Citrus Sinensis ID: 002081
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 971 | 2.2.26 [Sep-21-2011] | |||||||
| Q9ZVT9 | 1020 | C2 and GRAM domain-contai | yes | no | 0.991 | 0.944 | 0.655 | 0.0 | |
| Q9FGS8 | 1027 | C2 and GRAM domain-contai | no | no | 0.980 | 0.926 | 0.426 | 0.0 | |
| Q5R4J5 | 419 | Synaptotagmin-1 OS=Pongo | yes | no | 0.152 | 0.353 | 0.313 | 3e-13 | |
| Q6DN14 | 999 | Multiple C2 and transmemb | yes | no | 0.128 | 0.125 | 0.311 | 3e-13 | |
| Q60HC0 | 419 | Synaptotagmin-1 OS=Macaca | N/A | no | 0.123 | 0.286 | 0.353 | 6e-13 | |
| P21579 | 422 | Synaptotagmin-1 OS=Homo s | no | no | 0.123 | 0.284 | 0.353 | 6e-13 | |
| P21707 | 421 | Synaptotagmin-1 OS=Rattus | yes | no | 0.123 | 0.285 | 0.353 | 6e-13 | |
| Q54E35 | 570 | Rho GTPase-activating pro | yes | no | 0.118 | 0.201 | 0.361 | 6e-13 | |
| P46096 | 421 | Synaptotagmin-1 OS=Mus mu | no | no | 0.123 | 0.285 | 0.353 | 6e-13 | |
| P48018 | 422 | Synaptotagmin-1 OS=Bos ta | yes | no | 0.123 | 0.284 | 0.353 | 6e-13 |
| >sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 | Back alignment and function desciption |
|---|
Score = 1371 bits (3548), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 669/1021 (65%), Positives = 795/1021 (77%), Gaps = 58/1021 (5%)
Query: 1 MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLK 60
MKL VRV+EARN+PAMD NG+SDPYVRLQLG+QR +TKVV+K+L+P W E+FSF V+DL
Sbjct: 1 MKLQVRVVEARNLPAMDLNGFSDPYVRLQLGKQRSRTKVVKKNLNPKWTEDFSFGVDDLN 60
Query: 61 DELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEIL 120
DELV+SVLDEDKYFNDDFVG +++ VS VFDA+N+SL T W+ L PK K SK KDCGEIL
Sbjct: 61 DELVVSVLDEDKYFNDDFVGQVRVSVSLVFDAENQSLGTVWYPLNPKKKGSK-KDCGEIL 119
Query: 121 LTISFSHNTSSADFNINSDPLDQLKTTESPKRSFSGPSNAPSPVRVEDTTSSREEKSCAQ 180
L I FS S D + D ++ + S PS SP R +D +S Q
Sbjct: 120 LKICFSQKNSVLDLTSSGDQTSASRSPDLRLESPIDPSTCASPSRSDDASS------IPQ 173
Query: 181 KTLAGRIAQMFNKNSDTA-----SDRGVDFLELPETTKSELFDDKCVDQSSSASFEEAMK 235
T AGR Q+F KN+ TA S R +D +L E +K + D+SSS SFEE +K
Sbjct: 174 TTFAGRFTQIFQKNAITATPTQSSSRSIDASDLSEISKPVFSLELSEDESSSTSFEELLK 233
Query: 236 TMEPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGP 295
ME +D GSE PSNL GGV+VDQ+++I+P DLN +LF+ DS+F + E QG TE+QIGP
Sbjct: 234 AMESKDQGSEPPSNLSGGVVVDQLFMISPSDLNIVLFASDSSFYASLTELQGTTEVQIGP 293
Query: 296 WRFENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSF 355
W+ EN ES+KR V+Y+KAA KLIKA KG EEQTYLKADG+V+A+LASV+TP+V +GG+F
Sbjct: 294 WKAENDGESVKRVVSYLKAATKLIKAVKGTEEQTYLKADGEVYAVLASVATPDVPFGGTF 353
Query: 356 KTELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFL 415
K E+L+CI+PGPEL SGEQ S LV+SWR+NFLQSTMM+GMIENGAR L++ +EQ+A L
Sbjct: 354 KVEVLYCISPGPELPSGEQCSRLVVSWRLNFLQSTMMRGMIENGARQGLKDNFEQYANLL 413
Query: 416 SQTITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLA 475
+Q++ PVDS D+GLNKEQ L+SLQ EPQSDWKLAV YFANFTV+S+F +GIYV +HI A
Sbjct: 414 AQSVKPVDSKDIGLNKEQALSSLQAEPQSDWKLAVQYFANFTVLSTFLIGIYVFVHIVFA 473
Query: 476 TSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKAQGD 535
+ IQGLEF GLDLPDSIGEF+V GVLVLQ ER LQLISRFMQARKQKGSDHG+KA GD
Sbjct: 474 IPSAIQGLEFNGLDLPDSIGEFVVSGVLVLQCERVLQLISRFMQARKQKGSDHGIKAHGD 533
Query: 536 GWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWN---------- 585
GWLLTVALI+G +LAAVD SG CDPY+VFT NGK+RTSSIKFQ+ +P WN
Sbjct: 534 GWLLTVALIEGVDLAAVDPSGHCDPYIVFTSNGKTRTSSIKFQKSNPQWNEIFEFDAMAD 593
Query: 586 -----------------------------------DLADVWIPLQGKLAQACQSKLHLRI 610
DLADVW+PLQGKLAQACQSKLHLRI
Sbjct: 594 PPSVLNVEVFDFDGPFDEAVSLGHAEVNFVRSNISDLADVWVPLQGKLAQACQSKLHLRI 653
Query: 611 FLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRK 670
FL++T G +VV++YL KMEKEVGKKIN+RSPQTNSAFQKLFGLP EEFLINDFTCHLKRK
Sbjct: 654 FLDHTGGGDVVRDYLNKMEKEVGKKINVRSPQTNSAFQKLFGLPQEEFLINDFTCHLKRK 713
Query: 671 MLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGR 730
M LQGRLFLSARI+GF+A++FG+KT FFFLWEDIE+IQVLPP+L+SMGSP++VMTLR R
Sbjct: 714 MPLQGRLFLSARIVGFYASIFGNKTKFFFLWEDIEEIQVLPPTLASMGSPIVVMTLRPNR 773
Query: 731 GMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEESEAKSL 790
G+DAR GAKT DEEGRLKFHFHSFVS+NVA +TIMALWKA+SL+PEQKVQ VEE + L
Sbjct: 774 GLDARIGAKTHDEEGRLKFHFHSFVSFNVAQKTIMALWKAKSLTPEQKVQAVEEESEQKL 833
Query: 791 QSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWES 850
QSEE G FLG++DV SEV+S LPVP+SFFMELFGGGE++R ME+AGC SYSCS WES
Sbjct: 834 QSEESGLFLGVDDVRFSEVFSLTLPVPVSFFMELFGGGEVDRKAMERAGCQSYSCSPWES 893
Query: 851 EKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLH 910
EK DVYERQ YYR DK ISRYRGEVTSTQQKS +P NGWLVEEVMTLHGVPLGDYFNLH
Sbjct: 894 EKDDVYERQTYYR-DKRISRYRGEVTSTQQKSLVPEKNGWLVEEVMTLHGVPLGDYFNLH 952
Query: 911 LRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFAA 970
LRYQ+E+S S+PK +VY G+ WLKSTRHQKR+TKNI+ NL+DRL++ +EKE+++
Sbjct: 953 LRYQMEESTSKPKTTYVRVYFGIEWLKSTRHQKRVTKNILVNLQDRLKMTFGFLEKEYSS 1012
Query: 971 R 971
R
Sbjct: 1013 R 1013
|
Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9FGS8|C2GR2_ARATH C2 and GRAM domain-containing protein At5g50170 OS=Arabidopsis thaliana GN=At5g50170 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q60HC0|SYT1_MACFA Synaptotagmin-1 OS=Macaca fascicularis GN=SYT1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P21579|SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens GN=SYT1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P21707|SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus GN=Syt1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q54E35|GACEE_DICDI Rho GTPase-activating protein gacEE OS=Dictyostelium discoideum GN=gacEE PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|P46096|SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus GN=Syt1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus GN=SYT1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 971 | ||||||
| 224124726 | 1020 | predicted protein [Populus trichocarpa] | 0.995 | 0.948 | 0.694 | 0.0 | |
| 224089543 | 1012 | predicted protein [Populus trichocarpa] | 0.987 | 0.947 | 0.688 | 0.0 | |
| 359495634 | 1030 | PREDICTED: C2 and GRAM domain-containing | 0.996 | 0.939 | 0.687 | 0.0 | |
| 356532855 | 1018 | PREDICTED: C2 and GRAM domain-containing | 0.994 | 0.948 | 0.661 | 0.0 | |
| 297843150 | 1872 | C2 domain-containing protein [Arabidopsi | 0.991 | 0.514 | 0.649 | 0.0 | |
| 334182268 | 1020 | C2 calcium/lipid-binding and GRAM domain | 0.991 | 0.944 | 0.655 | 0.0 | |
| 357448113 | 1042 | Synaptotagmin-1 [Medicago truncatula] gi | 0.997 | 0.929 | 0.639 | 0.0 | |
| 356555781 | 1018 | PREDICTED: C2 and GRAM domain-containing | 0.994 | 0.948 | 0.657 | 0.0 | |
| 449443488 | 1034 | PREDICTED: C2 and GRAM domain-containing | 0.996 | 0.936 | 0.663 | 0.0 | |
| 356520120 | 1027 | PREDICTED: C2 and GRAM domain-containing | 0.993 | 0.939 | 0.647 | 0.0 |
| >gi|224124726|ref|XP_002329933.1| predicted protein [Populus trichocarpa] gi|222871955|gb|EEF09086.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1441 bits (3730), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 709/1021 (69%), Positives = 823/1021 (80%), Gaps = 54/1021 (5%)
Query: 1 MKLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLK 60
++L VRVIEARN+P D NG SDPY +L+LG+Q+ KTKVV+K+L+PSWEEEFSFKVEDL
Sbjct: 4 LRLFVRVIEARNLPPTDPNGLSDPYAKLRLGKQKCKTKVVKKNLNPSWEEEFSFKVEDLN 63
Query: 61 DELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEIL 120
++LV+ VLDEDK+FNDDFVG +K+PVSRVFDA++KSL TAW+SLQPKNKKSK K+CGEIL
Sbjct: 64 EDLVVCVLDEDKFFNDDFVGLIKVPVSRVFDAEDKSLGTAWYSLQPKNKKSKIKECGEIL 123
Query: 121 LTISFSHNTSSADFNINSDPLDQLKTTESPKRSFSGPSNAPSPVRVEDTTSSREEKSCAQ 180
L+I S S D N N + +SP RSF+G +N+ S R E+T SS+E+K AQ
Sbjct: 124 LSICVSQ--SFPDLNCNGSR-KNVDIMQSPSRSFNGMTNSSS-ARSEETASSKEDKFFAQ 179
Query: 181 KTLAGRIAQMFNKNSDTAS---DRGVDFLELPETTKSELFDDKCVDQSSSASFEEAMKTM 237
K LAGRIAQ+FNKNSD S R + E ET SE+ D+K DQSSS +FEE MK M
Sbjct: 180 KNLAGRIAQIFNKNSDAISATTSRSTEISEQSETDGSEVCDEKAEDQSSSDNFEELMKEM 239
Query: 238 EPRDLGSEVPSNLPGGVLVDQMYVIAPQDLNTLLFSPDSNFPRTWAEEQGNTELQIGPWR 297
+ RD+GSEVP NLPGGVLVDQ Y+IA DLN+LLFSPDS+F R+ ++ GN+E Q GPW+
Sbjct: 240 KSRDVGSEVPKNLPGGVLVDQSYLIATPDLNSLLFSPDSSFARSLSDFLGNSEQQFGPWK 299
Query: 298 FENGCESLKRDVTYIKAANKLIKATKGFEEQTYLKADGKVFAILASVSTPEVMYGGSFKT 357
FENG SLKR +TY++A +KL+ A K E+Q Y+K DGK FAIL VSTP+VMYG +FK
Sbjct: 300 FENGSGSLKRVITYVRAPSKLVGAVKASEDQIYVKVDGKTFAILNCVSTPDVMYGSTFKV 359
Query: 358 ELLFCITPGPELSSGEQSSHLVISWRMNFLQSTMMKGMIENGARSALRETYEQFATFLSQ 417
ELL+CITPGPEL SGE++SHLVISWRMNFLQSTM K MIENGAR+ L++++EQF+TFLSQ
Sbjct: 360 ELLYCITPGPELPSGEETSHLVISWRMNFLQSTMFKSMIENGARAGLKDSFEQFSTFLSQ 419
Query: 418 TITPVDSNDMGLNKEQILASLQPEPQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATS 477
T+ PVD DMG +KEQ+LASL+ EPQSD KLAV YFANFTVVS+FFMG+YV +HIWLA
Sbjct: 420 TVKPVDLKDMGSSKEQVLASLKAEPQSDRKLAVQYFANFTVVSAFFMGLYVFVHIWLAAP 479
Query: 478 TTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQARKQKGSDHGVKAQGDGW 537
+ IQGLEF+GLDLPDSIGE +VC VL LQ ER L L+SRFMQAR QKG+DHGVKAQGDGW
Sbjct: 480 SAIQGLEFLGLDLPDSIGEVLVCSVLALQCERVLGLLSRFMQARAQKGTDHGVKAQGDGW 539
Query: 538 LLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWN------------ 585
LLTVALI+G +L VDSSGFCDPYVVFTCNGK++TSSIKFQ+ DP+WN
Sbjct: 540 LLTVALIEGSHLPTVDSSGFCDPYVVFTCNGKTKTSSIKFQKSDPLWNEIFEFDAMDDPP 599
Query: 586 ---------------------------------DLADVWIPLQGKLAQACQSKLHLRIFL 612
