQWKLLPSPSQQQQQKQQAQMAILTTESSPSPTTLPITNPQSQAHTTTASSSDTASSPPHSPIPSLSAASGQETNRPELLGEQFHPQFRKGKYVSPVWKPNEMLWLARAWRIQYQGGGGSNGSGSSSRVDHHQPESTGQGEVAAAAQSTRAKTRADKDREVAEFLQRHGVNRDAKTSGTKWDNMLGEFRKVYEWERGGEREQVGKSYFRLSPYERKLHRLPASFDEEVFEELSQFMGSRMRSTSQSRAASSVFVSSDHDNRSTRALPPPPPFKEDELSLSARAKQLVMTSGGEAFFHGGRGSLLGFESSLDVGSKELRRIGRIRMTWEESVSLWAEEGEHQRGRIKLQGSSFLNADELTFFDDAMVACNMEAFEEGTLRGFSVDRFVPGQQVKVFGRRKSSSGSASASSAGFFERVQFPFTEPSIRFTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQEPPPEEFRFPIRKDVYRDLPQGKEIFFTTSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKFCSSEMVIVRKPSSSSISSPEPLQDQWPNVTGFVRNLCLWRGEETDQLKEGQLDPSSSIVEKLLWTYMDLPYLFGYYAVGYIVTFCALSRSQDRVVRTDLYSLDLSSPVERLKALIPCYRIAGLLPLLADRCFNSSSSIISNGGGGYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQLVAAVAGGVEARGRHAPEMGRPGLHGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELRPTAADCYHHLLQLQSSLSVAAASSSTAPY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1018
2254556351032 PREDICTED: uncharacterized protein LOC10 0.944 0.931 0.745 0.0
147841219974 hypothetical protein VITISV_011181 [Viti 0.943 0.985 0.745 0.0
296084084959 unnamed protein product [Vitis vinifera] 0.929 0.986 0.737 0.0
224122504994 predicted protein [Populus trichocarpa] 0.914 0.936 0.734 0.0
2555396231021 hypothetical protein RCOM_1498350 [Ricin 0.949 0.947 0.724 0.0
3565293181011 PREDICTED: uncharacterized protein LOC10 0.909 0.915 0.635 0.0
449465190937 PREDICTED: uncharacterized protein LOC10 0.835 0.908 0.558 0.0
297792497973 hypothetical protein ARALYDRAFT_357417 [ 0.858 0.898 0.517 0.0
15242187972 protein kinase family protein [Arabidops 0.853 0.894 0.522 0.0
449530662869 PREDICTED: uncharacterized protein LOC10 0.780 0.914 0.538 0.0
>gi|225455635|ref|XP_002271423.1| PREDICTED: uncharacterized protein LOC100241288 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1447 bits (3747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 763/1023 (74%), Positives = 839/1023 (82%), Gaps = 62/1023 (6%)

Query: 1    MGDNKGDTTKKQKSQQPQQLQQQQQQPQQQQLSSSPKNPLEESTE-KGQHHHQQPPAVVV 59
            MGD KG+ TKKQ               QQQQ S+SP++PLEESTE + QHHHQQ P VVV
Sbjct: 59   MGD-KGEATKKQ---------------QQQQHSTSPQDPLEESTETRQQHHHQQSPVVVV 102

Query: 60   TGAPYISAPLYVPIGPTSSSPFEQQ---FEPVNPKRQRYNSSQWKLLPSPSQQQQQKQQA 116
            TGA +I  PLYVP G  SS+ FEQQ   F+ +NPKR RY S QWKLLPSPS  QQQ++Q 
Sbjct: 103  TGAQFI-PPLYVPSG-ASSATFEQQQQQFDVLNPKRPRYGSGQWKLLPSPSHHQQQQKQT 160

Query: 117  QMAILTTESSPSPTTLPITNPQSQAHTTTASSSDTASSPPHSPIPSLSAASGQETNRPEL 176
            QMAIL TESSPSPTT    NP +Q HTT ASSSDTASSP HSPIPSLSAASGQETN+PE 
Sbjct: 161  QMAILNTESSPSPTT----NPHTQLHTTAASSSDTASSPSHSPIPSLSAASGQETNKPE- 215

Query: 177  LGEQFHPQFRKGKYVSPVWKPNEMLWLARAWRIQYQGGGGSNGSGSSSRVDHHQPESTGQ 236
             GE FH QFRKGKYVSPVWKPNEMLWLARAWRIQYQ        GS S      PE    
Sbjct: 216  -GEHFHQQFRKGKYVSPVWKPNEMLWLARAWRIQYQ----GGSDGSGSSSRSEPPEGAQG 270

Query: 237  GEVAAAAQSTRAKTRADKDREVAEFLQRHGVNRDAKTSGTKWDNMLGEFRKVYEWERGGE 296
              V  A  S R KTRADKDREVAEFL RHGV+RDAKT+GTKWDNMLGEFRKVYEWER GE
Sbjct: 271  TGVDVAVLSVRGKTRADKDREVAEFLNRHGVSRDAKTAGTKWDNMLGEFRKVYEWERRGE 330

Query: 297  REQVGKSYFRLSPYERKLHRLPASFDEEVFEELSQFMGSRMRSTSQSRAASSVFVSSDHD 356
            REQ GKSYFRLSPYERKLHRLPASFDEEVFEELSQFMGSRMR T QSR AS++    D  
Sbjct: 331  REQGGKSYFRLSPYERKLHRLPASFDEEVFEELSQFMGSRMR-TPQSRGASAIVSVDD-- 387

