Citrus Sinensis ID: 002026

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------98
MTSPAWLPPEVQQLTANAPISGKPVGGSLVASSTPIAPTSNGSDTATNDSISGPSQAKSVTATGGVIPQSSFSFQNSEGSGHSASSVINSNPSVPPGVSSFTYSASQTVVGYSPNQQFQPNMNKLEAVEDAGLGSSTSTNSQPVQASVRTFSDSTVATSSATALSTTTSWMPTIPSFSTPPGLFVTPQTQAPPGLLTLRTKDTSSAFGDFYSSAGLRPSVPTPSAPSNSGSAIQHQIYPTYPSLPPIGVSPQGPLLRPPQMGVRPWLPFLPYPAAYPSPFPLPAHGMPNPSVSQIDAQPPGLSSVRTAAATSHSAIPGHQLVGTSGNTEAPPSGTDKKEHVHDVSSRIGASVNEQLDAWTAHKTDTGIVYYYNAVTGESTYEKPAGFKGEPDKVPVQPTPISMEHLTGTDWALVTTNDGKKYYYNSKMKVSSWQIPSEVTELKKKEDDDTLKEQSVPNTNIVIEKGSNAISLSSPAVNTGGRDATALRTSSMPGSSSALDLIKKKLQDSGTPTASPAPVSSAAATSESNGSKAVEVTVKGLQNENTKDKLKDINGDGTMSDSSSDSEDGETGPTKEECIIKFKEMLKERGVAPFSKWEKELPKIVFDPRFKAIQSQSARRALFERYVKTRAEEERKEKRAAQKAAIEGFKQLLEEVSEDIDHSTDYQTFKKKWGSDPRFEALDRKDRELLLNERVLPLKRAAEEKAQAIRAAAASSFKSMLREKGDITLSSRWSKVKDILRDDPRYKSVRHEDREVIFNEYVRELKAAEEEAEREAKARREEQEKLKEREREMRKRKEREEQEMERVRLKVRRKEAVTSFQALLVETIKDPQASWTESRPKLEKDPQGRATNADLDSSDREKLFREHIKTLYERCAHDFRGLLAEVITAEAAAQETEDGKTVLNSWSTAKRVLKPEPRYSKMPRKEREALWRRHAEEIQRKHKSSLDQNEDNHKDSKSRSSTDGGRPPSSSRRNQERR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccHHHHHHHcccccHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHccccccHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHccccHHHcccccccccccccccccHHccc
********************************************************************************************************************************************************************************************************************************************************************MGVRPWLPFLPYPAAY********************************************************************************DAWTAHKTDTGIVYYYNAVTGESTY*********************MEHLTGTDWALVTTNDGKKYYYNSKMKVSSWQ**********************************************************************************************************************************************ECIIKFKEMLKERGVAPFSKWEKELPKIVFDPRFKAIQSQSARRALFERYVK********************FKQLLEEVSEDIDHSTDYQTFKKKWGSDPRFEALDRKDRELLLNERVL************************************WSKVKDILRDDPRYKSVRHEDREVIFNEYVREL******************************************RLKVRRKEAVTSFQALLVET**D**ASWTESRPKLEK******************LFREHIKTLYERCAHDFRGLLAEVITAEAAAQETEDGKTVLNSWSTAKRVLKPEPRYSKMPRKEREALWRRHAE******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSPAWLPPEVQQLTANAPISGKPVGGSLVASSTPIAPTSNGSDTATNDSISGPSQAKSVTATGGVIPQSSFSFQNSEGSGHSASSVINSNPSVPPGVSSFTYSASQTVVGYSPNQQFQPNMNKLEAVEDAGLGSSTSTNSQPVQASVRTFSDSTVATSSATALSTTTSWMPTIPSFSTPPGLFVTPQTQAPPGLLTLRTKDTSSAFGDFYSSAGLRPSVPTPSAPSNSGSAIQHQIYPTYPSLPPIGVSPQGPLLRPPQMGVRPWLPFLPYPAAYPSPFPLPAHGMPNPSVSQIDAQPPGLSSVRTAAATSHSAIPGHQLVGTSGNTEAPPSGTDKKEHVHDVSSRIGASVNEQLDAWTAHKTDTGIVYYYNAVTGESTYEKPAGFKGEPDKVPVQPTPISMEHLTGTDWALVTTNDGKKYYYNSKMKVSSWQIPSEVTELKKKEDDDTLKEQSVPNTNIVIEKGSNAISLSSPAVNTGGRDATALRTSSMPGSSSALDLIKKKLQDSGTPTASPAPVSSAAATSESNGSKAVEVTVKGLQNENTKDKLKDINGDGTMSDSSSDSEDGETGPTKEECIIKFKEMLKERGVAPFSKWEKELPKIVFDPRFKAIQSQSARRALFERYVKTRAEEERKEKRAAQKAAIEGFKQLLEEVSEDIDHSTDYQTFKKKWGSDPRFEALDRKDRELLLNERVLPLKRAAEEKAQAIRAAAASSFKSMLREKGDITLSSRWSKVKDILRDDPRYKSVRHEDREVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSFQALLVETIKDPQASWTESRPKLEKDPQGRATNADLDSSDREKLFREHIKTLYERCAHDFRGLLAEVITAEAAAQETEDGKTVLNSWSTAKRVLKPEPRYSKMPRKEREALWRRHAEEIQRKHKSSLDQNEDNHKDSKSRSSTDGGRPPSSSRRNQERR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pre-mRNA-processing protein 40C Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Interacts with both the phosphorylated and the dephosphorylated forms of the CTD domain of the RPB1 subunit of the RNA polymerase II.probableQ9LT25

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DOF, chain A
Confidence level:very confident
Coverage over the Query: 805-881
View the alignment between query and template
View the model in PyMOL
Template: 2DOD, chain A
Confidence level:very confident
Coverage over the Query: 568-639
View the alignment between query and template
View the model in PyMOL
Template: 2DOF, chain A
Confidence level:very confident
Coverage over the Query: 869-887,900-948
View the alignment between query and template
View the model in PyMOL
Template: 2DOE, chain A
Confidence level:very confident
Coverage over the Query: 710-768
View the alignment between query and template
View the model in PyMOL
Template: 2L5F, chain A
Confidence level:very confident
Coverage over the Query: 353-392,403-444
View the alignment between query and template
View the model in PyMOL
Template: 1UZC, chain A
Confidence level:confident
Coverage over the Query: 643-698
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 684-758
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 305-360
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1twf, chain Aprobable Alignment | Template Structure