DLADVW+PLQGKLAQACQSKLHLRIFL
Sbjct: 600 SVLDVDVYDFDGPFDEAMSLGHTEINFVKSNLSDLADVWVPLQGKLAQACQSKLHLRIFL 659
Query: 613 NNTKGSNVVKEYLTKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKML 672
NNT+GSNVVKEYL+KMEKEVGKKIN+RSPQTNSAFQK+FGLPPEEFLINDFTCHLKRKM
Sbjct: 660 NNTRGSNVVKEYLSKMEKEVGKKINVRSPQTNSAFQKVFGLPPEEFLINDFTCHLKRKMP 719
Query: 673 LQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGM 732
LQGRLFLSARIIGF+ANLF KT FFFLWEDIEDIQ+ P+LSSMGSPVIV+TLRQG+GM
Sbjct: 720 LQGRLFLSARIIGFYANLFRQKTKFFFLWEDIEDIQIYTPTLSSMGSPVIVITLRQGKGM 779
Query: 733 DARHGAKTQDEEGRLKFHFHSFVSYNVAH-RTIMALWKARSLSPEQKVQIVEE-SEAKSL 790
DARHGAK D+EGRLKFHF SFVS+NVAH RTIMALWKARSLS EQKVQIVEE SE K L
Sbjct: 780 DARHGAKNIDDEGRLKFHFQSFVSFNVAHSRTIMALWKARSLSLEQKVQIVEEDSETKIL 839
Query: 791 QSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWES 850
Q+EE G+FLGLEDV+MSEVY++ VP +F ME+FGGGEL+R VMEKAGC+SYS + WES
Sbjct: 840 QTEESGSFLGLEDVSMSEVYAASFSVPTNFVMEMFGGGELDRKVMEKAGCLSYSYTPWES 899
Query: 851 EKLDVYERQIYYRFDKCISRYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLH 910
K DV+ERQIYYRFDK ISR+ GEVTSTQQK PL + GWLVEEVMTLHGVPLGDYFNLH
Sbjct: 900 VKTDVHERQIYYRFDKRISRFGGEVTSTQQKYPLSDRKGWLVEEVMTLHGVPLGDYFNLH 959
Query: 911 LRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKNIVSNLEDRLRVKLSVIEKEFAA 970
LRYQVED PSR KGC +V +G+ WLKSTRHQKRI+KNI+SNL+DRL+V S++EKEF
Sbjct: 960 LRYQVEDFPSRLKGCHVRVSIGIQWLKSTRHQKRISKNILSNLQDRLKVIFSLVEKEFVN 1019
Query: 971 R 971
R
Sbjct: 1020 R 1020
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224089543|ref|XP_002308750.1| predicted protein [Populus trichocarpa] gi|222854726|gb|EEE92273.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359495634|ref|XP_002264782.2| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Vitis vinifera] gi|297736702|emb|CBI25738.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356532855|ref|XP_003534985.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297843150|ref|XP_002889456.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335298|gb|EFH65715.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|334182268|ref|NP_171836.3| C2 calcium/lipid-binding and GRAM domain containing protein [Arabidopsis thaliana] gi|75315948|sp|Q9ZVT9.4|C2GR1_ARATH RecName: Full=C2 and GRAM domain-containing protein At1g03370 gi|15778696|gb|AAC72128.2| Contains similarity to gb|AB011110 KIAA0538 protein from Homo sapiens brain and to phospholipid-binding domain C2 PF|00168. ESTs gb|AA585988 and gb|T04384 come from this gene [Arabidopsis thaliana] gi|21539553|gb|AAM53329.1| unknown protein [Arabidopsis thaliana] gi|332189444|gb|AEE27565.1| C2 calcium/lipid-binding and GRAM domain containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357448113|ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355483380|gb|AES64583.1| Synaptotagmin-1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356555781|ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449443488|ref|XP_004139509.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356520120|ref|XP_003528713.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 971 | ||||||
| UNIPROTKB|Q66VB0 | 1086 | Os06g0607900 "Os06g0607900 pro | 0.397 | 0.355 | 0.597 | 4.7e-274 | |
| UNIPROTKB|Q5Z6I4 | 1037 | OSJNBa0055N24.36 "Putative Osn | 0.394 | 0.369 | 0.677 | 2.7e-268 | |
| TAIR|locus:2157707 | 1027 | AT5G50170 "AT5G50170" [Arabido | 0.595 | 0.562 | 0.398 | 2.7e-226 | |
| UNIPROTKB|Q69V64 | 354 | P0556B08.10 "C2 domain-contain | 0.357 | 0.980 | 0.601 | 4.5e-114 | |
| TAIR|locus:2097578 | 594 | AT3G59660 "AT3G59660" [Arabido | 0.221 | 0.361 | 0.274 | 5e-19 | |
| ZFIN|ZDB-GENE-040718-165 | 419 | syt1a "synaptotagmin Ia" [Dani | 0.122 | 0.284 | 0.364 | 3.5e-16 | |
| UNIPROTKB|J9P243 | 425 | SYT6 "Uncharacterized protein" | 0.122 | 0.28 | 0.353 | 3.1e-15 | |
| UNIPROTKB|F1SBR7 | 501 | SYT6 "Uncharacterized protein" | 0.122 | 0.237 | 0.353 | 6.3e-15 | |
| UNIPROTKB|E1BGL9 | 509 | SYT6 "Uncharacterized protein" | 0.122 | 0.233 | 0.353 | 6.7e-15 | |
| UNIPROTKB|F1PQ58 | 510 | SYT6 "Uncharacterized protein" | 0.122 | 0.233 | 0.353 | 6.8e-15 |
| UNIPROTKB|Q66VB0 Os06g0607900 "Os06g0607900 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 1250 (445.1 bits), Expect = 4.7e-274, Sum P(3) = 4.7e-274
Identities = 232/388 (59%), Positives = 298/388 (76%)
Query: 585 NDLADVWIPLQGKLAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKKINLRSPQTN 644
+DL DVW+PL+GK Q K+HLRIFLNN++G+ VV YL KM KEVGKKINLRS QTN
Sbjct: 696 SDLTDVWLPLEGKCDQTSNPKIHLRIFLNNSRGTEVVMNYLAKMRKEVGKKINLRSAQTN 755
Query: 645 SAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDI 704
+AF+KLF LPPEEFLI+DFTCHLKRKM LQGRLF S RIIGF++N+FGHKT FFFLW+D+
Sbjct: 756 AAFRKLFNLPPEEFLIDDFTCHLKRKMPLQGRLFFSPRIIGFYSNIFGHKTKFFFLWDDV 815
Query: 705 EDIQVLPPSLSSMGSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSYNVAHRTI 764
+DIQV+PP+LS +GSP + + LR+GRG++A+HGAK D GRLK++F SFVS+N AHR I
Sbjct: 816 DDIQVIPPTLS-IGSPSLTIILRKGRGLEAKHGAKGTDPNGRLKYYFQSFVSFNDAHRII 874
Query: 765 MALWKARSLSPEQKVQIVE-ESEAKSLQSEEGGTFLGLEDVTMSEVYSSVLPVPMSFFME 823
MA+WK RSLSPEQ+ ++E ES+ K LQ EEGGT EDV MSE++SS L V + ME
Sbjct: 875 MAIWKMRSLSPEQQGDMIEKESDTKELQLEEGGTLFTHEDVKMSEIFSSALSVDVESLME 934
Query: 824 LFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRFDKCISRYRGEVTSTQQKSP 883
+F GG LE +M+KAGC+ YS + WE ++Y+RQI Y+FDK +SRY GE T+TQQ+
Sbjct: 935 MFSGGPLEHRMMQKAGCIDYSPTEWELVSRNIYQRQISYKFDKNLSRYGGEATTTQQRYA 994
Query: 884 LPNGNGWLVEEVMTLHGVPLGDYFNLHLRYQVEDSPSRPKGCLAQVYLGVAWLKSTRHQK 943
L N GW +EEVM+L GV LGD FN+ ++Y V + PS+P C QV LG+AWLKST+ QK
Sbjct: 995 LVNQEGWAIEEVMSLQGVLLGDCFNVQMKYTVVNVPSKPNTCSVQVLLGIAWLKSTKQQK 1054
Query: 944 RITKNIVSNLEDRLRVKLSVIEKEFAAR 971
+ITK+++SN RL+ + +EK+ +R
Sbjct: 1055 KITKSVISNSSIRLKELFAEVEKDLTSR 1082
|
|
| UNIPROTKB|Q5Z6I4 OSJNBa0055N24.36 "Putative Osnop" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157707 AT5G50170 "AT5G50170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q69V64 P0556B08.10 "C2 domain-containing protein-like" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2097578 AT3G59660 "AT3G59660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-165 syt1a "synaptotagmin Ia" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P243 SYT6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SBR7 SYT6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BGL9 SYT6 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PQ58 SYT6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9ZVT9 | C2GR1_ARATH | No assigned EC number | 0.6552 | 0.9917 | 0.9441 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 971 | |||
| cd13219 | 161 | cd13219, PH-GRAM_C2-GRAM, C2 and GRAM domain-conta | 1e-109 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 5e-29 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 2e-25 | |
| pfam00168 | 85 | pfam00168, C2, C2 domain | 1e-24 | |
| cd04026 | 131 | cd04026, C2_PKC_alpha_gamma, C2 domain in Protein | 1e-23 | |
| cd08376 | 116 | cd08376, C2B_MCTP_PRT, C2 domain second repeat fou | 3e-21 | |
| cd08377 | 119 | cd08377, C2C_MCTP_PRT, C2 domain third repeat foun | 3e-21 | |
| cd08682 | 126 | cd08682, C2_Rab11-FIP_classI, C2 domain found in R | 1e-19 | |
| cd04042 | 121 | cd04042, C2A_MCTP_PRT, C2 domain first repeat foun | 2e-19 | |
| cd04024 | 128 | cd04024, C2A_Synaptotagmin-like, C2 domain first r | 1e-18 | |
| cd04019 | 150 | cd04019, C2C_MCTP_PRT_plant, C2 domain third repea | 1e-18 | |
| cd08385 | 124 | cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain | 1e-17 | |
| cd04040 | 115 | cd04040, C2D_Tricalbin-like, C2 domain fourth repe | 1e-17 | |
| cd08386 | 125 | cd08386, C2A_Synaptotagmin-7, C2A domain first rep | 4e-17 | |
| cd04009 | 133 | cd04009, C2B_Munc13-like, C2 domain second repeat | 5e-17 | |
| cd08688 | 110 | cd08688, C2_KIAA0528-like, C2 domain found in the | 1e-16 | |
| cd04035 | 123 | cd04035, C2A_Rabphilin_Doc2, C2 domain first repea | 1e-16 | |
| cd04033 | 133 | cd04033, C2_NEDD4_NEDD4L, C2 domain present in the | 2e-16 | |
| cd04038 | 145 | cd04038, C2_ArfGAP, C2 domain present in Arf GTPas | 2e-16 | |
| cd08391 | 121 | cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir | 3e-16 | |
| cd08375 | 136 | cd08375, C2_Intersectin, C2 domain present in Inte | 3e-16 | |
| cd08384 | 133 | cd08384, C2B_Rabphilin_Doc2, C2 domain second repe | 4e-16 | |
| cd00276 | 134 | cd00276, C2B_Synaptotagmin, C2 domain second repea | 8e-16 | |
| smart00568 | 60 | smart00568, GRAM, domain in glucosyltransferases, | 2e-15 | |
| cd08388 | 128 | cd08388, C2A_Synaptotagmin-4-11, C2A domain first | 3e-15 | |
| cd08402 | 136 | cd08402, C2B_Synaptotagmin-1, C2 domain second rep | 3e-15 | |
| cd08675 | 137 | cd08675, C2B_RasGAP, C2 domain second repeat of Ra | 4e-15 | |
| cd04025 | 123 | cd04025, C2B_RasA1_RasA4, C2 domain second repeat | 5e-14 | |
| cd08405 | 136 | cd08405, C2B_Synaptotagmin-7, C2 domain second rep | 5e-14 | |
| cd13220 | 111 | cd13220, PH-GRAM_GRAMDC, GRAM domain-containing pr | 8e-14 | |
| cd04027 | 127 | cd04027, C2B_Munc13, C2 domain second repeat in Mu | 3e-13 | |
| cd04030 | 127 | cd04030, C2C_KIAA1228, C2 domain third repeat pres | 4e-13 | |
| cd04031 | 125 | cd04031, C2A_RIM1alpha, C2 domain first repeat con | 5e-13 | |
| cd04022 | 127 | cd04022, C2A_MCTP_PRT_plant, C2 domain first repea | 6e-13 | |