Query: 357  NRSTRALPPPPPFKEDELSLSARAKQLVMTSGGEAFFHGGRGSLLGFESSLDVGS----- 411
              S +ALPPPPPFKED++SLSAR KQLVM SGGEAF+HG RGS LGFESSLD+G      
Sbjct: 388  --SRKALPPPPPFKEDDISLSARTKQLVMGSGGEAFYHGTRGSQLGFESSLDIGGPSSSS 445

Query: 412  --KELRRIGRIRMTWEESVSLWAEEGEHQRGRIKLQGSSFLNADELTFFDDAMVACNMEA 469
              KELRRIG+IRMTWEESVSLWAEEGEH RGR++LQGSSFLNADELTF DD+ VAC +E 
Sbjct: 446  SSKELRRIGKIRMTWEESVSLWAEEGEHHRGRVRLQGSSFLNADELTFLDDSTVACTIET 505

Query: 470  FEEGTLRGFSVDRFVPGQQVKVFGRRKSSSGSASASSAGFFERVQFPFTEPSIR-FTPWE 528
            FE+G L+GFSVDRF+ GQQVKVFGRRKSS   ++++S+GF ERVQ P  EPSIR   PWE
Sbjct: 506  FEDGPLKGFSVDRFISGQQVKVFGRRKSS---SASASSGFTERVQLPLAEPSIRSIPPWE 562

Query: 529  YQDPSDYYVGCLRVPPTTLPSLFELSWHLQEPPPEEFRFPIRKDVYRDLPQGKEIFFTTS 588
            +QDP++YYVGCLR PPTTLPSLFELSWHLQEPPPE+ RFP+R+DVYRDLPQGKE+FFTTS
Sbjct: 563  FQDPTEYYVGCLRAPPTTLPSLFELSWHLQEPPPEDLRFPLRRDVYRDLPQGKEVFFTTS 622

Query: 589  TELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKFCSSEMVIVR 648
            TELLDCRA T+DILS I+R +NPS+S +TA SRDSF+GLWDDCINRVVSKFCS EM+++R
Sbjct: 623  TELLDCRAFTFDILSSIIR-SNPSISAATATSRDSFVGLWDDCINRVVSKFCSIEMIVIR 681

Query: 649  KPSSSSISSPEPLQDQWPNVTGFVRNLCLWRGEETDQLKEGQLDPSSSIVEKLLWTYMDL 708
            KPSSSS    E LQDQWPNVTGFVRN CLWRGEETDQL++G +DPSSSIVEKLLWTYMDL
Sbjct: 682  KPSSSSA---EALQDQWPNVTGFVRNFCLWRGEETDQLRDGHIDPSSSIVEKLLWTYMDL 738

Query: 709  PYLFGYYAVGYIVTFCALSRSQDRVVRTDLYSLDLSSPVERLKALIPCYRIAGLLPLLAD 768
            PYL GYYAVGY+VTFCALSRSQDRV+RTDLYSLDLS+P ER+K LIPC+RIAGLLPLLAD
Sbjct: 739  PYLLGYYAVGYMVTFCALSRSQDRVIRTDLYSLDLSTPSERIKGLIPCWRIAGLLPLLAD 798

Query: 769  RCFNSSSSIISNGGGGYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIY 828
            RCFN+      N G  YK +P+SDFERID  +GNIIE+TPNTV ++FSS+RKW AVK+IY
Sbjct: 799  RCFNNI-----NNGSNYKSFPYSDFERIDSCNGNIIEVTPNTVAKYFSSRRKWGAVKEIY 853

Query: 829  DFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSFM 888
            DFLDHRIPHAE I  SSEKDL L+FKPRGCK KPT+C+QLVEALK VTKALVALHDLSFM
Sbjct: 854  DFLDHRIPHAEFILRSSEKDLVLIFKPRGCKSKPTNCDQLVEALKNVTKALVALHDLSFM 913

Query: 889  HKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQLVAAVAGGVEARGRHAPEMGRPGL 948
            H+DLSWDKVMRRSDR++EWFV GFDEA  APQIYP   A  A      GRHAPEMGR GL
Sbjct: 914  HRDLSWDKVMRRSDRDSEWFVCGFDEAVGAPQIYPHGAATPA----TSGRHAPEMGR-GL 968

Query: 949  HGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELRPTAADCYHHLLQLQSSLSV 1008
            HG+KVDVWGVG LVKTCGL  VPK+LRELQNRCLDQNPE RPTAADCYHHLLQLQSSLS 
Sbjct: 969  HGIKVDVWGVGHLVKTCGLVAVPKLLRELQNRCLDQNPEQRPTAADCYHHLLQLQSSLSA 1028

