Citrus Sinensis ID: 001846


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------
MGLKTRKNHCHSVALKVNEQMGTKIGYTFIQSNRAWLPKALVLWIMGMAFISMSIYRGMDEENKIRRKEVLGSMCDQRARMLQDQFNVTVNHVHALTILVSTFHYFKNPSALDQDTFAEYTTRTAFERPLLSGVAYAPRVVDAQREQFERQHGMTITTMKSEPSPIRDEYAPVMFYQEPMSHVKSLDMMSGEEDRENILRARATGKAVLTRPFRLLGSHHLGVVLTFPVYKSKLPPRSTVEERIKATAGYIGGPFDVESLVENLLGQLAGNQAILVNVYDMTNASDPLIMYGDQNQDGDMSLLHESELDFGDSFRKHKMICRYHQKASTPWTALTTAFFLFVIGLLVGYILYGAAIHIVKVEDDFHKMQELKVRAEAADVAKSQFLATVSHEIRTPMNGILGMLALLLDTDLSSTQRDYAQTAQICGKALIALINEVLDRAKIEARKLELEAVLFNLRAILDDVLSLFSEKSRNKGIELAVFVSDKVPEFVLGDPGRFRQIITNLVGNSVKFTERGHIFVKVHLAERTMVKTDAKDETLLNGGTEEGVCRSGTGQFNTLSGLEAADGRNSWDKFKHLIDAEGFQSNASIINMMASNGGSEDVTLMVCVEDTGIGIPLSAQERVFMPFMQADSSTSRHYGGTGIGLSISKCLVELMRGQISFVSRPQVGSTFSFTAVFGKCKEYVFEDIKQSKSEDLPPGFKGLKAVVVDEKPVRAAVTQYHLNRLGIMVKMSSSIKDASSTAKNGLTSSEDKFQPDIILVEKDCWISGEDSGFNAQLLDWKPNGHVFKLPKLILLATNISKDECDKAKAGGFADTVIMKPLRASMIAACLQQVLSTENKRQAGRGVPNGSSFHQGLLRGKKILVVDDNGVNRMVAAGALKKFGATVECAASAKAALDKLQSPHCFDACFMDIQMPEMDGFEATRRIRQMESKANEQMMNGGSSVDGTAKRDELHLPILAMTADVIHATFDECLKCGMDGYVSKPFEEENLYRELAKFFKSKPLSGA
cccccccccccccEEEHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHccccccccccccccccccccCEEEECccccccccccccccHHHHHHHHHHHHcccccccccEEcccccccEEEEEEEcccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHcccccEEEEEccccccccccEEEcccccccccccccccccccccccccEEEEEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEccccccccccccccccHHHHHHHHHccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccEEEEEECcccccccEEEEEEEEcccccccHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccEEEEEEccccccEEEEEEEEccccccccccccccccccccccccccEEEEECccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccccccccEEEEEcccccccccHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHcccccEEEcccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHccHHHccccccccccccccccccccEEEEcccccHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccc
*********CHSVALKVNEQMGTKIGYTFIQSNRAWLPKALVLWIMGMAFISMSIYRGMDEENKIRRKEVLGSMCDQRARMLQDQFNVTVNHVHALTILVSTFHYFKNPSALDQDTFAEYTTRTAFERPLLSGVAYAPRVVDAQREQFERQHGMTIT**********DEYAPVMFYQEPMSHVKSLDMMSGEEDRENILRARATGKAVLTRPFRLLGSHHLGVVLTFPVYKSKLPPRSTVEERIKATAGYIGGPFDVESLVENLLGQLAGNQAILVNVYDMTNASDPLIMYGDQNQDGDMSLLHESELDFGDSFRKHKMICRYHQKASTPWTALTTAFFLFVIGLLVGYILYGAAIHIVKVEDDFHKMQELKVRAEAADVAKSQFLATVSHEIRTPMNGILGMLALLLDTDLSSTQRDYAQTAQICGKALIALINEVLDRAKIEARKLELEAVLFNLRAILDDVLSLFSEKSRNKGIELAVFVSDKVPEFVLGDPGRFRQIITNLVGNSVKFTERGHIFVKVHLAERTMVKTDAKDETLLNGGTEEGVCRSGTGQFNTLSGLEAADGRNSWDKFKHLIDAEGFQSNASIINMMASNGGSEDVTLMVCVEDTGIGIPLSAQERVFMPFMQADSSTSRHYGGTGIGLSISKCLVELMRGQISFVSRPQVGSTFSFTAVFGKCK*****************GFKGLKAVVVDEKPVRAAVTQYHLNRLGIMVKMSSSIKDASSTAKNGLTSSEDKFQPDIILVEKDCWISGEDSGFNAQLLDWKPNGHVFKLPKLILLATNISKDECDKAKAGGFADTVIMKPLRASMIAACLQQVLS*******************GLLRGKKILVVDDNGVNRMVAAGALKKFGATVECAASAKAALDKLQSPHCFDACFMDIQMPEMDGFEATRRIRQMESKANE*MM***SSVDGTAKRDELHLPILAMTADVIHATFDECLKCGMDGYVSKPFEEENLYRELAKFF*S******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLKTRKNHCHSVALKVNEQMGTKIGYTFIQSNRAWLPKALVLWIMGMAFISMSIYRGMDEENKIRRKEVLGSMCDQRARMLQDQFNVTVNHVHALTILVSTFHYFKNPSALDQDTFAEYTTRTAFERPLLSGVAYAPRVVDAQREQFERQHGMTITTMKSEPSPIRDEYAPVMFYQEPMSHVKSLDMMSGEEDRENILRARATGKAVLTRPFRLLGSHHLGVVLTFPVYKSKLPPRSTVEERIKATAGYIGGPFDVESLVENLLGQLAGNQAILVNVYDMTNASDPLIMYGDQNQDGDMSLLHESELDFGDSFRKHKMICRYHQKASTPWTALTTAFFLFVIGLLVGYILYGAAIHIVKVEDDFHKMQELKVRAEAADVAKSQFLATVSHEIRTPMNGILGMLALLLDTDLSSTQRDYAQTAQICGKALxxxxxxxxxxxxxxxxxxxxxAVLFNLRAILDDVLSLFSEKSRNKGIELAVFVSDKVPEFVLGDPGRFRQIITNLVGNSVKFTERGHIFVKVHLAERTMVKTDAKDETLLNGGTEEGVCRSGTGQFNTLSGLEAADGRNSWDKFKHLIDAEGFQSNASIINMMASNGGSEDVTLMVCVEDTGIGIPLSAQERVFMPFMQADSSTSRHYGGTGIGLSISKCLVELMRGQISFVSRPQVGSTFSFTAVFGKCKEYVFEDIKQSKSEDLPPGFKGLKAVVVDEKPVRAAVTQYHLNRLGIMVKMSSSIKDASSTAKNGLTSSEDKFQPDIILVEKDCWISGEDSGFNAQLLDWKPNGHVFKLPKLILLATNISKDECDKAKAGGFADTVIMKPLRASMIAACLQQVLSTENKRQAGRGVPNGSSFHQGLLRGKKILVVDDNGVNRMVAAGALKKFGATVECAASAKAALDKLQSPHCFDACFMDIQMPEMDGFEATRRIRQMESKANEQMMNGGSSVDGTAKRDELHLPILAMTADVIHATFDECLKCGMDGYVSKPFEEENLYRELAKFFKSKPLSGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histidine kinase 4 Cytokinins (CK) receptor related to bacterial two-component regulators. Functions as a histidine kinase and transmits the stress signal to a downstream