| pfam02893 | 60 | pfam02893, GRAM, GRAM domain | 8e-13 | |
| cd04017 | 135 | cd04017, C2D_Ferlin, C2 domain fourth repeat in Fe | 1e-12 | |
| cd08387 | 124 | cd08387, C2A_Synaptotagmin-8, C2A domain first rep | 1e-12 | |
| cd08681 | 118 | cd08681, C2_fungal_Inn1p-like, C2 domain found in | 2e-12 | |
| cd04054 | 121 | cd04054, C2A_Rasal1_RasA4, C2 domain first repeat | 7e-12 | |
| cd04036 | 119 | cd04036, C2_cPLA2, C2 domain present in cytosolic | 1e-11 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 1e-11 | |
| cd04020 | 162 | cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat | 2e-11 | |
| cd04037 | 124 | cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer | 4e-11 | |
| cd00275 | 128 | cd00275, C2_PLC_like, C2 domain present in Phospho | 5e-11 | |
| cd04011 | 111 | cd04011, C2B_Ferlin, C2 domain second repeat in Fe | 9e-11 | |
| cd04050 | 105 | cd04050, C2B_Synaptotagmin-like, C2 domain second | 9e-11 | |
| cd08676 | 153 | cd08676, C2A_Munc13-like, C2 domain first repeat i | 1e-10 | |
| cd04049 | 124 | cd04049, C2_putative_Elicitor-responsive_gene, C2 | 2e-10 | |
| cd04010 | 148 | cd04010, C2B_RasA3, C2 domain second repeat presen | 2e-10 | |
| cd04041 | 111 | cd04041, C2A_fungal, C2 domain first repeat; funga | 2e-10 | |
| cd08378 | 121 | cd08378, C2B_MCTP_PRT_plant, C2 domain second repe | 3e-10 | |
| cd04046 | 126 | cd04046, C2_Calpain, C2 domain present in Calpain | 6e-10 | |
| cd08403 | 134 | cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s | 8e-10 | |
| cd08390 | 123 | cd08390, C2A_Synaptotagmin-15-17, C2A domain first | 8e-10 | |
| cd08404 | 136 | cd08404, C2B_Synaptotagmin-4, C2 domain second rep | 1e-09 | |
| cd04045 | 120 | cd04045, C2C_Tricalbin-like, C2 domain third repea | 4e-09 | |
| cd08383 | 117 | cd08383, C2A_RasGAP, C2 domain (first repeat) of R | 5e-09 | |
| cd08394 | 127 | cd08394, C2A_Munc13, C2 domain first repeat in Mun | 1e-08 | |
| cd04039 | 108 | cd04039, C2_PSD, C2 domain present in Phosphatidyl | 3e-08 | |
| cd08410 | 135 | cd08410, C2B_Synaptotagmin-17, C2 domain second re | 3e-08 | |
| cd10570 | 94 | cd10570, PH-GRAM, Pleckstrin Homology-Glucosyltran | 3e-08 | |
| cd08381 | 122 | cd08381, C2B_PI3K_class_II, C2 domain second repea | 4e-08 | |
| cd04043 | 126 | cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma | 4e-08 | |
| cd08382 | 123 | cd08382, C2_Smurf-like, C2 domain present in Smad | 8e-08 | |
| cd04040 | 115 | cd04040, C2D_Tricalbin-like, C2 domain fourth repe | 1e-07 | |
| cd13351 | 125 | cd13351, PH-GRAM1_TCB1D9_TCB1D9B, TBC1 domain fami | 1e-07 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 4e-07 | |
| cd08678 | 126 | cd08678, C2_C21orf25-like, C2 domain found in the | 6e-07 | |
| pfam00168 | 85 | pfam00168, C2, C2 domain | 1e-06 | |
| cd08389 | 124 | cd08389, C2A_Synaptotagmin-14_16, C2A domain first | 2e-06 | |
| cd08400 | 126 | cd08400, C2_Ras_p21A1, C2 domain present in RAS p2 | 3e-06 | |
| cd08373 | 127 | cd08373, C2A_Ferlin, C2 domain first repeat in Fer | 3e-06 | |
| cd04052 | 111 | cd04052, C2B_Tricalbin-like, C2 domain second repe | 8e-06 | |
| cd04018 | 151 | cd04018, C2C_Ferlin, C2 domain third repeat in Fer | 1e-05 | |
| cd08401 | 121 | cd08401, C2A_RasA2_RasA3, C2 domain first repeat p | 2e-05 | |
| cd04015 | 158 | cd04015, C2_plant_PLD, C2 domain present in plant | 3e-05 | |
| cd04047 | 110 | cd04047, C2B_Copine, C2 domain second repeat in Co | 3e-05 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 5e-05 | |
| cd04042 | 121 | cd04042, C2A_MCTP_PRT, C2 domain first repeat foun | 5e-05 | |
| cd08393 | 125 | cd08393, C2A_SLP-1_2, C2 domain first repeat prese | 8e-05 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 2e-04 | |
| COG5038 | 1227 | COG5038, COG5038, Ca2+-dependent lipid-binding pro | 2e-04 | |
| cd04032 | 127 | cd04032, C2_Perforin, C2 domain of Perforin | 2e-04 | |
| cd04016 | 121 | cd04016, C2_Tollip, C2 domain present in Toll-inte | 2e-04 | |
| cd08409 | 137 | cd08409, C2B_Synaptotagmin-15, C2 domain second re | 2e-04 | |
| cd08403 | 134 | cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s | 3e-04 | |
| cd13216 | 117 | cd13216, PH-GRAM2_AGT26, Autophagy-related protein | 4e-04 | |
| cd04038 | 145 | cd04038, C2_ArfGAP, C2 domain present in Arf GTPas | 7e-04 | |
| cd08521 | 123 | cd08521, C2A_SLP, C2 domain first repeat present i | 9e-04 | |
| cd13350 | 135 | cd13350, PH-GRAM1_TBC1D8B, TBC1 domain family memb | 9e-04 | |
| cd08376 | 116 | cd08376, C2B_MCTP_PRT, C2 domain second repeat fou | 0.001 | |
| cd00276 | 134 | cd00276, C2B_Synaptotagmin, C2 domain second repea | 0.001 | |
| cd08685 | 119 | cd08685, C2_RGS-like, C2 domain of the Regulator O | 0.002 | |
| cd04014 | 132 | cd04014, C2_PKC_epsilon, C2 domain in Protein Kina | 0.002 | |
| cd04044 | 124 | cd04044, C2A_Tricalbin-like, C2 domain first repea | 0.002 | |
| cd04024 | 128 | cd04024, C2A_Synaptotagmin-like, C2 domain first r | 0.003 | |
| cd08384 | 133 | cd08384, C2B_Rabphilin_Doc2, C2 domain second repe | 0.004 | |
| cd04025 | 123 | cd04025, C2B_RasA1_RasA4, C2 domain second repeat | 0.004 |
| >gnl|CDD|241373 cd13219, PH-GRAM_C2-GRAM, C2 and GRAM domain-containing protein Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain | Back alignment and domain information |
|---|
Score = 335 bits (861), Expect = e-109
Identities = 136/161 (84%), Positives = 145/161 (90%), Gaps = 1/161 (0%)
Query: 626 TKMEKEVGKKINLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIG 685
+KMEKEVGKKINLRSPQ NSAFQKLFGLPPEEFLINDFTC LKRK LQGRLFLSARIIG
Sbjct: 1 SKMEKEVGKKINLRSPQKNSAFQKLFGLPPEEFLINDFTCALKRKFPLQGRLFLSARIIG 60
Query: 686 FHANLFGHKTNFFFLWEDIEDIQVLPPSLSSMGSPVIVMTLRQGRGMDARHGAKTQDEEG 745
F++NLFGHKT FFFLWEDIE+IQV PPSL S+GSP IV+ LR+GRG+DARHGAK QD EG
Sbjct: 61 FYSNLFGHKTKFFFLWEDIEEIQVSPPSL-SVGSPSIVIILRKGRGLDARHGAKPQDPEG 119
Query: 746 RLKFHFHSFVSYNVAHRTIMALWKARSLSPEQKVQIVEESE 786
RLKFHF SFVS+N A RTIMALWK RSLSPEQK QIVEESE
Sbjct: 120 RLKFHFQSFVSFNHAFRTIMALWKNRSLSPEQKKQIVEESE 160
|
C2GRAM contains two N-terminal C2 domains followed by a single PH-GRAM domain. Since it contains both of these domains it is assumed that this gene cross-links both calcium and phosphoinositide signaling pathways. In general he C2 domain is involved in binding phospholipids in a calcium dependent manner or calcium independent manner. The GRAM domain is found in glucosyltransferases, myotubularins and other putative membrane-associated proteins. The GRAM domain is part of a larger motif with a pleckstrin homology (PH) domain fold. Length = 161 |
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|215765 pfam00168, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >gnl|CDD|214725 smart00568, GRAM, domain in glucosyltransferases, myotubularins and other putative membrane-associated proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|241374 cd13220, PH-GRAM_GRAMDC, GRAM domain-containing protein (GRAMDC) Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain | Back alignment and domain information |
|---|
| >gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|217271 pfam02893, GRAM, GRAM domain | Back alignment and domain information |
|---|
| >gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >gnl|CDD|176040 cd08394, C2A_Munc13, C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >gnl|CDD|241306 cd10570, PH-GRAM, Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain | Back alignment and domain information |
|---|
| >gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241505 cd13351, PH-GRAM1_TCB1D9_TCB1D9B, TBC1 domain family members 9 and 9B (TBC1D9 and TBC1D9B) Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >gnl|CDD|215765 pfam00168, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin | Back alignment and domain information |
|---|
| >gnl|CDD|175983 cd04016, C2_Tollip, C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >gnl|CDD|241370 cd13216, PH-GRAM2_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241504 cd13350, PH-GRAM1_TBC1D8B, TBC1 domain family member 8B (TBC1D8B) Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >gnl|CDD|176067 cd08685, C2_RGS-like, C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 971 | |||
| KOG1032 | 590 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| KOG1032 | 590 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 99.82 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.8 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 99.78 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 99.77 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.76 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 99.76 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 99.75 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 99.75 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 99.74 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 99.73 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 99.72 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 99.72 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 99.72 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 99.72 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 99.72 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 99.71 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 99.71 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 99.71 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 99.7 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 99.7 | |