Query: 1009 AAA 1011
               
Sbjct: 1029 TGG 1031




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147841219|emb|CAN62096.1| hypothetical protein VITISV_011181 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084084|emb|CBI24472.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122504|ref|XP_002318853.1| predicted protein [Populus trichocarpa] gi|222859526|gb|EEE97073.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255539623|ref|XP_002510876.1| hypothetical protein RCOM_1498350 [Ricinus communis] gi|223549991|gb|EEF51478.1| hypothetical protein RCOM_1498350 [Ricinus communis] Back     alignment and taxonomy information
>gi|356529318|ref|XP_003533242.1| PREDICTED: uncharacterized protein LOC100800179 [Glycine max] Back     alignment and taxonomy information
>gi|449465190|ref|XP_004150311.1| PREDICTED: uncharacterized protein LOC101212506 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297792497|ref|XP_002864133.1| hypothetical protein ARALYDRAFT_357417 [Arabidopsis lyrata subsp. lyrata] gi|297309968|gb|EFH40392.1| hypothetical protein ARALYDRAFT_357417 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15242187|ref|NP_199993.1| protein kinase family protein [Arabidopsis thaliana] gi|10177879|dbj|BAB11249.1| unnamed protein product [Arabidopsis thaliana] gi|332008745|gb|AED96128.1| protein kinase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449530662|ref|XP_004172313.1| PREDICTED: uncharacterized protein LOC101227478 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1018
TAIR|locus:2165331972 AT5G51800 [Arabidopsis thalian 0.562 0.589 0.550 2.8e-235
TAIR|locus:2051174314 AT2G33550 [Arabidopsis thalian 0.083 0.270 0.310 9.4e-05
TAIR|locus:2058718340 AT2G35640 [Arabidopsis thalian 0.088 0.264 0.265 0.00037
TAIR|locus:2128186294 AT4G31270 [Arabidopsis thalian 0.089 0.309 0.297 0.00049
TAIR|locus:2165331 AT5G51800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1681 (596.8 bits), Expect = 2.8e-235, Sum P(4) = 2.8e-235
 Identities = 335/609 (55%), Positives = 428/609 (70%)

Query:   405 SSLDVGSKELRRIGRIRMTWEESVSLWAEEGEHQRGRIKLQGSSFLNADELTFFDDAMVA 464
             SS     ++LRRIG+IR+TWEESV+LWAE GE   GRI++ GSSFLNADELT+ DD+MVA
Sbjct:   373 SSSSSSLRDLRRIGKIRLTWEESVNLWAE-GEVDYGRIRVSGSSFLNADELTYLDDSMVA 431

Query:   465 CNMEAFEEGTLRGFSVDRFVPGQQVKVFGRRKXXXXXX---XXXXXXFFERVQFPFTEPS 521
             C ME+F++G L+GFS+D+F+ GQ +KVFGR++                F+R Q   +EP 
Sbjct:   432 CTMESFQDGPLKGFSLDKFISGQHLKVFGRQRSTSSSAPSPSVNVAGVFDRPQLQLSEPI 491

Query:   522 IR-FTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQXXXXXXFRFPIRKDVYRDLPQG 580
              +  +  E+QDPS++ +  LRVP   LPSLFEL+ +LQ       RFP+R DVY+DLPQG
Sbjct:   492 YKSISTLEFQDPSEHCLSKLRVPAGNLPSLFELARYLQEPPPENLRFPLRPDVYKDLPQG 551

Query:   581 KEIFFT-TSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDDCINRVVSKF 639
             KE+FF+ +STELLDCRAITYDI+ PI+   N +  F   +S+DS I LWDDCINR+VSKF
Sbjct:   552 KELFFSISSTELLDCRAITYDIIGPIMSRLNSNNGF-VISSKDSLIPLWDDCINRMVSKF 610

Query:   640 CSSEMVIVRKPXXXXXXXPEPLQDQWPNVTGFVRNLCLWRGEETDQLKEGQLDPSSSIVE 699
             C  EM I+RKP        E +Q QWPNV G+V+   LWRGEE D+++EG  DPSS + E
Sbjct:   611 C--EMAILRKPDSSSCI--ENVQHQWPNVIGYVKGFGLWRGEEADKVREGAADPSSLLAE 666

Query:   700 KLLWTYMDLPYLFGYYAVGYIVTFCALS-RSQDRVVRTDLYSLDLSSPVERLKALIPCYR 758
             K+LW+Y DLPY+ GY+A+G+ VTFCALS  SQDRV+ TDLYS ++SSP +R+KAL+PCYR
Sbjct:   667 KILWSYNDLPYILGYHAIGFTVTFCALSLSSQDRVICTDLYSFNVSSPSDRIKALVPCYR 726

Query:   759 IAGLLPLLADRCFXXXXXXXXXXXXXYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSK 818
             +A LLPLLADRC               +   ++DFERID G   + E+TP+TVTR++SSK
Sbjct:   727 LASLLPLLADRCTT-------------RPSCYNDFERIDRGD-YVTELTPHTVTRYYSSK 772

Query:   819 RKWAAVKQIYDFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKA 878
             RKW  VK IYDFLD R+PHAE +  +SEKDL+L FKPRG ++KP + +QL+++L  VTKA
Sbjct:   773 RKWLGVKGIYDFLDQRVPHAEHLDMASEKDLSLSFKPRGIRVKPRNIDQLIDSLMCVTKA 832

Query:   879 LVALHDLSFMHKDLSWDKVMRRS-----DRENEWFVSGFDEAASAPQIYPQLXXXXXXXX 933
             L+ALHDLSFMH+D+ WD VMR +       + +WFV GFD A  APQ+ P          
Sbjct:   833 LLALHDLSFMHRDMGWDNVMRSTATTTTTTDTDWFVCGFDAAVEAPQLNPHRPADKVVDN 892

Query:   934 XXXXXX----XPEMGRPGLHGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLDQNPELR 989
                        PEM R GLH VKVDVWGVG ++KTCGLSNVPKMLR+LQ +CL+ N E R
Sbjct:   893 EEREDERGRYAPEMER-GLHAVKVDVWGVGYMIKTCGLSNVPKMLRDLQGKCLEPNQENR 951

