Citrus Sinensis ID: 002028


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------98
MEEVGAQVAPSILMHQRLSSRLCEAPTMTMTMTMAKKRHLSYQAQSQNHYGGEQQNWNPKLWDWDSVGFVGKPVVDSDPEVLRLGGATASESPNKTTDNINYNYNYNNQKKGNTTTTSAVTVGNVEDDGRLDLNLGGGLTAVDVEQPEPPVVTSKPNKRVRSGSPGTAPYPMCQVDNCKEDLSNAKDYHRRHKVCELHSKSTKALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQPEDITSRMLIHGHGNQSNNPTANVDIVNLLTALARAQGKTEDRSISCSSVPDREQLLMILSKINSLPLPADLAAKLHNFGSLNRKTPVHTSTDVQNRLNENTSSPSTMDLLAVLSSTLTAPSPDTLAAHSQRSSHSSDSEKTKSTCPEQATPNFLKRTTMDFPSVGGERSSTSYQSPVEDSDGQNQETRVNLPLQLFSSSPEDDSPPKLSSSRKYFSSDSSNPIEERSPSSSPVVQTFFPMQSTSETVKSEKLSIGREVNANVEGNRSRGSIMPLELFRGSNKAADNCSFQSFPYQAGYTSSSGSDHSPSSLNSDAQDCTGRIIFKLFDKDPSQFPGTLRKEIYNWLSNSPSEMESYIRPGCVILSLYVSMPYATWEQLEGNLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGNIRVCKSWRTWSSPELISVSPLAVVGGQELSFKLRGRNLTNLGTKIHCTFMGGYASQEVTSSTCQGSIYDEIILAGLKIQDTSPSVLGRFFIEVENGFKGNSFPVIIADATICKELSLLESEFGAEAKVCDVISEHQAHEYGRPRSREEVLHFLNELGWLFQRKRASSIVKGSDYSLSRFKFLLVFSVDRGCCALVKAILDILVEGNLSMDGLSRESLEMLWEIQLLNRAVKMKCRRMVDLLIHYSLTSSNDTPQKYIFPPNLAGPGGITPLHLAACTSDSDDIIDALTNDPQEVSYSIFLLQLSAHLSLIG
cccccccccccHHHHHHHcccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHcccccccccccccEEEEcccEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccEEEEEEcccEEEECcccccccccEEEEccEEEEcccCEEEEEEEccccccccEEEEEEcccccccccccccccccccccccEEEEEEcccccccccccEEEEEcccccccccEEEccHHHHHHHHHHHHHHcccccccHHHcccHHHccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccccccHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHcccccc
*****AQVAPSILMHQRLSSRL*******************************QQNWNPKLWDWDSVGFVGKPVVDS******************************************VTVGNVE**GRLDLNLGGGLT*********************************QVDNCKEDLSNAKDYHRRHKVCELHSKSTKALVGKQMQRFCQQCSRFHPLSEFDEGKRSC*************************************NVDIVNLLTALAR*******************QLLMILSKINSLPLPADL*A***N************************************************************************************************************************************************************************************************************************************************CTGRIIFKLFDKDPSQFPGTLRKEIYNWLSNSPSEMESYIRPGCVILSLYVSMPYATWEQLEGNLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGNIRVCKSWRTWSSPELISVSPLAVVGGQELSFKLRGRNLTNLGTKIHCTFMGGYASQEVTSSTCQGSIYDEIILAGLKIQDTSPSVLGRFFIEVENGFKGNSFPVIIADATICKELSLLESEFGAEAKVCDVISEHQ***YGRPRSREEVLHFLNELGWLFQRKRASSIVKGSDYSLSRFKFLLVFSVDRGCCALVKAILDILVEGNLSMDGLSRESLEMLWEIQLLNRAVKMKCRRMVDLLIHYSLTSSNDTPQKYIFPPNLAGPGGITPLHLAACTSDSDDIIDALTNDPQEVSYSIFLLQLSAHLSLIG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEVGAQVAPSILMHQRLSSRLCEAPTMTMTMTMAKKRHLSYQAQSQNHYGGEQQNWNPKLWDWDSVGFVGKPVVDSDPEVLRLGGATASESPNKTTDNINYNYNYNNQKKGNTTTTSAVTVGNVEDDGRLDLNLGGGLTAVDVEQPEPPVVTSKPNKRVRSGSPGTAPYPMCQVDNCKEDLSNAKDYHRRHKVCELHSKSTKALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQPEDITSRMLIHGHGNQSNNPTANVDIVNLLTALARAQGKTEDRSISCSSVPDREQLLMILSKINSLPLPADLAAKLHNFGSLNRKTPVHTSTDVQNRLNENTSSPSTMDLLAVLSSTLTAPSPDTLAAHSQRSSHSSDSEKTKSTCPEQATPNFLKRTTMDFPSVGGERSSTSYQSPVEDSDGQNQETRVNLPLQLFSSSPEDDSPPKLSSSRKYFSSDSSNPIEERSPSSSPVVQTFFPMQSTSETVKSEKLSIGREVNANVEGNRSRGSIMPLELFRGSNKAADNCSFQSFPYQAGYTSSSGSDHSPSSLNSDAQDCTGRIIFKLFDKDPSQFPGTLRKEIYNWLSNSPSEMESYIRPGCVILSLYVSMPYATWEQLEGNLLQRINSLVQDSDSDFWRNARFLVHTGKQLASHKDGNIRVCKSWRTWSSPELISVSPLAVVGGQELSFKLRGRNLTNLGTKIHCTFMGGYASQEVTSSTCQGSIYDEIILAGLKIQDTSPSVLGRFFIEVENGFKGNSFPVIIADATICKELSLLESEFGAEAKVCDVISEHQAHEYGRPRSREEVLHFLNELGWLFQRKRASSIVKGSDYSLSRFKFLLVFSVDRGCCALVKAILDILVEGNLSMDGLSRESLEMLWEIQLLNRAVKMKCRRMVDLLIHYSLTSSNDTPQKYIFPPNLAGPGGITPLHLAACTSDSDDIIDALTNDPQEVSYSIFLLQLSAHLSLIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Squamosa promoter-binding-like protein 14 Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development.probableQ8RY95
Squamosa promoter-binding-like protein 15 Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.probableQ6Z8M8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UL4, chain A
Confidence level:very confident
Coverage over the Query: 170-250
View the alignment between query and template
View the model in PyMOL
Template: 2ETB, chain A
Confidence level:confident
Coverage over the Query: 847-956
View the alignment between query and template
View the model in PyMOL