| KOG1030 | 168 | consensus Predicted Ca2+-dependent phospholipid-bi | 99.69 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 99.69 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 99.69 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 99.68 | |
| PF02893 | 69 | GRAM: GRAM domain; InterPro: IPR004182 The GRAM do | 99.68 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 99.68 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 99.68 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 99.68 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 99.66 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 99.66 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 99.66 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 99.66 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 99.66 | |
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 99.66 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 99.65 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 99.65 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 99.65 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 99.64 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 99.63 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 99.62 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 99.62 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 99.62 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 99.61 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 99.61 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 99.6 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 99.6 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 99.6 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 99.6 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 99.6 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 99.6 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 99.59 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 99.59 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 99.59 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 99.58 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 99.58 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 99.58 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 99.57 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 99.57 | |
| KOG1028 | 421 | consensus Ca2+-dependent phospholipid-binding prot | 99.57 | |
| smart00568 | 61 | GRAM domain in glucosyltransferases, myotubularins | 99.57 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 99.57 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 99.55 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 99.55 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 99.53 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 99.53 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 99.53 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 99.53 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 99.53 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 99.53 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 99.52 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 99.52 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 99.52 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 99.51 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 99.5 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 99.5 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 99.49 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 99.49 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 99.49 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 99.49 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 99.48 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 99.46 | |
| PLN03008 | 868 | Phospholipase D delta | 99.46 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 99.45 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 99.45 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 99.45 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 99.45 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 99.44 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 99.43 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 99.42 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 99.42 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.42 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 99.41 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 99.4 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 99.37 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 99.36 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 99.34 | |
| KOG1011 | 1283 | consensus Neurotransmitter release regulator, UNC- | 99.34 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 99.33 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 99.32 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.29 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 99.28 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 99.26 | |
| KOG1030 | 168 | consensus Predicted Ca2+-dependent phospholipid-bi | 99.19 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 99.1 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 99.07 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 99.05 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 99.03 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 98.99 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 98.98 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 98.98 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 98.95 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 98.95 | |
| KOG1328 | 1103 | consensus Synaptic vesicle protein BAIAP3, involve | 98.95 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 98.93 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 98.91 | |
| PLN02270 | 808 | phospholipase D alpha | 98.9 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 98.88 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 98.88 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 98.86 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 98.85 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 98.84 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 98.83 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 98.82 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 98.82 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 98.81 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 98.79 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 98.79 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 98.78 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 98.78 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 98.78 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 98.78 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 98.77 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 98.77 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 98.76 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 98.75 | |
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 98.75 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 98.75 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 98.74 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 98.74 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 98.73 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 98.73 | |
| KOG1028 | 421 | consensus Ca2+-dependent phospholipid-binding prot | 98.71 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 98.7 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 98.7 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 98.7 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 98.7 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 98.69 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 98.69 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 98.68 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 98.67 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 98.66 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 98.66 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 98.66 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 98.65 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 98.65 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 98.63 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 98.63 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 98.63 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 98.63 | |