Query:   990 PTAADCYHH 998
             PTAADC+HH
Sbjct:   952 PTAADCFHH 960


GO:0005634 "nucleus" evidence=ISM
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0048445 "carpel morphogenesis" evidence=RCA
TAIR|locus:2051174 AT2G33550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058718 AT2G35640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128186 AT4G31270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00038528001
SubName- Full=Chromosome chr16 scaffold_94, whole genome shotgun sequence; (1210 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1018
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 7e-08
pfam09770804 pfam09770, PAT1, Topoisomerase II-associated prote 4e-06
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 9e-06
pfam00069260 pfam00069, Pkinase, Protein kinase domain 7e-05
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
pfam09606768 pfam09606, Med15, ARC105 or Med15 subunit of Media 0.002
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 0.002
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 0.002
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 0.003
pfam1383784 pfam13837, Myb_DNA-bind_4, Myb/SANT-like DNA-bindi 0.003
cd1220366 cd12203, GT1, GT1, myb-like, SANT family 0.003
pfam09606768 pfam09606, Med15, ARC105 or Med15 subunit of Media 0.004
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
 Score = 53.8 bits (130), Expect = 7e-08
 Identities = 31/136 (22%), Positives = 60/136 (44%), Gaps = 19/136 (13%)

Query: 865 CEQLVEALKYVTKALVALHDLSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQ 924
             Q++E L+Y       LH    +H+DL  + ++       +  ++ F  +    ++   
Sbjct: 98  LLQILEGLEY-------LHSNGIIHRDLKPENILL-DSDNGKVKLADFGLS----KLLTS 145

Query: 925 LVAAVAGGVEARGRHAPEMGR-PGLHGVKVDVWGVGQLVKTCGLSNVPKMLRELQNRCLD 983
             + +   V      APE+    G +  K D+W +G       L  +P+ L++L  + L 
Sbjct: 146 DKSLLKTIVGTPAYMAPEVLLGKGYYSEKSDIWSLG-----VILYELPE-LKDLIRKMLQ 199

Query: 984 QNPELRPTAADCYHHL 999
           ++PE RP+A +   HL
Sbjct: 200 KDPEKRPSAKEILEHL 215


Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and 550 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. Length = 215

