Citrus Sinensis ID: 001980

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------

MAKGLGLGCTYGIACMSWALVFWYAGVFIRNGVTDGGKAFTAIFSAIVGGMSLGQSFSNLGAFSKGKAAGYKLMEIIKQKPSIIQDPTNGRCLDEVNGNIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNAGHVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTILENILYGKPEATMAEVEAAASAANAHSFITLLPNGYSTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTVAVIQQGQVVETGTHEELIAKAGAYASLIRFQEMVRNRDFANPSTRRSRSTRLSHSLSTKSLSLRSGSLRNLSYSYSTGADGRIEMVSNAETDRKNPAPDGYFLRLLKLNAPEWPYSIMGAIGSVLSGFIGPTFAIVMACMIEVFYYRNPASMERKTKEFVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIADRISVILQNMTSLLTSFIVAFIVEWRVSLLILGTYPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCHELRVPQSQTLRRSLTAGILFGISQFALHASEALILWYGVHLVGKGVSTFSKVIKVFVVLVVTANSVAETVSLAPEIIRGGESVGSVFSTLDRSTRIDPDDPDAEPVETIRGEIELRHVDFAYPSRPDVVVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPALFAASIFDNIAYGKEGATEAEVVEAARAANVHGFVSALPNAYKTPVGERGVQLSGGQKQRIAIARAVLKNPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELVSRPDGAYSRLLQLQHHHI

ccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccCEEEEEEEECcccccccccccccEEEECcccEEEEEccccccHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHccccccccccccccHHHHHHcccccccHHHHHHHHHHHcHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccEEEccccccccccccHHHHHHHHHHHHccccEEEEccccHHHccccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccccCEEEEEEEEECccccccccccccccEEEccccEEEEEccccccHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHccccccccccccccHHHHHccccccccHHHHHHHHHHHcHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEEccEEEEEccHHHHHcccccHHHHHHHHHHHcc

MAKGLGLGCTYGIACMSWALVFWYAGVFIRNGVTDGGKAFTAIFSAIVGGMSLGQSFSNLGAFSKGKAAGYKLMEIIKQKPSIIQDPTNGRCLDEVNGNIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNAGHVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTILENILYGKPEATMAEVEAAASAANAHSFITLLPNGYSTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLMVGRTTVVVAHRLSTIRNVDTVAVIQQGQVVETGTHEELIAKAGAYASLIRFQEM******************************************************************GYFLRLLKLNAPEWPYSIMGAIGSVLSGFIGPTFAIVMACMIEVFYYRNPASMERKTKEFVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEEHNSSLVAARLATDAADVKSAIADRISVILQNMTSLLTSFIVAFIVEWRVSLLILGTYPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCHELRVPQSQTLRRSLTAGILFGISQFALHASEALILWYGVHLVGKGVSTFSKVIKVFVVLVVTANSVAETVSLAPEIIRGGESVGSVFSTL*****************TIRGEIELRHVDFAYPSRPDVVVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRLNLKSLRLKIGLVQQEPALFAASIFDNIAYGKEGATEAEVVEAARAANVHGFVSALPNAYKTPVGERGVQLSGGQKQRIAIARAVLKNPAILLLDEATSALDAESECVLQEALERLMRGRTTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELVSRPDGAYSRLLQLQH***

xxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ABC transporter B family member 19	Auxin efflux transporter that acts as a negative regulator of light signaling to promote hypocotyl elongation. Mediates the accumulation of chlorophyll and anthocyanin, as well as the expression of genes in response to light. Participates in auxin efflux and thus regulates the polar auxin basipetal transport (from auxin-producing leaves to auxin-sensitive tissues, and from root tips to root elongating zone). Involved in divers auxin-mediated responses including gravitropism, phototropism and lateral root formation.	probable	Q9LJX0

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 98-215,227-325
View the alignment between query and template
View the model in PyMOL

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 743-970
View the alignment between query and template
View the model in PyMOL

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 406-984
View the alignment between query and template
View the model in PyMOL

Template: 3NH6, chain A
Confidence level:very confident
Coverage over the Query: 64-338
View the alignment between query and template
View the model in PyMOL

Template: 3QF4, chain B
Confidence level:very confident
Coverage over the Query: 4-338
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3g5u, chain A		very confident	Alignment \| Template Structure