| KOG1264 | 1267 | consensus Phospholipase C [Lipid transport and met | 98.62 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 98.62 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 98.61 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 98.61 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 98.61 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 98.61 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 98.61 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 98.6 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 98.58 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 98.57 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 98.57 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 98.56 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 98.56 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 98.56 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 98.54 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 98.53 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 98.53 | |
| KOG1031 | 1169 | consensus Predicted Ca2+-dependent phospholipid-bi | 98.52 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 98.5 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 98.49 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 98.49 | |
| KOG1328 | 1103 | consensus Synaptic vesicle protein BAIAP3, involve | 98.49 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 98.48 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 98.48 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 98.46 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 98.46 | |
| KOG1013 | 362 | consensus Synaptic vesicle protein rabphilin-3A [I | 98.46 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 98.46 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 98.45 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 98.45 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 98.44 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 98.38 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 98.38 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 98.38 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 98.36 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 98.36 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 98.35 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 98.35 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 98.33 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 98.32 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 98.32 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 98.31 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 98.28 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 98.27 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 98.27 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 98.24 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 98.23 | |
| PLN02352 | 758 | phospholipase D epsilon | 98.22 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 98.22 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 98.21 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 98.2 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 98.18 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.16 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 98.16 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 98.14 | |
| KOG4347 | 671 | consensus GTPase-activating protein VRP [General f | 98.02 | |
| KOG1326 | 1105 | consensus Membrane-associated protein FER-1 and re | 97.89 | |
| PLN03008 | 868 | Phospholipase D delta | 97.87 | |
| KOG1011 | 1283 | consensus Neurotransmitter release regulator, UNC- | 97.86 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 97.72 | |
| KOG0905 | 1639 | consensus Phosphoinositide 3-kinase [Signal transd | 97.65 | |
| KOG1013 | 362 | consensus Synaptic vesicle protein rabphilin-3A [I | 97.47 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 97.45 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 97.39 | |
| cd08683 | 143 | C2_C2cd3 C2 domain found in C2 calcium-dependent d | 97.28 | |
| KOG1326 | 1105 | consensus Membrane-associated protein FER-1 and re | 97.12 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 96.96 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 96.9 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 96.78 | |
| KOG2060 | 405 | consensus Rab3 effector RIM1 and related proteins, | 96.77 | |
| KOG1327 | 529 | consensus Copine [Signal transduction mechanisms] | 96.41 | |
| PF14470 | 96 | bPH_3: Bacterial PH domain | 96.12 | |
| cd08684 | 103 | C2A_Tac2-N C2 domain first repeat found in Tac2-N | 95.82 | |
| PLN02270 | 808 | phospholipase D alpha | 95.81 | |
| PF12416 | 340 | DUF3668: Cep120 protein; InterPro: IPR022136 This | 95.75 | |
| KOG3837 | 523 | consensus Uncharacterized conserved protein, conta | 95.63 | |
| KOG1031 | 1169 | consensus Predicted Ca2+-dependent phospholipid-bi | 95.42 | |
| KOG1265 | 1189 | consensus Phospholipase C [Lipid transport and met | 95.35 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 95.16 | |
| PF10698 | 159 | DUF2505: Protein of unknown function (DUF2505); In | 94.54 | |
| PF15627 | 156 | CEP76-C2: CEP76 C2 domain | 94.44 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 93.79 | |
| PF10698 | 159 | DUF2505: Protein of unknown function (DUF2505); In | 93.38 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 93.04 | |
| cd08693 | 173 | C2_PI3K_class_I_beta_delta C2 domain present in cl | 92.96 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 92.73 | |
| PF11605 | 89 | Vps36_ESCRT-II: Vacuolar protein sorting protein 3 | 92.55 | |
| PF14844 | 106 | PH_BEACH: PH domain associated with Beige/BEACH; P | 92.52 | |
| cd08398 | 158 | C2_PI3K_class_I_alpha C2 domain present in class I | 92.33 | |
| cd08380 | 156 | C2_PI3K_like C2 domain present in phosphatidylinos | 91.01 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 90.93 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 90.36 | |
| PF10358 | 143 | NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; | 89.97 | |
| cd08397 | 159 | C2_PI3K_class_III C2 domain present in class III p | 88.09 | |
| cd04012 | 171 | C2A_PI3K_class_II C2 domain first repeat present i | 87.75 | |
| KOG1264 | 1267 | consensus Phospholipase C [Lipid transport and met | 86.11 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 86.1 | |
| KOG1452 | 442 | consensus Predicted Rho GTPase-activating protein | 85.52 | |
| cd08687 | 98 | C2_PKN-like C2 domain in Protein kinase C-like (PK | 82.73 | |
| KOG0905 | 1639 | consensus Phosphoinositide 3-kinase [Signal transd | 81.0 | |
| cd05018 | 144 | CoxG Carbon monoxide dehydrogenase subunit G (CoxG | 80.13 |
| >KOG1032 consensus Uncharacterized conserved protein, contains GRAM domain [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-35 Score=350.84 Aligned_cols=528 Identities=31% Similarity=0.397 Sum_probs=451.5
Q ss_pred CccchhhhhhcccchhhhHHHHHHHHHHHhhhhccCCCcccccccCCCCCcchhhheeeeEEEEEehhhhHHHHHHHHHH
Q 002081 442 PQSDWKLAVHYFANFTVVSSFFMGIYVLIHIWLATSTTIQGLEFVGLDLPDSIGEFIVCGVLVLQGERFLQLISRFMQAR 521 (971)
Q Consensus 442 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 521 (971)
+..+|+....+|....++.....-+++-+|+-.+.+...+|.+|.|+++||..|++.-..+++.+.+|......+|.+++
T Consensus 2 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~q~~~~~~~n~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~k 81 (590)
T KOG1032|consen 2 PHMQQKSESPKFAKVSVLLSSPLGISVDVAMNVEESAKIQGFPFLGLNLPDVSGSLFSSKVISSDLERSSDRVDSFASAK 81 (590)
T ss_pred CcccccccccchhhhhcccccccccccceeccccccccccCcccccCCchhhcccccCCccccccccccccccccccccc
Confidence 34568888899999999988888899999999999999999999999999999999999999999999999999999999
Q ss_pred HhcCCCCceeeecCceEEEEEEEeecCCccCCCCCCCCCeEEEEeCCeeeeeecccccCCCCCc----------------
Q 002081 522 KQKGSDHGVKAQGDGWLLTVALIKGDNLAAVDSSGFCDPYVVFTCNGKSRTSSIKFQQCDPMWN---------------- 585 (971)
Q Consensus 522 ~~~g~d~~~~~~~~~~~l~v~l~~~~~l~~~d~~g~sdPyv~~~~~~~~~~s~v~~~~~np~wn---------------- 585 (971)
...|.+++++..+++|...+..+.|.+++..+.++.+|||++++|.+..+.+++..|..+|.|+
T Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~n~~~~~~~l~~~~~cal~reillQGrmyis~~~icF~s~i~gw~~~~ 161 (590)
T KOG1032|consen 82 LHKGGLKGSPKTEKGYIGSSALLAGVNLASEFLNGVPDPEILLTDYSCALQREILLQGRMYISEEHICFNSNIFGWETKV 161 (590)
T ss_pred cCCCCCCcccccCccccchhhhhcchhhhhhhhhcCCCcceeeeecchhhccccccccccccccceeeecccccCcccee
Confidence 9999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ----------------------------ccceEEEEcCcccccccccceeEEEEecCCCCccchhhhhhHhhhhcccc--
Q 002081 586 ----------------------------DLADVWIPLQGKLAQACQSKLHLRIFLNNTKGSNVVKEYLTKMEKEVGKK-- 635 (971)
Q Consensus 586 ----------------------------~~~~~w~~l~~~~~q~~~~~l~l~i~~~~~~~~~~vr~~l~k~~~~~~~~-- 635 (971)
...++|..|.++.++.++.+++++.+.+++..+.....++..++++++.+
T Consensus 162 vIpf~eI~~ikk~~tag~fpn~i~i~t~~~ky~f~s~~Srda~~~~~~~~~~~~~~~s~s~~~~~~~l~~~~~~~~~~~~ 241 (590)
T KOG1032|consen 162 VIPFDEITLIKKTKTAGIFPNAIEITTGTTKYIFVSLLSRDATYKLIKLLLHKFLDSSGSPRADSDYLSSVEPEVNDDQQ 241 (590)
T ss_pred EEeeeeeeeeehhhhccCCCcceEEecCCCcceeeecccCccHHHHHHHhhhhcccccCCccccchhcccCCCCcCcccc
Confidence 47789999999999999999999999999988888899999999999888
Q ss_pred ccccCcccchhhhcccCCCCCCeeEEEEEeeEeeecccCeeEEeecceeEEeeccCCceeEEEEeccccccccccCCccc
Q 002081 636 INLRSPQTNSAFQKLFGLPPEEFLINDFTCHLKRKMLLQGRLFLSARIIGFHANLFGHKTNFFFLWEDIEDIQVLPPSLS 715 (971)
Q Consensus 636 ~~~~s~~~~~~f~~lF~lp~~E~Li~~f~Cal~~~~~~~GrlYls~~~lcF~S~~~g~~tk~~ip~~dI~~I~k~~~~~~ 715 (971)
-...+++.+.+|+..|++|.+|.++++|+|++.+.++++|+++++....|||+++||..+++...|+|++.++..+....