>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|222409 pfam13837, Myb_DNA-bind_4, Myb/SANT-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|213402 cd12203, GT1, GT1, myb-like, SANT family Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1018
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 99.97
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 99.97
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.97
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.97
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.97
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.97
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.97
KOG0583370 consensus Serine/threonine protein kinase [Signal 99.97
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.97
KOG0198313 consensus MEKK and related serine/threonine protei 99.96
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.96
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.96
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.96
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.96
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.96
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.96
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.96
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.96
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.96
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.96
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.96
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.96
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 99.96
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.96
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.96
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.96
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.96
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.96
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.96
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.95
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.95
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.95
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.95
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.95
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.95
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.95
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.95
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.95
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.95
KOG0605550 consensus NDR and related serine/threonine kinases 99.95
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.95
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.95
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.95
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.95
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.95
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.95
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.95
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.95
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.95
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.95
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.95
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.95
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.95
PTZ00267 478 NIMA-related protein kinase; Provisional 99.95
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.95
PHA03212391 serine/threonine kinase US3; Provisional 99.95
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.95
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.95
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.95
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.95
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.95
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.95
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.95
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.95
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.95
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.95
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.95
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.95
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.95
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.95
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.95
KOG0589 426 consensus Serine/threonine protein kinase [General 99.95
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.95
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.95
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.95
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.95
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.95
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.95
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.95
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.95
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.95
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.95
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.95
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.95
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.95
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.94
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.94
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.94
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.94
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.94
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.94
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.94
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.94
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.94
PTZ00036440 glycogen synthase kinase; Provisional 99.94
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.94
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.94
PHA02988283 hypothetical protein; Provisional 99.94
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.94
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.94
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.94
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.94
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.94
PTZ00283 496 serine/threonine protein kinase; Provisional 99.94
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.94
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.94
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.94
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.94
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.94
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.94
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.94
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.94
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.94
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.94
PHA03209357 serine/threonine kinase US3; Provisional 99.94
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.94
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.94
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.94
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.94
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.94
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.94
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.94
KOG0584 632 consensus Serine/threonine protein kinase [General 99.94
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.94
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.94
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.94
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.94
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.94
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.94
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.94
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.94
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.94
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.94
PHA03211461 serine/threonine kinase US3; Provisional 99.94
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.94
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.94
PTZ00284467 protein kinase; Provisional 99.94
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.94
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.94
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.94
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.94
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.94
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.94
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.94
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.94
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.94
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.94
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.94
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.94
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.94
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.94
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.94
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.94
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.94
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.94
PHA03207392 serine/threonine kinase US3; Provisional 99.94
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.93
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.93
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.93
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.93
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.93
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.93
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.93
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.93
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.93
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.93
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.93
KOG0610459 consensus Putative serine/threonine protein kinase 99.93
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.93
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.93
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.93
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.93
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.93
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.93
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.93
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.93
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.93
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.93
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.93
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.93
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.93
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.93
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.93
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.93
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.93
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.93
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.93
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.93
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.93
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.93
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.93
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.93
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.93
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.93
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.93
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.93
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.93
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.93
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.93
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.93
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.93
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.93
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.93
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.93
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.93
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.93
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.93
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.93
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.93
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.93
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.93
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.93
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.93
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.93
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.93
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.93
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.93
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.93
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.93
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.93
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.93
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.93
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.93
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.93
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.93
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.93
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.93
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.93
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.93
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.93
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.93
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.93
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.93
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.93
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.93
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.93
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.93
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.93
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.93
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.93
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.93
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.93
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.93
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.93
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.93
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.93
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.93
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.93
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.93
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.93
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.93
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.93
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.93
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.93
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.93
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.93
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.93
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.92
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.92
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.92
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.92
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.92
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.92
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.92
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.92
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.92
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.92
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.92
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.92
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.92
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.92
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.92
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.92
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.92
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.92
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.92
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.92
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.92
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.92
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.92
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.92
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.92
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.92
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.92
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.92
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.92
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.92
PHA03210501 serine/threonine kinase US3; Provisional 99.92
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.92
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.92
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.92
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.92
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.92
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.92
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.92
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.92
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.92
KOG0586 596 consensus Serine/threonine protein kinase [General 99.92
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.92
PLN00009294 cyclin-dependent kinase A; Provisional 99.92
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.92
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.92
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.92
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.92
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.92
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.92
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.92
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.92
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.92
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.92
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.92
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.92
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.92
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.92
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.92
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.92
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.91
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.91
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.91
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.91
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.91
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.91
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.91
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.91
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.91
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.91
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.91
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.91
KOG0596677 consensus Dual specificity; serine/threonine and t 99.91
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.91
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.91
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.91
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.91
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.91
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.91
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.91
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.91
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.91
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.91
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.91
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.91
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.91
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.91
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.91
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.9
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.9
PHA02882294 putative serine/threonine kinase; Provisional 99.9
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.9
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.9
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.9
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.9
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.9
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.9
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.9
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.9
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.9
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.9
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.9
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.9
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.9
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.9
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.89
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.89
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.89
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.89
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.89
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.88
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.88
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.88
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.88
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.87
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.87
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.87
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.87
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.87
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.86
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.86
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.86
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.86
KOG3653534 consensus Transforming growth factor beta/activin 99.85
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.85
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.84
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.84
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.84
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.84
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.84
PLN00181 793 protein SPA1-RELATED; Provisional 99.83
PLN03224507 probable serine/threonine protein kinase; Provisio 99.83
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.82
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.82
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.82
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.82
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.82
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.82
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.8
KOG1167418 consensus Serine/threonine protein kinase of the C 99.78
KOG1152772 consensus Signal transduction serine/threonine kin 99.77
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.76
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.74
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.73
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.7
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.68
PRK09188365 serine/threonine protein kinase; Provisional 99.56
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.53
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.52
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.45
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.43
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.43
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.41
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.4
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.35
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.33
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.33
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.3
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.3
PRK10345210 hypothetical protein; Provisional 99.29
PRK12274218 serine/threonine protein kinase; Provisional 99.28
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.26
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.21
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 99.19
smart00090237 RIO RIO-like kinase. 99.17
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.16
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.15
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.12
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.09
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.04
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.01
PRK14879211 serine/threonine protein kinase; Provisional 99.0
KOG0590 601 consensus Checkpoint kinase and related serine/thr 98.99
KOG1266 458 consensus Protein kinase [Signal transduction mech 98.93
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.88
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.86
KOG4282345 consensus Transcription factor GT-2 and related pr 98.7
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.65
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 98.53
KOG1243 690 consensus Protein kinase [General function predict 98.5
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.49
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.48
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 98.45
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.45
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.44
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 98.27
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.2
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.18
KOG3087229 consensus Serine/threonine protein kinase [General 98.17
KOG06061205 consensus Microtubule-associated serine/threonine 98.07
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 98.07
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 97.99
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 97.85
COG4248 637 Uncharacterized protein with protein kinase and he 97.78
COG0478304 RIO-like serine/threonine protein kinase fused to 97.48
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 97.42
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 97.26
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 97.23
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 97.06
COG1718268 RIO1 Serine/threonine protein kinase involved in c 96.98
PRK09902216 hypothetical protein; Provisional 96.97
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 96.97
PF01636239 APH: Phosphotransferase enzyme family This family 96.2
COG0661 517 AarF Predicted unusual protein kinase [General fun 96.19
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 96.1
PLN02876 822 acyl-CoA dehydrogenase 95.95
PLN03212249 Transcription repressor MYB5; Provisional 95.67
PLN03091459 hypothetical protein; Provisional 95.43
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 95.21
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 95.12
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 95.01
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 94.95
KOG1235538 consensus Predicted unusual protein kinase [Genera 94.91
KOG0576 829 consensus Mitogen-activated protein kinase kinase 94.75
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 94.47
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 93.96
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 93.88
PRK09550401 mtnK methylthioribose kinase; Reviewed 93.44
COG5072488 ALK1 Serine/threonine kinase of the haspin family 92.41
PRK10593297 hypothetical protein; Provisional 92.17
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 92.07
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 91.7
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 90.69
KOG2268 465 consensus Serine/threonine protein kinase [Signal 90.6
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 90.44
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 90.31
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 90.2
PRK05231319 homoserine kinase; Provisional 89.74
TIGR01767370 MTRK 5-methylthioribose kinase. This enzyme is inv 89.34
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 89.23
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 89.06
smart0059589 MADF subfamily of SANT domain. 88.82
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 88.79
PLN03091459 hypothetical protein; Provisional 88.66
PLN03212249 Transcription repressor MYB5; Provisional 88.53
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 87.82
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 87.42
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 86.94
PTZ00384383 choline kinase; Provisional 85.99
KOG1826 2724 consensus Ras GTPase activating protein RasGAP/neu 85.91
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=4.6e-35  Score=322.81  Aligned_cols=214  Identities=16%  Similarity=0.202  Sum_probs=177.0

