Citrus Sinensis ID: 002095


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------
MAWFSGKVSLGNFPDLAGAVNKFSESVKNIEKNFDTALGFDEKAEKSAKPETSSSNEGLWPVMSFMGHKSEGSSPTESSGKPQTPQQQSKPEEKVGVETERSVHSATGEVYADKQKASPKTEKDDEHPDTAENLDFVVSEHGKVDSESNIVPNDPSESAIQNIDSSEPVDNQQQKVTSDLGTSEETESGEAKSGPFEADQIEISSSLRDESDNVANACQSKDEGKKEESNYEEKSQAEEMIETGSPVQAEVSSTIQAEVGTESSDSQSVSAEETERVRELLSSSASSPKAVSETVCAPVSPEHGEKDKAVEVEQQANDSGIVSEEQRLSSEANVSVSADSVCELEKLKREMKMMETALQGAARQAQAKADEIAKMMNENEHLKAVIEDLKRKTNDAELETLREEYHQRVATLERKVYALTKERDTLRREQNKKSDAAALLKEKDEIINQVMAEGEELSKKQAAQEAQIRKLRAQIRELEEEKKGLVTKLQVEENKVESIKRDKTATEKLLQETIEKHQVELGEQKDYYTNALAAAKEAEELAEARANNEARAELESRLREAGERETMLVQALEELRQTLSRTEQQAVFREDMLRRDIEDLQRRYQASERRCEELVTQVPESTRPLLRQIEAIQETTARRAEAWAAVERSLNLRLQEAEAKAAASEERERSVNERLSQTLSRINVLEAQISCLRAEQTQLTKSLEKERQRAAENRQEYLAAKEEADTQEGRANQLEEEIKELRRKHKQELQEALMHRELLQQEIEREKTARVDLERRASAESAAVSEKTPIARHTSAFENGSLSRKLSSASSLGSMEESHFLQASLDSSDSLSDRKNTVEPTMSPYYVKSMTPSAFESILRQKEGELASYMSRLASMESIRDSLAEELVKMTAQCEKLRAEAAILPGIQAELDALRRRHSAALELMGERDEELEELRADIMDLKEMYREQVNLLVNKIQVMGSSMGNT
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHcccHHHHHHccccccccccccccHHHccHHHHHHcccccccccccccccccHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccccHHcccccccccccHHHccccHHHHHHHccccccccHHHcccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*AWFSGKVSLGNFPDLAGAVNKF*********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YHQRVATLERKVYAL************************************************************************************************************Y****************************************************************************************************I**I********EAWAAV***********************************INVLEAQISCL**************************************************************************************************************************************************************************************************LVKMTAQCEKLRAEAAILPGIQAELDAL**********************ADIMDLKEMYREQVNLLVNKIQV********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAWFSGKVSLGNFPDLAGAVNKFSESVKNIEKNFDTALGFDEKAEKSAKPETSSSNEGLWPVMSFMGHKSEGSSPTESSGKPQTPQQQSKPEEKVGVETERSVHSATGEVYADKQKASPKTEKDDEHPDTAENLDFVVSEHGKVDSESNIVPNDPSESAIQNIDSSEPVDNQQQKVTSDLGTSEETESGEAKSGPFEADQIEISSSLRDESDNVANACQSKDEGKKEESNYEEKSQAEEMIETGSPVQAEVSSTIQAEVGTESSDSQSVSAEETERVRELLSSSASSPKAVSETVCAPVSPEHGEKDKAVEVEQQANDSGIVSEEQRLSSEANVSVSADSVCExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQNKKSDAAALLKEKDEIINQVMAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVESIKRDKTATEKLLQETIEKHQVELGEQKDYYTNALAAAKEAEELAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVPESTRPLLRQIEAIQETTARRAEAWAAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxASAESAAVSEKTPIARHTSAFENGSLSRKLSSASSLGSMEESHFLQASLDSSDSLSDRKNTVEPTMSPYYVKSMTPSAFESILRQKEGELASYMSRLASMESIxxxxxxxxxxxxxxxxxxxxxAAILPGIQAELDALRRRHSAALELxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVNKIQVMGSSMGNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgin candidate 5 Golgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.probableQ0WVL7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 339-361
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 467-487
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 601-612
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 567-706
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 342-458
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 624-747
View the alignment between query and template
View the model in PyMOL
Template: 2YCU, chain A
Confidence level:probable
Coverage over the Query: 395-524,536-616,634-658
View the alignment between query and template
View the model in PyMOL
Template: 3MQ7, chain A
Confidence level:probable
Coverage over the Query: 859-943
View the alignment between query and template
View the model in PyMOL
Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 245-747
View the alignment between query and template
View the model in PyMOL
Template: 2I1J, chain A
Confidence level:probable
Coverage over the Query: 603-687,703-770
View the alignment between query and template
View the model in PyMOL
Template: 2FXO, chain A
Confidence level:probable
Coverage over the Query: 854-964
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1g8x, chain Aprobable Alignment | Template Structure