T Consensus 242 ~~~~~~~~~s~~~~s~~~~~~e~~~~~~~~~~~~~~~v~~~~~~s~~~~~~~~~lf~d~~~~~~~l~~~~~~~vs~~~~~ 321 (590)
T KOG1032|consen 242 GNVDNSQSPSALQNSFDSPKEEELEHDFSCSLSRLFGVLGRLPFSAPIGAFFSLLFGDNTFFFFFLEDQDEIQVSPIPWK 321 (590)
T ss_pred cccccCCCccccccccCCCccccccccccccccccccccccccccccccccceeeccCcceeeecccccccccccccccc
Confidence 35667899999999999999999999999999999999999999999999999999999999999999999999987776
Q ss_pred cCCCCeEEEEEeecCCcCcCCCceeeccCCceEEEEeeccCh-hHHHHHHHHHHHhCCCChhhhhhcccccc---cccCc
Q 002081 716 SMGSPVIVMTLRQGRGMDARHGAKTQDEEGRLKFHFHSFVSY-NVAHRTIMALWKARSLSPEQKVQIVEESE---AKSLQ 791 (971)
Q Consensus 716 ~~g~~~~~i~l~~~~~l~~~~~~~~~~~~~~~k~~F~sf~~r-d~~~~~i~~~w~~~~ls~e~~~~~~~~~e---~~~~~ 791 (971)
..+.+....++..+.++.+..+.+.+...+++.+.|.++... +..-.+++..|............++.... ..-..
T Consensus 322 ~~~~~~~~r~~~y~~~l~~~~gPk~t~~~~~~~l~~~~~~~~~~vls~t~~~~vps~~~f~v~~~y~i~~~~~~~~~l~v 401 (590)
T KOG1032|consen 322 GPRSGILLRTLSYTKGLPAKSGPKSTDCEGTQTLHHQDLEKYFRVLSETLTPDVPSGDSFYVKTRYLISRAGSNSCKLKV 401 (590)
T ss_pred CCCccceeEeccCCccCCCcCCCccccccceeeEEeccchhhhhhhheeccCCccccceeeeeEEEEEEecCCcceeecc
Confidence 566666888888999999999999998889999999888773 33334444444332222222222222110 00001
Q ss_pred cCCCCCcCCCCCccccccccccccCChhheeeecCCChhHHHHHHHcCcccceeccccccCCCceeEEEEEEE--eeccc
Q 002081 792 SEEGGTFLGLEDVTMSEVYSSVLPVPMSFFMELFGGGELERAVMEKAGCVSYSCSSWESEKLDVYERQIYYRF--DKCIS 869 (971)
Q Consensus 792 ~eesg~~~g~~d~~~~~v~~~~~pisv~~~f~lF~d~~~~~~~~~k~g~~d~~~s~W~~~~~~~~~R~~sY~~--~~~l~ 869 (971)
..+..-....-+..++++.....++.++.+..+|.+.+-.+..+++.++..+..++|+...+++.+|+.+|+- +.+++
T Consensus 402 ~~~V~~~~~sw~~~~~~~~~~~~k~lv~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~v~~~~~~v~~~~~~~~~~~~i~ 481 (590)
T KOG1032|consen 402 STSVEWTKSSWDVPVSEIGSNTLKDLVEILEKLLENGEELAKNQEKEDELTYEGSPWEVEKPGGTVRQLSYKEVWNKPIS 481 (590)
T ss_pred eeEEEeccCchhhccccccccchhhHHHHHHHHHhccHHHHHhhcccccccccCCCccccCCCceeeeeccccccccccc
Confidence 1110001112345577777767888888888889888777888888888899889999889999999999996 66788
Q ss_pred CCccccCceEEEEecCCCCcEEEEEEEeeCCCCCCCceEEEEEEE-EEeCCCCCCccEEEEEEEEEEeecccchhhhhhh
Q 002081 870 RYRGEVTSTQQKSPLPNGNGWLVEEVMTLHGVPLGDYFNLHLRYQ-VEDSPSRPKGCLAQVYLGVAWLKSTRHQKRITKN 948 (971)
Q Consensus 870 p~g~~vt~~Qqk~~~~~~~~~vve~~~~~~dVPyGD~F~V~~R~~-i~~~s~~~~~c~l~V~~~V~w~Kst~~K~~Iek~ 948 (971)
+....++..|++........|++++++.+||||||++|.||.||. +......+..+++.++..|.|++...++.+..+.
T Consensus 482 ~~~~~~~~~~i~~l~~~~~~~l~~~i~~l~~~~~g~~~~~h~r~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~~~~~~k~ 561 (590)
T KOG1032|consen 482 PDKREVTLLQVVVLVPLKILWLLNTILFLHDVPFGSYFEVHERYREALDETSKVKTTLVWVSFRIEWLKDIKMEARKIKQ 561 (590)
T ss_pred cccccceeEEEEEEehhhhhHHHHHHhhccCCCCccceeeehhhhhhhcccchhhhhhHHHHHHHHHHHHHHHHHhhhHH
Confidence 899999999999999888899999999999999999999999993 4444444578888888999999999999999999
Q ss_pred hHHhHHHHHHHHHHHHHhhhh
Q 002081 949 IVSNLEDRLRVKLSVIEKEFA 969 (971)
Q Consensus 949 ~~~~~~~~~k~l~~~~~kei~ 969 (971)
++.+.++.++.++.+++++-.