Q ss_pred             cccCCCCcccceeeeEEEEEecCCCcEEEEEeeeeecccccHHHHHHHHHHHHHhhcCCCceeEEeEEeccc-----eEE
Q 001741          777 IISNGGGGYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKD-----LAL  851 (1018)
Q Consensus       777 ~IgnGG~Gy~~v~Yg~v~Ri~~~dG~tV~Vk~~~V~K~f~~k~~~~~lkEIye~Lk~rHPNIVkL~~v~e~~-----LVm  851 (1018)
                      .||.|   .++++|++.++   .+++.+++|.+...-.-...+.+..+-+|+..  .+|||||++|+.|..+     ++|
T Consensus        86 ~lG~G---~gG~V~kv~Hk---~t~~i~AlK~I~~~~~~~~~~Qi~rEl~il~~--~~spyIV~~ygaF~~~~~~isI~m  157 (364)
T KOG0581|consen   86 VLGSG---NGGTVYKVRHK---PTGKIYALKVILLNIDPALQKQILRELEILRS--CQSPYIVGFYGAFYSNGEEISICM  157 (364)
T ss_pred             hcccC---CCcEEEEEEEc---CCCeEEEEEeecccCCHHHHHHHHHHHHHHhh--CCCCCeeeEeEEEEeCCceEEeeh
Confidence            44544   56888989888   88888888777443321222333333344444  4799999999998766     899


Q ss_pred             EEccCCCcCC------CCCHHHHHHHHHHHHHHHHHHHh-CCccccCCCCCcEEEccCCCCeEEEEeecccccCCCCccc
Q 001741          852 VFKPRGCKLK------PTSCEQLVEALKYVTKALVALHD-LSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQ  924 (1018)
Q Consensus       852 Ey~p~GsLl~------~Lse~el~~ia~QIL~GL~yLHs-~GIVHRDIKPsNILld~dg~~~vKLiDFGlA~~~~~~~~~  924 (1018)
                      |||++|+|..      .++|..+-.++.+|++||.|||+ ++||||||||+|||++..|  .+||||||.++........
T Consensus       158 EYMDgGSLd~~~k~~g~i~E~~L~~ia~~VL~GL~YLh~~~~IIHRDIKPsNlLvNskG--eVKicDFGVS~~lvnS~a~  235 (364)
T KOG0581|consen  158 EYMDGGSLDDILKRVGRIPEPVLGKIARAVLRGLSYLHEERKIIHRDIKPSNLLVNSKG--EVKICDFGVSGILVNSIAN  235 (364)
T ss_pred             hhcCCCCHHHHHhhcCCCCHHHHHHHHHHHHHHHHHHhhccCeeeccCCHHHeeeccCC--CEEeccccccHHhhhhhcc
Confidence            9999998877      59999999999999999999995 8999999999999999988  8999999999866543333


Q ss_pred             cccccccCCCCCCccCccccCCCCCCchhhHHHHHHHH--HHcCC-----------------------------C-CCCH
Q 001741          925 LVAAVAGGVEARGRHAPEMGRPGLHGVKVDVWGVGQLV--KTCGL-----------------------------S-NVPK  972 (1018)
Q Consensus       925 ~~~~~t~~~GT~~Y~APEll~~~~ys~kSDVWSLGvLL--LltG~-----------------------------~-~ls~  972 (1018)
                      .      .+||..|||||.+.+..|+.++||||||..+  +..|.                             . .+++
T Consensus       236 t------fvGT~~YMsPERi~g~~Ys~~sDIWSLGLsllE~a~GrfP~~~~~~~~~~~~~Ll~~Iv~~ppP~lP~~~fS~  309 (364)
T KOG0581|consen  236 T------FVGTSAYMSPERISGESYSVKSDIWSLGLSLLELAIGRFPYPPPNPPYLDIFELLCAIVDEPPPRLPEGEFSP  309 (364)
T ss_pred             c------ccccccccChhhhcCCcCCcccceecccHHHHHHhhCCCCCCCcCCCCCCHHHHHHHHhcCCCCCCCcccCCH
Confidence            3      4899999999999999999999999999998  66674                             2 3788


Q ss_pred             HHHHHHHHhhhhCCCCCCCHHHHHHHHHHhhhhc
Q 001741          973 MLRELQNRCLDQNPELRPTAADCYHHLLQLQSSL 1006 (1018)
Q Consensus       973 eL~dLI~kcL~~DP~kRPTaeElL~hLf~lqseL 1006 (1018)
                      ++++||..||++||.+|+++.|+++|+|..+.+.
T Consensus       310 ef~~FV~~CL~Kdp~~R~s~~qLl~Hpfi~~~~~  343 (364)
T KOG0581|consen  310 EFRSFVSCCLRKDPSERPSAKQLLQHPFIKKFED  343 (364)
T ss_pred             HHHHHHHHHhcCCcccCCCHHHHhcCHHHhhccc
Confidence            9999999999999999999999999999987654



>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>PTZ00384 choline kinase; Provisional Back     alignment and domain information
>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1018
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 3e-06
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 7e-05
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 1e-04
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 78.7 bits (193), Expect = 7e-15
 Identities = 103/702 (14%), Positives = 178/702 (25%), Gaps = 206/702 (29%)

Query: 228 HHQPESTGQGEVAAA--AQSTRAKTRADKD-REVAEFLQRHGVNRDAKTSGTKWDNMLGE 284
           HH    TG+ +                + D ++V +        +   +          E
Sbjct: 5   HHMDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMP------KSILSKE--------E 50