MAPK cascade. This protein undergoes an ATP-dependent autophosphorylation at a conserved histidine residue in the kinase core, and a phosphoryl group is then transferred to a conserved aspartate residue in the receiver domain. In the presence of cytokinin, feed phosphate to phosphorelay-integrating histidine phosphotransfer protein (HPt) and activates subsequent cascade. In the absence of cytokinin, removes phosphate from HPt proteins, decreasing the system phosphoload. Involved in meristems establishment in seedlings. Acts as a redundant negative regulator of drought and salt stress responses, and abscisic acid (ABA) signaling in a cytokinin-dependent manner. Required to set vascular asymmetric cell divisions that establish phloem and procambium cell lines. Redundant positive regulator of cytokinin signaling that regulates many development process including seed germination, cell division, seed size, chlorophyll retention during leaf senescence, root repression and shoot promotion. Can interact with isoprenoid-type cytokinins trans-zeatin (tZ and tZR), isopentenyladenine (iP), and isopentenyladenosine (iPR), the meta hydroxylated derivative of benzyladenine m-topolin, buta-2,3-dienyladenine (HA-8), penta-2,3-dienyladenine (HA-1), 4-methyl-penta-2,3-dienyladenine (HA-10), 4-hydroxy-2-butynyladenine (RM1), 2-butynyladenine (RM6), and to a lower extent, with cis-zeatin (cZ), zeatin riboside and dihydrozeatin (DZ). Together with AHK3, involved in the cytokinin-dependent responses to Pi starvation and sucrose stresses. Required for the formation of auxin-transporting vascular tissues in the hypocotyl, and primary and lateral roots, but not in adventitious roots, thus leading to auxin basipetal transport that regulates root development and branching. Involved in alkamides (e.g. N-isobutyl decanamide) and N-acylethanolamides (NAE) signaling that control meristematic activity and differentiation processes during plant development. Prevents the uptake of sulfate by mediating cytokinin-dependent down-regulation of high-affinity sulfate transporters (e.g. SULTR1;1 and SULTR1;2) expression in roots. Together with AHK2, required for growth and reproduction promotion stimulated by the endophytic fungus Piriformospora indica in a trans-zeatin-dependent manner. Required to trigger the phytotoxic effect of the snapdragon (Antirrhinum majus) flowers volatile organic compound (VOC) methyl benzoate (MB). Plays a role in the cytokinin-mediated repression of the iron uptake pathway.probableQ9C5U0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
3.1.-.-Acting on ester bonds.probable
2.7.13.-Protein-histidine kinases.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable
2.7.13.3Histidine kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T4J, chain A
Confidence level:very confident
Coverage over the Query: 59-325
View the alignment between query and template
View the model in PyMOL
Template: 4EW8, chain A
Confidence level:very confident
Coverage over the Query: 368-530
View the alignment between query and template
View the model in PyMOL
Template: 2AYX, chain A
Confidence level:confident
Coverage over the Query: 792-931,954-997
View the alignment between query and template
View the model in PyMOL
Template: 3LUF, chain A
Confidence level:confident
Coverage over the Query: 777-842,857-933,954-996
View the alignment between query and template
View the model in PyMOL
Template: 3SL2, chain A
Confidence level:confident
Coverage over the Query: 599-674
View the alignment between query and template
View the model in PyMOL
Template: 1GKZ, chain A
Confidence level:probable
Coverage over the Query: 357-578,637-674
View the alignment between query and template
View the model in PyMOL
Template: 4EUK, chain A
Confidence level:probable
Coverage over the Query: 861-998
View the alignment between query and template
View the model in PyMOL
Template: 2AYX, chain A
Confidence level:probable
Coverage over the Query: 792-931,954-997
View the alignment between query and template
View the model in PyMOL
Template: 1W25, chain A
Confidence level:probable
Coverage over the Query: 861-933,954-990
View the alignment between query and template
View the model in PyMOL