T Consensus 562 ~~r~~~~~l~~~~~~l~~~~~ 582 (590)
T KOG1032|consen 562 ILRNDQDLLEVLFSLLEKLSQ 582 (590)
T ss_pred HHHHHHHHHHHHHHHHHHHHh
Confidence 999999999999999988653
|
|
| >KOG1032 consensus Uncharacterized conserved protein, contains GRAM domain [Function unknown] | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PF02893 GRAM: GRAM domain; InterPro: IPR004182 The GRAM domain is found in glucosyltransferases, myotubularins and other putative membrane-associated proteins | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00568 GRAM domain in glucosyltransferases, myotubularins and other putative membrane-associated proteins | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >KOG1264 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >PLN02352 phospholipase D epsilon | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >KOG4347 consensus GTPase-activating protein VRP [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins | Back alignment and domain information |
|---|
| >KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1327 consensus Copine [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14470 bPH_3: Bacterial PH domain | Back alignment and domain information |
|---|
| >cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length | Back alignment and domain information |
|---|
| >KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1265 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria | Back alignment and domain information |
|---|
| >PF15627 CEP76-C2: CEP76 C2 domain | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >PF11605 Vps36_ESCRT-II: Vacuolar protein sorting protein 36 Vps36; InterPro: IPR021648 Vps36 is a subunit of ESCRT-II, a protein involved in driving protein sorting from endosomes to lysosomes | Back alignment and domain information |
|---|
| >PF14844 PH_BEACH: PH domain associated with Beige/BEACH; PDB: 1MI1_B 1T77_C | Back alignment and domain information |
|---|
| >cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] | Back alignment and domain information |
|---|
| >cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >KOG1264 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins | Back alignment and domain information |
|---|
| >KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 971 | ||||
| 2r83_A | 284 | Crystal Structure Analysis Of Human Synaptotagmin 1 | 3e-14 | ||
| 2ep6_A | 133 | Solution Structure Of The Second C2 Domain From Hum | 9e-13 | ||
| 1byn_A | 128 | Solution Structure Of The Calcium-Bound First C2-Do | 9e-13 | ||
| 3jzy_A | 510 | Crystal Structure Of Human Intersectin 2 C2 Domain | 1e-12 | ||
| 3f04_A | 143 | Crystal Structure Of Synaptotagmin I C2a Domain Len | 1e-12 | ||
| 3f00_A | 143 | Crystal Structure Of Synaptotagmin I C2a Domain Wit | 1e-12 | ||
| 1rsy_A | 152 | Structure Of The First C2-domain Of Synaptotagmin I | 1e-12 | ||
| 3hn8_A | 296 | Crystal Structure Of Synaptotagmin Length = 296 | 2e-11 | ||
| 1dqv_A | 296 | Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt | 2e-11 | ||
| 1dsy_A | 139 | C2 Domain From Protein Kinase C (Alpha) Complexed W | 2e-11 | ||
| 3gpe_A | 137 | Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain | 2e-11 | ||
| 3kwt_A | 148 | Munc13-1 C2b-Domain, Calcium-Free Length = 148 | 3e-11 | ||
| 2d8k_A | 141 | Solution Structure Of The First C2 Domain Of Synapt | 6e-11 | ||
| 2uzp_A | 144 | Crystal Structure Of The C2 Domain Of Human Protein | 1e-10 | ||
| 4dnl_A | 140 | Crystal Structure Of A C2 Domain Of A Protein Kinas | 2e-10 | ||
| 2nsq_A | 155 | Crystal Structure Of The C2 Domain Of The Human E3 | 5e-10 | ||
| 3rpb_A | 140 | The C2b-Domain Of Rabphilin: Structural Variations | 5e-10 | ||
| 2cm6_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin3a | 8e-10 | ||
| 1ugk_A | 138 | Solution Structure Of The First C2 Domain Of Synapt | 8e-10 | ||
| 1rh8_A | 142 | Three-Dimensional Structure Of The Calcium-Free Pic | 2e-09 | ||
| 3pfq_A | 674 | Crystal Structure And Allosteric Activation Of Prot | 2e-09 | ||
| 3b7y_A | 153 | Crystal Structure Of The C2 Domain Of The E3 Ubiqui | 2e-09 | ||
| 2cm5_A | 166 | Crystal Structure Of The C2b Domain Of Rabphilin Le | 5e-09 | ||
| 1a25_A | 149 | C2 Domain From Protein Kinase C (Beta) Length = 149 | 6e-09 | ||
| 2chd_A | 142 | Crystal Structure Of The C2a Domain Of Rabphilin-3a | 1e-08 | ||
| 3m7f_B | 176 | Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX | 1e-08 | ||
| 2k3h_A | 140 | Structural Determinants For Ca2+ And Pip2 Binding B | 1e-08 | ||
| 1tjm_A | 159 | Crystallographic Identification Of Sr2+ Coordinatio | 4e-07 | ||
| 1k5w_A | 152 | Three-Dimensional Structure Of The Synaptotagmin 1 | 6e-07 | ||
| 2lha_A | 151 | Solution Structure Of C2b With Ip6 Length = 151 | 6e-07 | ||
| 3n5a_A | 138 | Synaptotagmin-7, C2b-Domain, Calcium Bound Length = | 1e-06 | ||
| 1wfj_A | 136 | C2 Domain-Containing Protein From Putative Elicitor | 1e-06 | ||
| 2enp_A | 147 | Solution Structure Of The First C2 Domain From Huma | 7e-06 |
| >pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 | Back alignment and structure |
|
| >pdb|2EP6|A Chain A, Solution Structure Of The Second C2 Domain From Human Mctp2 Protein Length = 133 | Back alignment and structure |
| >pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 | Back alignment and structure |
| >pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 | Back alignment and structure |
| >pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 | Back alignment and structure |
| >pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 | Back alignment and structure |
| >pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 | Back alignment and structure |
| >pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 | Back alignment and structure |
| >pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 | Back alignment and structure |
| >pdb|1DSY|A Chain A, C2 Domain From Protein Kinase C (Alpha) Complexed With Ca2+ And Phosphatidylserine Length = 139 | Back alignment and structure |
| >pdb|3GPE|A Chain A, Crystal Structure Analysis Of Pkc (Alpha)-C2 Domain Complexed With Ca2+ And Ptdins(4,5)p2 Length = 137 | Back alignment and structure |
| >pdb|3KWT|A Chain A, Munc13-1 C2b-Domain, Calcium-Free Length = 148 | Back alignment and structure |
| >pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 | Back alignment and structure |
| >pdb|2UZP|A Chain A, Crystal Structure Of The C2 Domain Of Human Protein Kinase C Gamma. Length = 144 | Back alignment and structure |
| >pdb|4DNL|A Chain A, Crystal Structure Of A C2 Domain Of A Protein Kinase C Alpha (Prkca) From Homo Sapiens At 1.90 A Resolution Length = 140 | Back alignment and structure |
| >pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 | Back alignment and structure |
| >pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 | Back alignment and structure |
| >pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 | Back alignment and structure |
| >pdb|1UGK|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Iv From Human Fetal Brain (Kiaa1342) Length = 138 | Back alignment and structure |
| >pdb|1RH8|A Chain A, Three-Dimensional Structure Of The Calcium-Free Piccolo C2a- Domain Length = 142 | Back alignment and structure |
| >pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 | Back alignment and structure |
| >pdb|3B7Y|A Chain A, Crystal Structure Of The C2 Domain Of The E3 Ubiquitin- Protein Ligase Nedd4 Length = 153 | Back alignment and structure |
| >pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 | Back alignment and structure |
| >pdb|1A25|A Chain A, C2 Domain From Protein Kinase C (Beta) Length = 149 | Back alignment and structure |
| >pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 | Back alignment and structure |
| >pdb|3M7F|B Chain B, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 176 | Back alignment and structure |
| >pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 | Back alignment and structure |
| >pdb|1TJM|A Chain A, Crystallographic Identification Of Sr2+ Coordination Site In Synaptotagmin I C2b Domain Length = 159 | Back alignment and structure |
| >pdb|1K5W|A Chain A, Three-Dimensional Structure Of The Synaptotagmin 1 C2b- Domain: Synaptotagmin 1 As A Phospholipid Binding Machine Length = 152 | Back alignment and structure |
| >pdb|2LHA|A Chain A, Solution Structure Of C2b With Ip6 Length = 151 | Back alignment and structure |
| >pdb|3N5A|A Chain A, Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 138 | Back alignment and structure |
| >pdb|1WFJ|A Chain A, C2 Domain-Containing Protein From Putative Elicitor- Responsive Gene Length = 136 | Back alignment and structure |
| >pdb|2ENP|A Chain A, Solution Structure Of The First C2 Domain From Human BK Protein Length = 147 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
Score = 151 bits (384), Expect = 5e-43
Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 7/127 (5%)
Query: 2 KLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKD 61
L V+V++A ++ A D +G SDP+ L+LG R +T V K+L+P W + F+F ++D+ D
Sbjct: 14 ILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHD 73
Query: 62 ELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILL 121
L ++V DED DF+G + IP+ + D + L+ K+ + K G I L
Sbjct: 74 VLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPN-----CYVLKNKDLEQAFK--GVIYL 126
Query: 122 TISFSHN 128
+ +N
Sbjct: 127 EMDLIYN 133
|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Length = 138 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 971 | |||
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.78 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 99.78 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.78 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.76 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.76 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 99.76 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 99.75 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 99.75 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 99.73 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 99.72 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.67 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 99.65 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.63 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 99.63 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 99.63 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 99.63 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 99.62 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 99.62 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 99.62 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 99.62 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 99.62 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 99.61 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 99.6 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 99.6 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 99.6 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 99.6 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 99.59 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.59 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 99.58 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 99.58 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 99.57 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 99.57 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 99.57 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 99.57 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 99.57 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 99.55 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 99.51 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 99.49 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 99.45 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 99.42 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.4 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.39 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 99.27 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 99.24 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.22 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 99.08 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.07 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.99 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 98.95 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.92 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 98.87 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 98.86 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 98.82 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 98.82 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 98.79 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 98.78 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 98.76 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 98.75 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 98.75 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 98.74 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 98.72 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 98.71 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 98.7 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 98.7 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 98.67 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 98.66 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 98.65 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 98.65 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 98.65 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 98.65 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 98.64 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 98.63 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 98.63 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 98.63 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 98.63 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 98.62 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 98.62 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 98.62 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 98.6 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 98.56 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 98.53 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 98.52 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 98.5 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 98.5 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 98.47 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 98.34 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 98.32 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 98.18 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 98.15 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 98.11 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 98.0 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 97.96 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 97.29 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 97.11 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 96.9 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 96.87 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 96.35 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 95.06 | |
| 2hth_B | 140 | Vacuolar protein sorting protein 36; GLUE domain, | 94.56 | |
| 2cay_A | 145 | VPS36 PH domain, vacuolar protein sorting protein | 92.79 |
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
Probab=99.78 E-value=2.6e-18 Score=169.69 Aligned_cols=118 Identities=36% Similarity=0.606 Sum_probs=106.2
Q ss_pred EEEEEEEEeeCCCCCCCCCCCCcEEEEEECCeEEEeeeccCCCCCeeccEEEEEEeCCCCeEEEEEEeCCCC--------
Q 002081 2 KLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKDELVISVLDEDKY-------- 73 (971)
Q Consensus 2 ~L~V~Vi~ArnL~~~d~~g~sDPYv~v~l~~~~~rTkvi~~t~nP~WnE~F~F~v~~~~~~L~V~V~D~d~~-------- 73 (971)
+|.|+|++|+||++++.+|.+||||++.++++.++|+++.+++||.|||+|.|.+..+...|.|+|||++.+
T Consensus 18 ~L~V~v~~a~~L~~~d~~g~~dpyv~v~~~~~~~kT~~~~~t~nP~Wne~f~f~v~~~~~~l~~~v~d~d~~~~~~~~~~ 97 (148)
T 3kwu_A 18 KISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVLDEDDDIKSRVKQR 97 (148)
T ss_dssp EEEEEEEEEESCCCCSTTSCCCEEEEEEETTEEEECCCCCSCSSCEEEEEEEEEECSTTCEEEEEEEECCCSHHHHHHTT
T ss_pred EEEEEEEeeeCCCCCCCCCCcCeEEEEEECCEEEECCccCCCCCCCcccEEEEEecCCCCEEEEEEEECCCCcccccccc
Confidence 689999999999999999999999999999999999999999999999999999977778999999999985
Q ss_pred ---CCCceeEEEEEeCccccccCCCCCCcEEEEcccCCCCCCCCcceEEEEEEEEE
Q 002081 74 ---FNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILLTISFS 126 (971)
Q Consensus 74 ---~~d~~LG~v~I~l~~l~~~~~~~~~~~W~~L~~~~~k~~~~~~G~I~L~i~~~ 126 (971)
+++++||++.+++.++. .....||+|.++.++ ...+|+|+|+++|.