Query: 285 FRKVYEWERGGEREQVGKSYFRLSPYERKLHRLPASFDEEVFEELSQFMGSRMRSTSQSR 344
              +        ++ V  +         K   +   F EEV     +F+ S +++  +  
Sbjct: 51  IDHIIM-----SKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQP 105

Query: 345 AASSVFVSSDHDNRSTRALPPPPPF----KEDELSLSARAKQLVMTSGGEAFFHG--GRG 398
           +  +       D R          +     +  L L     +L           G  G G
Sbjct: 106 SMMTRMYIEQRD-RLYNDNQVFAKYNVSRLQPYLKLRQALLEL--RPAKNVLIDGVLGSG 162

Query: 399 -SLLGFESSLDVGSKE----------LRRIGRIRMTWEESVSL-------WAEEGEH--- 437
            + +  +  L    +           L+         E    L       W    +H   
Sbjct: 163 KTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSN 222

Query: 438 ---------QRGRIKLQGSSFLNADELTFFDDAMVACN---MEAFEEG-----TLRGFSV 480
                       R  L+   + N   L    +  V  N     AF        T R   V
Sbjct: 223 IKLRIHSIQAELRRLLKSKPYENC--LLVLLN--V-QNAKAWNAFNLSCKILLTTRFKQV 277

Query: 481 DRFVPGQQVKVFGRRKSSSGSASASSAGFFERV--QFPFTEP----------------SI 522
             F+             S             +     P   P                SI
Sbjct: 278 TDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESI 337

Query: 523 RFTPWEYQDPSDYYVGCLRVPPTTLPSLFELSWHLQEPPPEEFRFPIRKDVYRDLPQGKE 582
           R    +     D +     V    L ++ E S  L    P E+R      ++  L     
Sbjct: 338 R----DGLATWDNW---KHVNCDKLTTIIESS--LNVLEPAEYR-----KMFDRL----S 379

Query: 583 IFFTTSTELLDCRAITYDILSPIVRGNNPSLSFSTAASRDSFIGLWDD----CINRVVSK 638
           +F            I   +LS                     + +W D     +  VV+K
Sbjct: 380 VF------PPSAH-IPTILLS---------------------L-IWFDVIKSDVMVVVNK 410

Query: 639 FCSSEMVIVRKPSSSSISSPEPLQDQWPNVTGFVRNLCLWRGEETDQLKEGQLDPSSSIV 698
                +V  ++P  S+IS P    +    +            E    L    +D   +I 
Sbjct: 411 LHKYSLVE-KQPKESTISIPSIYLELKVKL------------ENEYALHRSIVD-HYNIP 456

Query: 699 EKLLWTYMDLPYLFGYYA--VGYIVTFCALSRSQDRVVRTDLYSLDLSSPVERLKAL-IP 755
           +      +  PYL  Y+   +G+      +   +   +   ++ LD     ++++     
Sbjct: 457 KTFDSDDLIPPYLDQYFYSHIGH--HLKNIEHPERMTLFRMVF-LDFRFLEQKIRHDSTA 513

Query: 756 CYRIAGLLPLLADRCFNSSSSIISNGGGGYKQYPFSDFERIDLGSGNIIEMTPNTVTRFF 815
                 +L  L    F             YK Y              I +  P    R  
Sbjct: 514 WNASGSILNTLQQLKF-------------YKPY--------------ICDNDP-KYERL- 544

Query: 816 SSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKDL---ALVFK 854
                   V  I DFL       E +  S   DL   AL+ +
Sbjct: 545 --------VNAILDFL---PKIEENLICSKYTDLLRIALMAE 575


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Length = 86 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1018
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-09
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-09
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-09
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-09
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-09
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-09
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-09
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-09
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 6e-09
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 7e-09
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-09
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-08
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 4e-08
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-08
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 6e-08
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-08
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-08
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 9e-08
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-07
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-07
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 5e-07
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 6e-07
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 6e-07
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 6e-07
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 6e-07
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 7e-07
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-06
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-06
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-06
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-06
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-06
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-06
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 7e-06
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 7e-06
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 8e-06
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-05
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-05
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-05
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 5e-05
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 7e-05
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 8e-05
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-04
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-04
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 8e-04
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 0.002
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 0.003
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fl cytokine receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 59.0 bits (142), Expect = 1e-09
 Identities = 34/199 (17%), Positives = 58/199 (29%), Gaps = 32/199 (16%)

Query: 829 DFLDHRIPHAEAIYESSEKDLALVFKPRGCKLKPTSCEQLVEALKYVTKALVALHDLSFM 888
           D L++     E   E   +            L   + E L+     V K +  L   S +
Sbjct: 127 DLLNYLRSKREKFSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCV 186

Query: 889 HKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQLVAAVAGGVEARGRHAPEMGRPGL 948
           H+DL+   V+          +  F  A         +V   A         APE    G+
Sbjct: 187 HRDLAARNVLV--THGKVVKICDFGLARDIMSDSNYVVRGNARL--PVKWMAPESLFEGI 242

Query: 949 HGVKVDVWGVGQLVK---TCGL-------------------------SNVPKMLRELQNR 980
           + +K DVW  G L+    + G+                             + +  +   
Sbjct: 243 YTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQS 302