T Consensus 98 ~~~~~~~~lG~~~i~l~~l~-----~~~~~w~~L~~~~~~--~~~~G~i~l~l~~e 146 (148)
T 3kwu_A 98 FKRESDDFLGQTIIEVRTLS-----GEMDVWYNLDKRTDK--SAVSGAIRLHISVE 146 (148)
T ss_dssp TSSCSSEEEEEEEEEGGGCC-----SEEEEEEECBCSSTT--CCCCCEEEEEEEEE
T ss_pred ccCCCCccEEEEEEEHHHCc-----CCCCEEEEcccCCCC--CCCceEEEEEEEEE
Confidence 78999999999999982 235799999976543 34689999999986
|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hth_B Vacuolar protein sorting protein 36; GLUE domain, PH domain, viral budding, ubiquitin complex, protein transport; 2.70A {Homo sapiens} SCOP: b.55.1.12 PDB: 2dx5_A | Back alignment and structure |
|---|
| >2cay_A VPS36 PH domain, vacuolar protein sorting protein 36; transport, ESCRT-II, lipid-binding, multivesicular bodies, membrane; 1.9A {Saccharomyces cerevisiae} SCOP: b.55.1.12 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 971 | ||||
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 1e-23 | |
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 1e-04 | |
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 3e-23 | |
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 0.004 | |
| d2cjta1 | 128 | b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no | 8e-22 | |
| d2cjta1 | 128 | b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no | 7e-04 | |
| d2nq3a1 | 133 | b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc | 1e-21 | |
| d2nq3a1 | 133 | b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc | 2e-04 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 1e-20 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 8e-07 | |
| d2bwqa1 | 125 | b.7.1.2 (A:729-853) Regulating synaptic membrane e | 1e-20 | |
| d2bwqa1 | 125 | b.7.1.2 (A:729-853) Regulating synaptic membrane e | 5e-05 | |
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 6e-19 | |
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 8e-05 | |
| d1w15a_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi | 1e-18 | |
| d1w15a_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi | 3e-04 | |
| d1uowa_ | 157 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 8e-18 | |
| d1uowa_ | 157 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 0.003 | |
| d1rh8a_ | 142 | b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax | 1e-17 | |
| d1ugka_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens | 2e-17 | |
| d2cm5a1 | 137 | b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( | 5e-17 | |
| d1rlwa_ | 126 | b.7.1.1 (A:) Domain from cytosolic phospholipase A | 2e-16 | |
| d1qasa2 | 131 | b.7.1.1 (A:626-756) PI-specific phospholipase C is | 3e-15 | |
| d1qasa2 | 131 | b.7.1.1 (A:626-756) PI-specific phospholipase C is | 9e-06 | |
| d1dqva2 | 145 | b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus | 1e-14 | |
| d1gmia_ | 136 | b.7.1.1 (A:) Domain from protein kinase C epsilon | 6e-14 | |
| d1wfma_ | 138 | b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie | 3e-12 | |
| d1wfma_ | 138 | b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie | 0.004 | |
| d1dqva1 | 130 | b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus | 4e-12 | |
| d1bdya_ | 123 | b.7.1.1 (A:) Domain from protein kinase C delta {R | 3e-08 | |
| d2zkmx2 | 122 | b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human | 4e-08 |
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 95.2 bits (236), Expect = 1e-23
Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 7/127 (5%)
Query: 2 KLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKD 61
L V+V++A ++ A D +G SDP+ L+LG R +T V K+L+P W + F+F ++D+ D
Sbjct: 7 ILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHD 66
Query: 62 ELVISVLDEDKYFNDDFVGFLKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILL 121
L ++V DED DF+G + IP+ + D + L+ K+ + K G I L
Sbjct: 67 VLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPN-----CYVLKNKDLEQAFK--GVIYL 119
Query: 122 TISFSHN 128
+ +N
Sbjct: 120 EMDLIYN 126
|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 971 | |||
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 99.8 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 99.76 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 99.74 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 99.7 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.68 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 99.67 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.67 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 99.66 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.63 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.6 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.6 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 99.56 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 99.52 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 99.49 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 99.48 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.48 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 99.47 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 99.39 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.36 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.26 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.04 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 98.99 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 98.82 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 98.79 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 98.76 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 98.74 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 98.66 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.65 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 98.63 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 98.62 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 98.6 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 98.6 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 98.46 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 98.45 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 98.35 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 98.35 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 98.27 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 98.27 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 98.21 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 97.66 | |
| d2hthb1 | 129 | Vacuolar protein sorting protein 36, VPS36 {Human | 91.1 | |
| d2caya1 | 130 | Vacuolar protein sorting protein 36, VPS36 {Baker' | 87.38 | |
| d1e7ua2 | 174 | Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) | 87.04 | |
| d1zsqa1 | 125 | Myotubularin-related protein 2, N-terminal domain | 84.16 | |
| d2rnrb1 | 108 | TFIIH basal transcription factor complex p62 subun | 82.7 | |
| d1t77a2 | 110 | Lipopolysaccharide-responsive and beige-like ancho | 81.74 |
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80 E-value=8.1e-20 Score=173.74 Aligned_cols=119 Identities=34% Similarity=0.543 Sum_probs=106.7
Q ss_pred EEEEEEEEeeCCCCCCCCCCCCcEEEEEECCeEEEeeeccCCCCCeeccEEEEEEeCCCCeEEEEEEeCCCCCCCceeEE
Q 002081 2 KLVVRVIEARNIPAMDQNGYSDPYVRLQLGRQRFKTKVVRKSLSPSWEEEFSFKVEDLKDELVISVLDEDKYFNDDFVGF 81 (971)
Q Consensus 2 ~L~V~Vi~ArnL~~~d~~g~sDPYv~v~l~~~~~rTkvi~~t~nP~WnE~F~F~v~~~~~~L~V~V~D~d~~~~d~~LG~ 81 (971)
.|+|+|++|+||++++.+|.+||||++.+++++++|+++.++.||.|||+|.|.+.++...|.|+|||++.++++++||+
T Consensus 7 ~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~~~~~~T~~~~~t~nP~wne~f~f~v~~~~~~L~i~V~d~~~~~~d~~lG~ 86 (126)
T d2ep6a1 7 ILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGK 86 (126)
T ss_dssp EEEEEEEEEESCCCSSSSSCCCEEEEEEETTEEEECCCCSSCSSCCCCEEEEEEESCTTCEEEEEEEEEETTEEEEECCB
T ss_pred EEEEEEEEeECCCCCCCCCCcCeEEEEEcCCeEEEEEeeCCceeEEEEEEEEEEEeccCceeEEEEEEccCCcCcceEEE
Confidence 58999999999999999999999999999999999999999999999999999998778899999999999888999999
Q ss_pred EEEeCccccccCCCCCCcEEEEcccCCCCCCCCcceEEEEEEEEEe
Q 002081 82 LKIPVSRVFDADNKSLPTAWHSLQPKNKKSKNKDCGEILLTISFSH 127 (971)
Q Consensus 82 v~I~l~~l~~~~~~~~~~~W~~L~~~~~k~~~~~~G~I~L~i~~~~ 127 (971)
+.|++.++.. ....|+.|.....+ ...+|+|+|++.|..
T Consensus 87 ~~i~l~~l~~-----~~~~~~~l~~~~~~--~~~~G~i~l~~~~i~ 125 (126)
T d2ep6a1 87 VAIPLLSIRD-----GQPNCYVLKNKDLE--QAFKGVIYLEMDLIY 125 (126)
T ss_dssp CEEEGGGCCS-----SCCEECCCBCSCTT--SCCSSEEEEEEEEEE
T ss_pred EEEEHHHCCC-----CCceEEEccccCCC--CceeEEEEEEEEEEE
Confidence 9999999843 24689999866543 356799999999864
|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hthb1 b.55.1.12 (B:3-131) Vacuolar protein sorting protein 36, VPS36 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2caya1 b.55.1.12 (A:1-99,A:252-282) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zsqa1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rnrb1 b.55.1.9 (B:1-108) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t77a2 b.55.1.6 (A:2076-2185) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|