Query: 981 CLDQNPELRPTAADCYHHL 999
           C   +   RP+  +    L
Sbjct: 303 CWAFDSRKRPSFPNLTSFL 321


>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1018
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.71
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 97.53
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 97.29
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 97.27
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 97.26
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 97.18
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 97.13
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 97.08
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 96.87
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 96.86
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 96.82
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 96.81
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 95.67
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 95.57
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 94.99
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 94.64
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 94.59
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 94.37
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 94.24
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 94.03
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 88.5
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.5e-44  Score=295.30  Aligned_cols=212  Identities=18%  Similarity=0.247  Sum_probs=174.8

Q ss_pred             CCCCCCCCCCCEEEEEEEEEECCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCC----EEEE
Q ss_conf             213888764321233799976599829999850121123319999999999998413899133896770466----4999
Q 001741          777 IISNGGGGYKQYPFSDFERIDLGSGNIIEMTPNTVTRFFSSKRKWAAVKQIYDFLDHRIPHAEAIYESSEKD----LALV  852 (1018)
Q Consensus       777 ~Ig~GG~Gy~~v~yg~i~Ri~~gdG~~V~Ik~~~V~K~~~~k~~l~~lkeIye~Lk~rHPNIVkL~~v~e~~----LVlE  852 (1018)
                      .||.|+   .+.+|....   ..+|..+++|.....+. ...+.+..+.+++..+  +||||+++++++.+.    ++||
T Consensus        27 ~iG~G~---fg~Vy~a~~---~~~~~~vAvK~~~~~~~-~~~~~~~~E~~il~~l--~HpnIv~~~~~~~~~~~~~ivmE   97 (293)
T d1yhwa1          27 KIGQGA---SGTVYTAMD---VATGQEVAIRQMNLQQQ-PKKELIINEILVMREN--KNPNIVNYLDSYLVGDELWVVME   97 (293)
T ss_dssp             ECCCSS---SCEEEEEEB---TTTCCEEEEEEEEGGGC-SCHHHHHHHHHHHHHC--CCTTBCCEEEEEEETTEEEEEEE
T ss_pred             EEECCC---CCEEEEEEE---CCCCCEEEEEEEECCCC-HHHHHHHHHHHHHHHC--CCCCEEEEEEEEEECCEEEEEEE
T ss_conf             981285---829999999---89998999999843017-2799999999999867--99988058577988999899997


Q ss_pred             ECCCCCCCC-----CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEECCCCCCEEEEEEECCCCCCCCCCCCCCC
Q ss_conf             716997699-----999999999999999999998848932058888948981699970999830444447987631100
Q 001741          853 FKPRGCKLK-----PTSCEQLVEALKYVTKALVALHDLSFMHKDLSWDKVMRRSDRENEWFVSGFDEAASAPQIYPQLVA  927 (1018)
Q Consensus       853 y~p~GsL~~-----~Lse~ell~il~QIL~GL~yLHskgIIHRDIKPsNILi~~dg~~~iKLiDFGlAr~~~~~~~~~~~  927 (1018)
                      |+++|+|..     .+++.++..++.||+.||.|||++||+||||||+|||++.++  .+||+|||+|+......    .
T Consensus        98 y~~gg~L~~~~~~~~l~~~~~~~i~~qi~~aL~yLH~~~iiHrDiKp~NILl~~~~--~vkl~DFG~a~~~~~~~----~  171 (293)
T d1yhwa1          98 YLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDG--SVKLTDFGFCAQITPEQ----S  171 (293)
T ss_dssp             CCTTCBHHHHHHHSCCCHHHHHHHHHHHHHHHHHHHHTTEECCCCSGGGEEECTTC--CEEECCCTTCEECCSTT----C
T ss_pred             ECCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHEEECCCC--CEEECCCHHHEEECCCC----C
T ss_conf             03798089886415999999999999999999999987972267768886887899--68642515641321366----6


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH--HHCCC--------------------------CCCCHHHHHHHH
Q ss_conf             10467789875686434989889145599999999--99089--------------------------998899999999
Q 001741          928 AVAGGVEARGRHAPEMGRPGLHGVKVDVWGVGQLV--KTCGL--------------------------SNVPKMLRELQN  979 (1018)
Q Consensus       928 ~ltt~~GT~~Y~APEll~~~~yt~kSDIWSLGvIL--LltG~--------------------------~~lS~el~dLI~  979 (1018)
                      .....+||+.|+|||++.+..|+.++||||+||++  +++|.                          ..+++++++||.
T Consensus       172 ~~~~~~gt~~Y~aPE~~~~~~~~~~~DiwSlGvilyemltG~~Pf~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~li~  251 (293)
T d1yhwa1         172 KRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLN  251 (293)
T ss_dssp             CBCCCCSCGGGCCHHHHSSSCBCTHHHHHHHHHHHHHHHHSSCTTTTSCHHHHHHHHHHHCSCCCSSGGGSCHHHHHHHH
T ss_pred             CCCCCCCCCCCCCHHHHCCCCCCCHHCEEHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
T ss_conf             44444447773682664479988012031372999998048899899799999999985799988885537999999999


Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             942209999999999999999753
Q 001741          980 RCLDQNPELRPTAADCYHHLLQLQ 1003 (1018)
Q Consensus       980 kLL~~DPeeRPTAeEiL~Hl~~lq 1003 (1018)
                      +||..||.+|||++++++|+|+..
T Consensus       252 ~~L~~dP~~R~s~~eil~Hp~~~~  275 (293)
T d1yhwa1         252 RCLDMDVEKRGSAKELLQHQFLKI  275 (293)
T ss_dssp             HHTCSSTTTSCCHHHHTTCGGGGG
T ss_pred             HHCCCCHHHCCCHHHHHCCHHHCC
T ss_conf             986699668909999964996577



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure