Citrus Sinensis ID: 002097


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------
MSGNEIDNLVVPQGLERLSRLSKLKKLDLRGNLCNNSILSSVARLSSLTSLHLSHNILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPICRSLATMSEASTSNEGDDNLIDMDSFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITSCYYFVIDNLIPTRFCH
cccccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccccccHHHHHHccccccEEEccccccccccccccccccccccEEEccccccccccccHHHHHcccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccEEccccccccccccccEEEccccccEEEccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEccccEEEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEccccEEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEcccccccccccEEEccccccEEcccHHHHcccccccEEEcccccccccccHHHHHcccccEEEccccccEEcccccccccccccEEEccccccccccccHHHccccccccccccccccccccccccccccccccccEEEEEEEEEccEEEEEccHHHccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHEEEEHHHHcccHHHHHHHHHHHHHHcEEEEEEEEEEEcccccc
cccccccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHcccccEEEEccccccccccccHHHHccccccEEEcccccccccccccHHHccccccEEEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHHHHHcccEEEcccccccccccHHHHHccccccEEEEccccccccccccHHHHccccccEEEEcccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHHcccccEEEEEccccccccccHHHcccccccEEEEEccccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHHHcccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEcccccccccccHHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccHEEEcccccccccccccccccccHHccccccEEEEEccccccccccHHHHHcccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccHEEccccccccccccHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHEEEHHHcccccccc
msgneidnlvvpqglERLSRLsklkkldlrgnlcnnsILSSVARLSSLTSLHLSHnilqgsidakefdslsnleeldindneidnvevsrgyrglrklksldlsgvgirdGNKLlqsmgsfpslntlhlesnnftaTLTTTQelhnftnleyltlddsSLHISLLQSIGsifpslknlsmsgcevngvlsgqgfphfksleHLDMRFARIALNTSFLQIIGEsmpslkylslsgstlgtnssrildqglcplahlqelyidnndlrgslpwclanttslrILDVSfnqltgsisssplvhltsieelrlsnnhfripvsleplfnhsklkifdaknneingeineshsltpkfqlkslslssnygdsvtfpkflyhqHELKEAELSHIKMIGefpnwllenntkLEFLYLVNdslagpfrlpihshkrlrfldvsnnnfqghipveigdilpSLVYFNIsmnaldgsipssfgnVIFLQFLDlsnnkltgeipdhLAMCCVNLEFLSlsnnslkghiFSRIFSLRNLRWLLLEgnhfvgeipqslskcsslkglylnnnnlsgkiprwlgnlkglqhivmpknhlegpipvefcrldslqildisdnnisgslpscfyplsikqVHLSKNmlhgqlkegtffncsslvtldlsynylngsipdwidgLSQLSHLNLAHNNLEGEVPIQLCRlnqlqlldlsdnnlhglipscfdnttlhesynnnsspdkpfktsfsisgpqgsvEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDlscnklvghippqignltRIQTLNlshnnltgtipltfsnlrhIESLDLSynklsgkiprqlvDLNTLAIFIVAYNnlsgkipewTAQFATfnkssydgnpflcglplpicrslatmseastsnegddnlidmdsFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITSCYYFVidnliptrfch
msgneidnlvvpqgleRLSRLSKLKKLDLRGNLCNNSILSSVARLSSLTSLHLSHNILQGSIDAKEFDSLSNLeeldindneidnvevsrgyrglrklksldlsgvGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPICRSLATMSEASTSNEGDDNLIDMDSFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITSCYYFVIDNLIPTRFCH
MSGNEIDNLVVPQGlerlsrlsklkkldlrGNLCNNSILSSVARlssltslhlshNILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPslkylslsgstlgtnssRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVnleflslsnnslKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIqlcrlnqlqlldlsdnnlHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPICRSLATMSEASTSNEGDDNLIDMDSFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITSCYYFVIDNLIPTRFCH
*****************LSRLSKLKKLDLRGNLCNNSILSSVARLSSLTSLHLSHNILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEI******************LSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTL***************************EKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPICRSLAT************NLIDMDSFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITSCYYFVIDNLIPTRFC*
MSGNEIDNLVVPQGLERLSRLSKLKKLDLRGNLCNNSILSSVARLSSLTSLHLSHNILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNN*SSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCG****************************DSFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITSCYYFVIDNLIPTRFCH
MSGNEIDNLVVPQGLERLSRLSKLKKLDLRGNLCNNSILSSVARLSSLTSLHLSHNILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPICRSLATMSEASTSNEGDDNLIDMDSFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITSCYYFVIDNLIPTRFCH
*****IDNLVVPQGLERLSRLSKLKKLDLRGNLCNNSILSSVARLSSLTSLHLSHNILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPICRSLATMSEASTSNEGDDNLIDMDSFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITSCYYFVIDNLIPTR*C*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGNEIDNLVVPQGLERLSRLSKLKKLDLRGNLCNNSILSSVARLSSLTSLHLSHNILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPICRSLATMSEASTSNEGDDNLIDMDSFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITSCYYFVIDNLIPTRFCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query967 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.756 0.584 0.274 7e-68
C0LGQ5 1249 LRR receptor-like serine/ no no 0.837 0.648 0.281 1e-65
Q9LJF3 1164 Receptor-like protein kin no no 0.662 0.550 0.315 4e-61
Q9SHI2 1101 Leucine-rich repeat recep no no 0.710 0.623 0.319 6e-61
Q9ZPS9 1143 Serine/threonine-protein no no 0.551 0.466 0.330 9e-61
Q9ZWC8 1166 Serine/threonine-protein no no 0.685 0.568 0.292 1e-60
Q9C9H7847 Receptor-like protein 12 no no 0.677 0.773 0.303 3e-60
Q9FL28 1173 LRR receptor-like serine/ no no 0.588 0.485 0.318 1e-59
O22476 1196 Protein BRASSINOSTEROID I no no 0.621 0.502 0.301 8e-58
C0LGS2 1136 Probable LRR receptor-lik no no 0.693 0.590 0.295 4e-57
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  259 bits (662), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 255/929 (27%), Positives = 402/929 (43%), Gaps = 197/929 (21%)

Query: 94  GLRKLKSLDLSGVGIRDGNKLLQSMGSFPSLNTLHLESNNFTATLTTT------------ 141
           G R++  L+LSG+G+     +  S+G F +L  + L SN     + TT            
Sbjct: 69  GGREIIGLNLSGLGLT--GSISPSIGRFNNLIHIDLSSNRLVGPIPTTLSNLSSSLESLH 126

Query: 142 -----------QELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSGCEVNGVLS 190
                       +L +  NL+ L L D+ L+ ++ ++ G++  +L+ L+++ C + G++ 
Sbjct: 127 LFSNLLSGDIPSQLGSLVNLKSLKLGDNELNGTIPETFGNLV-NLQMLALASCRLTGLIP 185

Query: 191 GQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLC 250
                          RF R                                         
Sbjct: 186 S--------------RFGR----------------------------------------- 190

Query: 251 PLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLS 310
            L  LQ L + +N+L G +P  + N TSL +   +FN+L GS+ +  L  L +++ L L 
Sbjct: 191 -LVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAE-LNRLKNLQTLNLG 248

Query: 311 NNHF--RIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSV 368
           +N F   IP  L  L +   L +     N++ G I     LT    L++L LSSN    V
Sbjct: 249 DNSFSGEIPSQLGDLVSIQYLNLI---GNQLQGLI--PKRLTELANLQTLDLSSNNLTGV 303

Query: 369 TFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKR 428
              +F +  ++L+   L+  ++ G  P  +  NNT L+ L+L    L+G     I + + 
Sbjct: 304 IHEEF-WRMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQS 362

Query: 429 LRFLDVSNNNFQGHIP------VEIGDI-----------------LPSLVYFNISMNALD 465
           L+ LD+SNN   G IP      VE+ ++                 L +L  F +  N L+
Sbjct: 363 LKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLE 422

Query: 466 GSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLR 525
           G +P   G +  L+ + L  N+ +GE+P  +   C  L+ +    N L G I S I  L+
Sbjct: 423 GKVPKEIGFLGKLEIMYLYENRFSGEMPVEIG-NCTRLQEIDWYGNRLSGEIPSSIGRLK 481

Query: 526 NLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLG--------------- 570
           +L  L L  N  VG IP SL  C  +  + L +N LSG IP   G               
Sbjct: 482 DLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNSL 541

Query: 571 ---------NLKGLQHI----------VMP-------------KNHLEGPIPVEFCRLDS 598
                    NLK L  I          + P             +N  EG IP+E  +  +
Sbjct: 542 QGNLPDSLINLKNLTRINFSSNKFNGSISPLCGSSSYLSFDVTENGFEGDIPLELGKSTN 601

Query: 599 LQILDISDNNISGSLPSCFYPLS-IKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYL 657
           L  L +  N  +G +P  F  +S +  + +S+N L G +       C  L  +DL+ NYL
Sbjct: 602 LDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGL-CKKLTHIDLNNNYL 660

Query: 658 NGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTT 717
           +G IP W+  L  L  L L+ N   G +P ++  L  +  L L  N+L+G IP    N  
Sbjct: 661 SGVIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQ 720

Query: 718 LHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDL 777
              + N   +          +SGP  S   K+ ++FE                    L L
Sbjct: 721 ALNALNLEEN---------QLSGPLPSTIGKLSKLFE--------------------LRL 751

Query: 778 SCNKLVGHIPPQIGNLTRIQT-LNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPR 836
           S N L G IP +IG L  +Q+ L+LS+NN TG IP T S L  +ESLDLS+N+L G++P 
Sbjct: 752 SRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVPG 811

Query: 837 QLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPICRSLATMSEA 896
           Q+ D+ +L    ++YNNL GK+ +   QF+ +   ++ GN  LCG PL  C    + ++ 
Sbjct: 812 QIGDMKSLGYLNLSYNNLEGKLKK---QFSRWQADAFVGNAGLCGSPLSHCNRAGSKNQR 868

Query: 897 STSNEGDDNLIDMDSFFITFTISYVIVIF 925
           S S +    +  + S      +  VI++F
Sbjct: 869 SLSPKTVVIISAISSLAAIALMVLVIILF 897




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query967
255581263912 serine-threonine protein kinase, plant-t 0.766 0.812 0.509 0.0
224142481781 predicted protein [Populus trichocarpa] 0.779 0.965 0.469 1e-180
2240734361014 predicted protein [Populus trichocarpa] 0.899 0.857 0.434 1e-177
224098008 1097 predicted protein [Populus trichocarpa] 0.893 0.787 0.427 1e-175
224073422969 predicted protein [Populus trichocarpa] 0.917 0.915 0.419 1e-173
224124658 1228 predicted protein [Populus trichocarpa] 0.966 0.761 0.412 1e-172
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.922 0.609 0.429 1e-172
224134891953 predicted protein [Populus trichocarpa] 0.859 0.871 0.413 1e-171
2241239841016 predicted protein [Populus trichocarpa] 0.823 0.783 0.447 1e-169
224073382 1309 predicted protein [Populus trichocarpa] 0.913 0.674 0.412 1e-167
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/766 (50%), Positives = 514/766 (67%), Gaps = 25/766 (3%)

Query: 189 LSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQG 248
           +  Q  P+F++LE L +   +I L  SFLQ +G  M SLK LSLSG  L      +  QG
Sbjct: 168 IQAQDLPNFENLEELYLD--KIELENSFLQTVG-VMTSLKVLSLSGCGLTGALPNV--QG 222

Query: 249 LCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELR 308
           LC L HL+ L + +N+  G LPWCL+N TSL++LD+S NQ  G IS+SPL  L S+ +L 
Sbjct: 223 LCELIHLRVLDVSSNEFHGILPWCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLD 282

Query: 309 LSNNHFRIPVSLEPLFNHSKLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSV 368
           +SNNHF++P SL P FNHS LK    +NN I  E  E HS  P+FQL S+ + S YG   
Sbjct: 283 VSNNHFQVPFSLGPFFNHSNLKHIRGQNNAIYLEA-ELHS-APRFQLISI-IFSGYGICG 339

Query: 369 TFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKR 428
           TFP FLYHQ+ L+  +LSH+ + GEFPNWLL NNT+LE L LVN+SL+G  +LP+H H  
Sbjct: 340 TFPNFLYHQNNLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHVN 399

Query: 429 LRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKL 488
           L  LD+SNN+   HIP+EIG  LP L   N+S N  DGSIPSSFGN+  L+ LDLSNN+L
Sbjct: 400 LLALDISNNHVHDHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQL 459

Query: 489 TGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKC 548
           +G IP+HLA  C +L  L LSNNSL+G +FS+ F+L NL WL L+ NHF G IP+SLSK 
Sbjct: 460 SGSIPEHLATGCFSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSK- 518

Query: 549 SSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNN 608
           S+L  + L++N+LSG IP W+GNL  LQ++++  N L+GPIPVEFC+L  L++LD+++N+
Sbjct: 519 SALSIMDLSDNHLSGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNS 578

Query: 609 ISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGL 668
           +SG LPSC  P SI  VHLS+NM+ G      F     LVTLDLS N + G IP  I G+
Sbjct: 579 VSGILPSCLSPSSIIHVHLSQNMIEGPWTNA-FSGSHFLVTLDLSSNRITGRIPTLIGGI 637

Query: 669 SQLSHLNLAHNNLEGEVPIQLCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSP 728
           + L  LNL  N  +GE+P Q+C L QL L+ L+DNNL G IPSC     L    +++ +P
Sbjct: 638 NALRILNLKSNRFDGEIPAQICGLYQLSLIVLADNNLSGSIPSC-----LQLDQSDSLAP 692

Query: 729 DKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPP 788
           D P   +        +     +    FTTK  +Y+YQG++LS ++G+D SCNKL G IPP
Sbjct: 693 DVPPVPN------PLNPYYLPVRPMYFTTKRRSYSYQGKILSYISGIDFSCNKLTGEIPP 746

Query: 789 QIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFI 848
           ++GN + I +LNLS+N  TG IP TFSNL+ IESLDLSYN L+G IP QL++L  L+ F 
Sbjct: 747 EMGNHSAIYSLNLSYNRFTGPIPSTFSNLKQIESLDLSYNNLNGDIPSQLLELKFLSYFS 806

Query: 849 VAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLPLPIC---RSLATMSEASTSNEGDDN 905
           VA+NNL GK P+ T QFATF  SSY+GNP LCGLPLP     R  ++   AS  +E + N
Sbjct: 807 VAHNNLFGKTPKRTGQFATFEVSSYEGNPNLCGLPLPKSCTEREASSAPRASAMDE-ESN 865

Query: 906 LIDMDSFFITFTISYVIVIFGIVVVLYVNPYWRRRWLYLVEMWITS 951
            +DM++F+ +F +SY  VI G+ +VLY+NP WRR W   V++ I+S
Sbjct: 866 FLDMNTFYGSFIVSYTFVIIGMFLVLYINPQWRRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124658|ref|XP_002330078.1| predicted protein [Populus trichocarpa] gi|222871503|gb|EEF08634.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query967
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.907 0.878 0.341 9.5e-121
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.715 0.638 0.362 4.9e-112
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.835 0.906 0.334 3.9e-99
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.858 0.850 0.331 8.2e-99
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.888 0.946 0.322 4.2e-95
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.819 0.847 0.324 3.6e-89
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.885 0.887 0.294 2.8e-82
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.834 0.644 0.284 1.1e-66
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.676 0.806 0.293 3e-60
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.634 0.523 0.306 2.7e-59
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1188 (423.3 bits), Expect = 9.5e-121, P = 9.5e-121
 Identities = 317/929 (34%), Positives = 476/929 (51%)

Query:    65 KEFDSLSNLEELDINDNEIDNVEVSRGYRGLRKLKSLDLSGVGIRDGNKLLQSMGSFPSL 124
             K    L NLE LD++ +  +N  +         L +L L+   +     L++      +L
Sbjct:    66 KSLSRLRNLEILDLSSHRFNN-SIFPFLNAATSLTTLFLTYNNMHSPF-LVKEFKDLTNL 123

Query:   125 NTLHLESNNFTATLTTTQ--ELHNFTNLEYLTLDDSSLHISLLQSIGSIFPSLKNLSMSG 182
               L L  N F  ++ T     L  F  LE L L D+  +  +   + S   SLK+LS+ G
Sbjct:   124 EHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSA-TSLKSLSLWG 182

Query:   183 CEVNGVLSGQGFPHFKSLEHLDM---RF-ARIALNTSFL--QIIGESMPXXXXXXXXXXX 236
               + G    +      ++E LD+   RF   I +   F   ++    +            
Sbjct:   183 NNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQ 242

Query:   237 XXXXXXRILDQGLCPLAHLQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSS 296
                   + L  G CP  +++EL + NN L G  P CL + T LR+LD+S NQLTG++ S+
Sbjct:   243 GKFAKTKPLS-GTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSA 301

Query:   297 PLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIF--DAKNNEINGEINESHSLTPKFQ 354
              L +L S+E L L  N+F    SL  L N SKLK+   D+++N +  E+    S  PKFQ
Sbjct:   302 -LANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSL--EVEFETSWKPKFQ 358

Query:   355 LKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDS 414
             L  ++L S   + V  P FL HQ +L   +LS  ++ G FP+WLLENNTKLE L L N+S
Sbjct:   359 LVVIALRSCNLEKV--PHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNS 416

Query:   415 LAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVE-IGDILPSLVYFNISMNALDGSIPSSFG 473
                 F+LP  +H  L FL+VS N F  H+ ++  G ILP LV  N++ N   G++PSS  
Sbjct:   417 FTS-FQLPKSAHNLL-FLNVSVNKFN-HLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLD 473

Query:   474 NVIFLQFLDLSNNKLTGEIPDHLAMCCVXXXXXXXXXXXXKGHIFSRIFSLRNLRWLL-L 532
             N+  ++FLDLS+N+  G++P      C              G +F    +   L W++ +
Sbjct:   474 NMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRL-WVMSM 532

Query:   533 EGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVE 592
             + N F G I +      SL  L ++NN L+G IP W+G  +GL  + +  N LEG IP  
Sbjct:   533 DNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTS 592

Query:   593 FCRLDSLQILDISDNNISGSLP---SCFYPLSIKQVHLSKNMLHGQLKEGTFFNCSSLVT 649
                +  LQ+LD+S N +SG +P   S  Y  ++  + L  N L G + +    N   ++ 
Sbjct:   593 LFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAV--LLLQNNNLSGVIPDTLLLN---VIV 647

Query:   650 LDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIXXXXXXXXXXXXXXXXXXHGLI 709
             LDL  N L+G++P++I+    +S L L  NN  G++P                   +G I
Sbjct:   648 LDLRNNRLSGNLPEFIN-TQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSI 706

Query:   710 PSCFDNTTL-----HESYNNN------SSPDKPFKTSFSISGPQGSVEKKILEI-FEFTT 757
             PSC  NT+       +SY  +      ++ D  +  S  +      V +   +   EF T
Sbjct:   707 PSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFAT 766

Query:   758 KNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNL 817
             K+   AY G  L LL G+DLS N+L G IP ++G L  ++ LNLSHNNL+G I  +FS L
Sbjct:   767 KHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGL 826

Query:   818 RHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDGNP 877
             +++ESLDLS+N+L G IP QL D+ +LA+F V+YNNLSG +P+   QF TF   SY GNP
Sbjct:   827 KNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGR-QFNTFETQSYFGNP 885

Query:   878 FLCGLPLPICRSLATMSEASTSN--EGDDNLIDMDSFFITFTISYVIVIFGIVVVLYVNP 935
              LCG  + I  S A+ +   T N  E D++ +DM+SF+ +F  +YV ++ GI+  L  + 
Sbjct:   886 LLCGKSIDI--SCASNNFHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILASLSFDS 943

Query:   936 YWRRRWLYLVEMWITSCYYFVIDNLIPTR 964
              W R W Y+V+ ++      +  N   T+
Sbjct:   944 PWSRAWFYIVDAFVLKVRNMLWQNTAGTK 972


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00181059
hypothetical protein (781 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query967
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-64
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-54
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-47
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-29
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-16
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  233 bits (596), Expect = 6e-64
 Identities = 193/619 (31%), Positives = 294/619 (47%), Gaps = 98/619 (15%)

Query: 279 LRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDAKNNE 338
           ++ +++S NQL+G I        +S+  L LSNN+F   +    + N   L+  D  NN 
Sbjct: 95  IQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN---LETLDLSNNM 151

Query: 339 INGEI-NESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYHQHELKEAELSHIKMIGEFPNW 397
           ++GEI N+  S      LK L L  N                          ++G+ PN 
Sbjct: 152 LSGEIPNDIGSF---SSLKVLDLGGNV-------------------------LVGKIPNS 183

Query: 398 LLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYF 457
           L  N T LEFL L ++ L G     +   K L+++ +  NN  G IP EIG  L SL + 
Sbjct: 184 L-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHL 241

Query: 458 NISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHI 517
           ++  N L G IPSS GN+  LQ+L L  NKL+G IP                        
Sbjct: 242 DLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP------------------------ 277

Query: 518 FSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQH 577
              IFSL+ L  L L  N   GEIP+ + +  +L+ L+L +NN +GKIP  L +L  LQ 
Sbjct: 278 -PSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQV 336

Query: 578 IVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPS--CFYPLSIKQVHLSKNMLHGQ 635
           + +  N   G IP    + ++L +LD+S NN++G +P   C      K +  S N L G+
Sbjct: 337 LQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFS-NSLEGE 395

Query: 636 LKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQL 695
           + + +   C SL  + L  N  +G +P     L  +  L++++NNL+G +  +   +  L
Sbjct: 396 IPK-SLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSL 454

Query: 696 QLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEF 755
           Q+L L+ N   G +P  F +  L                  S +   G+V +K+      
Sbjct: 455 QMLSLARNKFFGGLPDSFGSKRLE-------------NLDLSRNQFSGAVPRKL------ 495

Query: 756 TTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFS 815
                        LS L  L LS NKL G IP ++ +  ++ +L+LSHN L+G IP +FS
Sbjct: 496 -----------GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFS 544

Query: 816 NLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATFNKSSYDG 875
            +  +  LDLS N+LSG+IP+ L ++ +L    +++N+L G +P  T  F   N S+  G
Sbjct: 545 EMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS-TGAFLAINASAVAG 603

Query: 876 NPFLCG----LPLPICRSL 890
           N  LCG      LP C+ +
Sbjct: 604 NIDLCGGDTTSGLPPCKRV 622


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 967
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
PLN03150623 hypothetical protein; Provisional 99.53
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
PLN03150623 hypothetical protein; Provisional 99.24
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.0
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.67
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
KOG4341483 consensus F-box protein containing LRR [General fu 98.48
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.31
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.27
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.24
KOG4341483 consensus F-box protein containing LRR [General fu 98.23
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.17
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.05
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.97
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.86
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.8
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.75
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.7
PRK15386426 type III secretion protein GogB; Provisional 97.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.69
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.37
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.37
PRK15386426 type III secretion protein GogB; Provisional 97.37
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.98
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.56
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.31
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.2
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.06
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.72
KOG4308478 consensus LRR-containing protein [Function unknown 94.14
KOG4308478 consensus LRR-containing protein [Function unknown 92.57
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.72
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.28
smart0037026 LRR Leucine-rich repeats, outliers. 90.28
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.64
smart0037026 LRR Leucine-rich repeats, outliers. 88.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.91
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.85
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.56
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.94
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.2e-61  Score=604.95  Aligned_cols=455  Identities=36%  Similarity=0.547  Sum_probs=408.6

Q ss_pred             cChhccCCCCccEEEccCCcCcccCchHHhhcCCCCcEEEccCCcccCcCCCCcCCCCCccEEEecCCcCCcCCChhhhh
Q 002097          370 FPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGD  449 (967)
Q Consensus       370 ~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~  449 (967)
                      +|..++.+++|+.|++++|.+.+.+|..+ +++++|++|++++|.+.+..+..+..+++|++|++++|.+.+.+|..+..
T Consensus       156 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~~-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~  234 (968)
T PLN00113        156 IPNDIGSFSSLKVLDLGGNVLVGKIPNSL-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG  234 (968)
T ss_pred             CChHHhcCCCCCEEECccCcccccCChhh-hhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhc
Confidence            34455666777778888887777777765 67888888888888888888888888889999999999988888877665


Q ss_pred             cCCCCcEEECcCCCCCCCCcccccCCCCCCEEEccCCcCCCccchhHhhcCCCCcEEEcccccccccccccccCCccccc
Q 002097          450 ILPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRW  529 (967)
Q Consensus       450 ~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~  529 (967)
                       +++|++|++++|.+++.+|..++++++|++|++++|++++.+|..+.. +++|++|++++|.+.+.+|..+..+++|++
T Consensus       235 -l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~  312 (968)
T PLN00113        235 -LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFS-LQKLISLDLSDNSLSGEIPELVIQLQNLEI  312 (968)
T ss_pred             -CCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhh-ccCcCEEECcCCeeccCCChhHcCCCCCcE
Confidence             789999999999998888989999999999999999998888877654 889999999999998888888889999999


Q ss_pred             eeccCccccccCCccCcCCCCCcEEECcCCcCCCCCCccccCCCCCCEEECCCCccccCCCccccCCCCCCEEeCcCCcC
Q 002097          530 LLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNI  609 (967)
Q Consensus       530 L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l  609 (967)
                      |++++|.+.+..|..+..+++|+.|++++|.+.+.+|..++.+++|+.|++++|++.+.+|..++.+++|+.|++++|++
T Consensus       313 L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l  392 (968)
T PLN00113        313 LHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSL  392 (968)
T ss_pred             EECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEe
Confidence            99999999988888889999999999999999988999899999999999999999888899999999999999999999


Q ss_pred             CcCCCCCcC-CCcccEEEccCCcCcccCCcccccCCCCCcEEECcCccCCCCcchhhhCCCCCCEEEcCCCcCcccCChh
Q 002097          610 SGSLPSCFY-PLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQ  688 (967)
Q Consensus       610 ~~~~~~~~~-~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~  688 (967)
                      .+.+|..+. +++|+.|++++|.+.+.+|. .|..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++.+.+|..
T Consensus       393 ~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~-~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~  471 (968)
T PLN00113        393 EGEIPKSLGACRSLRRVRLQDNSFSGELPS-EFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDS  471 (968)
T ss_pred             cccCCHHHhCCCCCCEEECcCCEeeeECCh-hHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcc
Confidence            988887665 78999999999999888887 8899999999999999999999999999999999999999999888876


Q ss_pred             ccCCCCCCEEECCCCcCcccCCCcccccccccccCCCCCCCCCcccccccCCCCCchhhhhheeeeeeccccccccchhh
Q 002097          689 LCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRV  768 (967)
Q Consensus       689 ~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  768 (967)
                      + ..++|+.|++++|++++.+|..+..+                                                    
T Consensus       472 ~-~~~~L~~L~ls~n~l~~~~~~~~~~l----------------------------------------------------  498 (968)
T PLN00113        472 F-GSKRLENLDLSRNQFSGAVPRKLGSL----------------------------------------------------  498 (968)
T ss_pred             c-ccccceEEECcCCccCCccChhhhhh----------------------------------------------------
Confidence            6 46899999999999999988877653                                                    


Q ss_pred             hcccceEECCCCcccCCCcccccCCCCCCEEECcCccccccCcccccCCCCCCEEECcCCcCcccCCccccCCCcCCeEe
Q 002097          769 LSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFI  848 (967)
Q Consensus       769 l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~  848 (967)
                       +.|++|+|++|.+.+.+|..+..+++|++|+|++|.+++.+|..|+.+++|+.|||++|+++|.+|..+..+++|++++
T Consensus       499 -~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~  577 (968)
T PLN00113        499 -SELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVN  577 (968)
T ss_pred             -hccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEe
Confidence             3899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCcCccCCCCCcccccccCcccccCCcCCCCCC
Q 002097          849 VAYNNLSGKIPEWTAQFATFNKSSYDGNPFLCGLP  883 (967)
Q Consensus       849 ls~N~l~~~~p~~~~~~~~~~~~~~~~n~~lc~~~  883 (967)
                      +++|+++|.+|.. +++.++...++.|||.+|+.+
T Consensus       578 ls~N~l~~~~p~~-~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        578 ISHNHLHGSLPST-GAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             ccCCcceeeCCCc-chhcccChhhhcCCccccCCc
Confidence            9999999999985 789999999999999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query967
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-51
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-27
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-51
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-27
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-12
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-11
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 8e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 201 bits (512), Expect = 1e-51, Method: Compositional matrix adjust. Identities = 195/683 (28%), Positives = 303/683 (44%), Gaps = 82/683 (12%) Query: 253 AHLQELYIDNNDLRGSLPW--CLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLS 310 A L L + N L G + L + + L+ L+VS N L S + L S+E L LS Sbjct: 97 ASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLS 156 Query: 311 NNHFRIPVSLEPLFNHS--KLKIFDAKNNEINGEINESHSLTPKFQLKSLSLSSNYGDSV 368 N + + + +LK N+I+G+++ S + +F L +SSN + Sbjct: 157 ANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEF----LDVSSN--NFS 210 Query: 369 TFPKFLYHQHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHSHKR 428 T FL L+ ++S K+ G+F + + T+L+ L + ++ GP +P K Sbjct: 211 TGIPFLGDCSALQHLDISGNKLSGDF-SRAISTCTELKLLNISSNQFVGP--IPPLPLKS 267 Query: 429 LRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFG--------------- 473 L++L ++ N F G IP + +L ++S N G++P FG Sbjct: 268 LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNF 327 Query: 474 ----------NVIFLQFLDLSNNKLTGEIPDHLAMCCVXXXXXXXXXXXXKGHIFSRIFS 523 + L+ LDLS N+ +GE+P+ L G I + Sbjct: 328 SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ 387 Query: 524 --LRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMP 581 L+ L L+ N F G+IP +LS CS L L+L+ N LSG IP LG+L L+ + + Sbjct: 388 NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLW 447 Query: 582 KNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKNMLHGQLKEGTF 641 N LEG IP E + +L+ L + N+++G +PS Sbjct: 448 LNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS----------------------- 484 Query: 642 FNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIXXXXXXXXXXXXXX 701 NC++L + LS N L G IP WI L L+ L L++N+ G +P Sbjct: 485 -NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLN 543 Query: 702 XXXXHGLIPSCFDNTTLHESYN----------NNSSPDKPFKTSFSISGPQGSVEKKILE 751 +G IP+ + + N N K + ++ QG +++ Sbjct: 544 TNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNR 603 Query: 752 IFEFTTKNIAYAYQGRVLS-------LLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHN 804 + NI G S + LD+S N L G+IP +IG++ + LNL HN Sbjct: 604 LSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHN 663 Query: 805 NLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQ 864 +++G+IP +LR + LDLS NKL G+IP+ + L L ++ NNLSG IPE Q Sbjct: 664 DISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQ 722 Query: 865 FATFNKSSYDGNPFLCGLPLPIC 887 F TF + + NP LCG PLP C Sbjct: 723 FETFPPAKFLNNPGLCGYPLPRC 745
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query967
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-164
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-86
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-84
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-73
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-54
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-47
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-72
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-59
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-59
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-57
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-56
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-68
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-65
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-60
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-54
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-45
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-51
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-54
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-58
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-49
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-42
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-48
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-32
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-45
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-39
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-37
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-35
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-33
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-29
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-27
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-25
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 9e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-16
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  500 bits (1290), Expect = e-164
 Identities = 216/799 (27%), Positives = 342/799 (42%), Gaps = 111/799 (13%)

Query: 98  LKSLDLSGVGIR-DGNKLLQSMGSFPSLNTLHLESNNFTATLTTTQELHNFTNLEYLTLD 156
           + S+DLS   +    + +  S+ S   L +L L +++   +++         +L  L L 
Sbjct: 52  VTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVS---GFKCSASLTSLDLS 108

Query: 157 DSSLH--ISLLQSIGSIFPSLKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNT 214
            +SL   ++ L S+GS    LK L++S   ++      G     SLE LD+    I+   
Sbjct: 109 RNSLSGPVTTLTSLGS-CSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGAN 167

Query: 215 SFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAHLQELYIDNNDLRGSLPWCLA 274
               ++ +    LK+L++SG+ +   S  +    +    +L+ L + +N+    +P+ L 
Sbjct: 168 VVGWVLSDGCGELKHLAISGNKI---SGDV---DVSRCVNLEFLDVSSNNFSTGIPF-LG 220

Query: 275 NTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDA 334
           + ++L+ LD+S N+L+G  S + +   T ++ L +S+N F  P+   P      L+    
Sbjct: 221 DCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFVGPI---PPLPLKSLQYLSL 276

Query: 335 KNNEINGEINESHSLTPKFQLKSLSLSSNY--GDSVTFPKFLYHQHELKEAELSHIKMIG 392
             N+  GEI +  S      L  L LS N+  G     P F      L+   LS     G
Sbjct: 277 AENKFTGEIPDFLSGACD-TLTGLDLSGNHFYG---AVPPFFGSCSLLESLALSSNNFSG 332

Query: 393 EFPNWLLENNTKLEFLYLVNDSLAGPFRLPIHS-HKRLRFLDVSNNNFQGHIPVEIGDI- 450
           E P   L     L+ L L  +  +G     + +    L  LD+S+NNF G I   +    
Sbjct: 333 ELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNP 392

Query: 451 LPSLVYFNISMNALDGSIPSSFGNVIFLQFLDLSNNKLTGEIPDHLAMCCVNLEFLSLSN 510
             +L    +  N   G IP +  N   L  L LS N L+G IP  L      L  L L  
Sbjct: 393 KNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL-SKLRDLKLWL 451

Query: 511 NSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLG 570
           N L+G I   +  ++ L  L+L+ N   GEIP  LS C++L  + L+NN L+G+IP+W+G
Sbjct: 452 NMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIG 511

Query: 571 NLKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVHLSKN 630
            L+ L  + +  N   G IP E     SL  LD++ N  +G++P+               
Sbjct: 512 RLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM------------- 558

Query: 631 MLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHN--NLEGEVPIQ 688
                      F  S      ++ N++ G    +I         + A N    +G    Q
Sbjct: 559 -----------FKQS----GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQ 603

Query: 689 LCRLNQLQLLDLSDNNLHGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKK 748
           L RL+     +++     G     FDN                                 
Sbjct: 604 LNRLSTRNPCNITSRVYGGHTSPTFDN--------------------------------- 630

Query: 749 ILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPPQIGNLTRIQTLNLSHNNLTG 808
                                  +  LD+S N L G+IP +IG++  +  LNL HN+++G
Sbjct: 631 --------------------NGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG 670

Query: 809 TIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATF 868
           +IP    +LR +  LDLS NKL G+IP+ +  L  L    ++ NNLSG IPE   QF TF
Sbjct: 671 SIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETF 729

Query: 869 NKSSYDGNPFLCGLPLPIC 887
             + +  NP LCG PLP C
Sbjct: 730 PPAKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query967
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.36
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.18
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.15
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.08
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.6
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.59
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.41
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.09
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.97
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.56
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.4e-76  Score=720.00  Aligned_cols=670  Identities=31%  Similarity=0.434  Sum_probs=400.2

Q ss_pred             CCccEEECCCCccCcc---chhhhcCCCCCCEEECCCCcCCCCCChhhhcCCCCCCEEEcCCCCCCcccccc--CccCCC
Q 002097           22 SKLKKLDLRGNLCNNS---ILSSVARLSSLTSLHLSHNILQGSIDAKEFDSLSNLEELDINDNEIDNVEVSR--GYRGLR   96 (967)
Q Consensus        22 ~~L~~L~Ls~~~~~~~---~~~~l~~l~~L~~L~L~~~~i~~~i~~~~~~~l~~L~~L~Ls~n~i~~~~~~~--~~~~l~   96 (967)
                      .+++.|||+++.+.+.   +++++.++++|+.++++.+.+. .++. .|+.+++|++|||++|.+.+..+ .  .+++++
T Consensus        50 ~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~-~l~~-~~~~l~~L~~L~Ls~n~l~~~~~-~~~~l~~l~  126 (768)
T 3rgz_A           50 DKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHIN-GSVS-GFKCSASLTSLDLSRNSLSGPVT-TLTSLGSCS  126 (768)
T ss_dssp             TEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEE-ECCC-CCCCCTTCCEEECCSSEEEEEGG-GGGGGGGCT
T ss_pred             CcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcC-CCch-hhccCCCCCEEECCCCcCCCcCC-ChHHHhCCC
Confidence            3566666666666655   5566666666666666666544 2222 34666666666666666554433 2  455555


Q ss_pred             CccEEECCCCCCCCCchhhhhc-CCCCcccEEeccCCccccccccc-hhhcCCCCCcEEEcCCCCCchhhhhhhhccccc
Q 002097           97 KLKSLDLSGVGIRDGNKLLQSM-GSFPSLNTLHLESNNFTATLTTT-QELHNFTNLEYLTLDDSSLHISLLQSIGSIFPS  174 (967)
Q Consensus        97 ~L~~L~L~~~~l~~~~~~~~~l-~~l~~L~~L~L~~n~~~~~~~~~-~~l~~l~~L~~L~L~~~~~~~~~~~~l~~~~~~  174 (967)
                      +|++|++++|.+  .+..+..+ .++++|++|++++|.+.+..... ..+.++++|++|++++|.+              
T Consensus       127 ~L~~L~Ls~n~l--~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l--------------  190 (768)
T 3rgz_A          127 GLKFLNVSSNTL--DFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKI--------------  190 (768)
T ss_dssp             TCCEEECCSSEE--ECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEE--------------
T ss_pred             CCCEEECcCCcc--CCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcc--------------
Confidence            555555555554  22222222 44455555555555444332000 0033344444444443322              


Q ss_pred             chhhcccCcccccccCCCCCCCccccceecccccccccccchhhhhhcccCcccEEecCCCCCCCCCCcccccCCCCCCC
Q 002097          175 LKNLSMSGCEVNGVLSGQGFPHFKSLEHLDMRFARIALNTSFLQIIGESMPSLKYLSLSGSTLGTNSSRILDQGLCPLAH  254 (967)
Q Consensus       175 l~~l~~~~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~l~~~~~~i~~~~~~~l~~  254 (967)
                                                            .+..+.  .. +++|++|++++|.+.+   .++  .+..+++
T Consensus       191 --------------------------------------~~~~~~--~~-l~~L~~L~Ls~n~l~~---~~~--~l~~l~~  224 (768)
T 3rgz_A          191 --------------------------------------SGDVDV--SR-CVNLEFLDVSSNNFST---GIP--FLGDCSA  224 (768)
T ss_dssp             --------------------------------------ESCCBC--TT-CTTCCEEECCSSCCCS---CCC--BCTTCCS
T ss_pred             --------------------------------------cccCCc--cc-CCcCCEEECcCCcCCC---CCc--ccccCCC
Confidence                                                  111111  11 4555555555555544   222  1555555


Q ss_pred             CcEEEccCCccccccCchhccCCCCcEEecccCcccCCCCcccccCCCCCcEEEcccCCCCCCCCcccccCCCCccEEec
Q 002097          255 LQELYIDNNDLRGSLPWCLANTTSLRILDVSFNQLTGSISSSPLVHLTSIEELRLSNNHFRIPVSLEPLFNHSKLKIFDA  334 (967)
Q Consensus       255 L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~l  334 (967)
                      |++|++++|.+++..|..++.+++|++|++++|.+++.+|.  . .+++|++|++++|++.+.++.              
T Consensus       225 L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~--~-~l~~L~~L~L~~n~l~~~ip~--------------  287 (768)
T 3rgz_A          225 LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP--L-PLKSLQYLSLAENKFTGEIPD--------------  287 (768)
T ss_dssp             CCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCC--C-CCTTCCEEECCSSEEEESCCC--------------
T ss_pred             CCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCc--c-ccCCCCEEECcCCccCCccCH--------------
Confidence            55555555555555555555555555555555555544443  1 445555555555544432221              


Q ss_pred             cCCcccccccccCCCCCccceeEEEccCCCCCCCCcChhccC-CCCccEEEccCCcCcccCchHHhhcCCCCcEEEccCC
Q 002097          335 KNNEINGEINESHSLTPKFQLKSLSLSSNYGDSVTFPKFLYH-QHELKEAELSHIKMIGEFPNWLLENNTKLEFLYLVND  413 (967)
Q Consensus       335 s~n~l~~~~~~~~~~~~~~~L~~L~Ls~~~~~~~~~~~~~~~-~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~L~~n  413 (967)
                                                            .+.. +++|++|++++|.+.+.+|..                
T Consensus       288 --------------------------------------~~~~~~~~L~~L~Ls~n~l~~~~p~~----------------  313 (768)
T 3rgz_A          288 --------------------------------------FLSGACDTLTGLDLSGNHFYGAVPPF----------------  313 (768)
T ss_dssp             --------------------------------------CSCTTCTTCSEEECCSSEEEECCCGG----------------
T ss_pred             --------------------------------------HHHhhcCcCCEEECcCCcCCCccchH----------------
Confidence                                                  1111 133444444444444444443                


Q ss_pred             cccCcCCCCcCCCCCccEEEecCCcCCcCCChhhhhcCCCCcEEECcCCCCCCCCcccccCCC-CCCEEEccCCcCCCcc
Q 002097          414 SLAGPFRLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVI-FLQFLDLSNNKLTGEI  492 (967)
Q Consensus       414 ~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~-~L~~L~L~~n~l~~~i  492 (967)
                               +..+++|++|++++|.+.|.+|...+..+++|++|++++|.+++.+|..+.+++ +|++|++++|++++.+
T Consensus       314 ---------~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~  384 (768)
T 3rgz_A          314 ---------FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI  384 (768)
T ss_dssp             ---------GGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEEC
T ss_pred             ---------HhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCc
Confidence                     344444455555555554455544333355555555555555555555555554 5555555555555544


Q ss_pred             chhHhh-cCCCCcEEEcccccccccccccccCCccccceeccCccccccCCccCcCCCCCcEEECcCCcCCCCCCccccC
Q 002097          493 PDHLAM-CCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVGEIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGN  571 (967)
Q Consensus       493 ~~~~~~-~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~  571 (967)
                      |..+.. .+++|++|++++|.+++.+|..+..+++|++|++++|.+++..|..+.++++|++|++++|.+.+.+|..+..
T Consensus       385 ~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~  464 (768)
T 3rgz_A          385 LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY  464 (768)
T ss_dssp             CTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGG
T ss_pred             ChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcC
Confidence            444322 1345556666666555555555555566666666666665555555555666666666666665555655555


Q ss_pred             CCCCCEEECCCCccccCCCccccCCCCCCEEeCcCCcCCcCCCCCcC-CCcccEEEccCCcCcccCCcccccCCCCCcEE
Q 002097          572 LKGLQHIVMPKNHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFY-PLSIKQVHLSKNMLHGQLKEGTFFNCSSLVTL  650 (967)
Q Consensus       572 l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~-~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L  650 (967)
                      +++|++|++++|++++.+|..+.++++|++|++++|++++.+|..+. +++|+.|++++|.+.+.+|. .+..+++|+.|
T Consensus       465 l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~-~l~~l~~L~~L  543 (768)
T 3rgz_A          465 VKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPA-ELGDCRSLIWL  543 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCG-GGGGCTTCCEE
T ss_pred             CCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCH-HHcCCCCCCEE
Confidence            66666666666666555555566666666666666666555554433 44455555555555455554 55556666666


Q ss_pred             ECcCccCCCCcchhhhCCCCCCEEEcCCC----------------------cCcccCChhccCCCCCCEEECCCCcCccc
Q 002097          651 DLSYNYLNGSIPDWIDGLSQLSHLNLAHN----------------------NLEGEVPIQLCRLNQLQLLDLSDNNLHGL  708 (967)
Q Consensus       651 ~L~~n~l~~~~~~~~~~l~~L~~L~L~~n----------------------~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~  708 (967)
                      ++++|+++|.+|.++.....+..+++..+                      .+.+..+..+..++.++.++++.|.+.|.
T Consensus       544 ~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~  623 (768)
T 3rgz_A          544 DLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGH  623 (768)
T ss_dssp             ECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEE
T ss_pred             ECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceeccc
Confidence            66666666666655554444333332221                      12344455555666666677777777777


Q ss_pred             CCCcccccccccccCCCCCCCCCcccccccCCCCCchhhhhheeeeeeccccccccchhhhcccceEECCCCcccCCCcc
Q 002097          709 IPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGHIPP  788 (967)
Q Consensus       709 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~  788 (967)
                      +|..+..+                                                     +.|+.|||++|+++|.+|.
T Consensus       624 ~~~~~~~l-----------------------------------------------------~~L~~LdLs~N~l~g~ip~  650 (768)
T 3rgz_A          624 TSPTFDNN-----------------------------------------------------GSMMFLDMSYNMLSGYIPK  650 (768)
T ss_dssp             CCCSCSSS-----------------------------------------------------BCCCEEECCSSCCBSCCCG
T ss_pred             Cchhhhcc-----------------------------------------------------ccccEEECcCCcccccCCH
Confidence            77666553                                                     4899999999999999999


Q ss_pred             cccCCCCCCEEECcCccccccCcccccCCCCCCEEECcCCcCcccCCccccCCCcCCeEecCCCcCccCCCCCccccccc
Q 002097          789 QIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQFATF  868 (967)
Q Consensus       789 ~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~  868 (967)
                      .|+++++|+.|+|++|+++|.+|..|+++++|++|||++|+++|.+|..+..+++|++||+++|+++|.||.. ++|.++
T Consensus       651 ~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~-~~~~~~  729 (768)
T 3rgz_A          651 EIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETF  729 (768)
T ss_dssp             GGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS-SSGGGS
T ss_pred             HHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc-hhhccC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999996 899999


Q ss_pred             CcccccCCcCCCCCCCCCCCCcC
Q 002097          869 NKSSYDGNPFLCGLPLPICRSLA  891 (967)
Q Consensus       869 ~~~~~~~n~~lc~~~l~~c~~~~  891 (967)
                      ...+|.|||++||.|+..|....
T Consensus       730 ~~~~~~gN~~Lcg~~l~~C~~~~  752 (768)
T 3rgz_A          730 PPAKFLNNPGLCGYPLPRCDPSN  752 (768)
T ss_dssp             CGGGGCSCTEEESTTSCCCCSCC
T ss_pred             CHHHhcCCchhcCCCCcCCCCCc
Confidence            99999999999999988886443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 967
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-08
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-20
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-12
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 6e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 90.5 bits (223), Expect = 3e-20
 Identities = 46/270 (17%), Positives = 98/270 (36%), Gaps = 15/270 (5%)

Query: 420 RLPIHSHKRLRFLDVSNNNFQGHIPVEIGDILPSLVYFNISMNALDGSIPSSFGNVIFLQ 479
           ++P         LD+ NN        +  + L +L    +  N +    P +F  ++ L+
Sbjct: 24  KVPKDLPPDTALLDLQNNKITEIKDGDFKN-LKNLHTLILINNKISKISPGAFAPLVKLE 82

Query: 480 FLDLSNNKLTGEIPDHLAMCCVNLEFLSLSNNSLKGHIFSRIFSLRNLRWLLLEGNHFVG 539
            L LS N+L  E+P+ +      L         ++  +F+   +   +  L        G
Sbjct: 83  RLYLSKNQLK-ELPEKMPKTLQELRVHENEITKVRKSVFNG-LNQMIVVELGTNPLKSSG 140

Query: 540 EIPQSLSKCSSLKGLYLNNNNLSGKIPRWLGNLKGLQHIVMPKNHLEGPIPVEFCRLDSL 599
               +      L  + + + N++  IP+  G    L  + +  N +          L++L
Sbjct: 141 IENGAFQGMKKLSYIRIADTNIT-TIPQ--GLPPSLTELHLDGNKITKVDAASLKGLNNL 197

Query: 600 QILDISDNNISGSLPSCFYPLS-IKQVHLSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLN 658
             L +S N+IS            ++++HL+ N L          +   +  + L  N ++
Sbjct: 198 AKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGG--LADHKYIQVVYLHNNNIS 255

Query: 659 G------SIPDWIDGLSQLSHLNLAHNNLE 682
                    P +    +  S ++L  N ++
Sbjct: 256 AIGSNDFCPPGYNTKKASYSGVSLFSNPVQ 285


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query967
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.35
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.08
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.9
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.72
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.4
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.16
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=7.6e-31  Score=281.48  Aligned_cols=259  Identities=35%  Similarity=0.570  Sum_probs=220.4

Q ss_pred             CCcEEECcCCcCCC--CCCccccCCCCCCEEECCC-CccccCCCccccCCCCCCEEeCcCCcCCcCCCCCcCCCcccEEE
Q 002097          550 SLKGLYLNNNNLSG--KIPRWLGNLKGLQHIVMPK-NHLEGPIPVEFCRLDSLQILDISDNNISGSLPSCFYPLSIKQVH  626 (967)
Q Consensus       550 ~L~~L~L~~n~l~~--~~~~~~~~l~~L~~L~l~~-n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~L~~L~  626 (967)
                      +++.|+|++|.+.+  .+|..++++++|++|++++ |++.|.+|..|+++++|++|++++|++.+..+.           
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~-----------  119 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPD-----------  119 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCG-----------
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccc-----------
Confidence            56677777777765  3667777777788887775 677777777788888888888877777643322           


Q ss_pred             ccCCcCcccCCcccccCCCCCcEEECcCccCCCCcchhhhCCCCCCEEEcCCCcCcccCChhccCCCCC-CEEECCCCcC
Q 002097          627 LSKNMLHGQLKEGTFFNCSSLVTLDLSYNYLNGSIPDWIDGLSQLSHLNLAHNNLEGEVPIQLCRLNQL-QLLDLSDNNL  705 (967)
Q Consensus       627 l~~n~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~Ls~n~l  705 (967)
                                   .+..+..|+.+++++|.+.+.+|..+..+++|+++++++|.+.+.+|..+..+..+ +.+++++|++
T Consensus       120 -------------~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l  186 (313)
T d1ogqa_         120 -------------FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRL  186 (313)
T ss_dssp             -------------GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEE
T ss_pred             -------------cccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccc
Confidence                         56677888888999988888889999999999999999999999999988888876 8899999999


Q ss_pred             cccCCCcccccccccccCCCCCCCCCcccccccCCCCCchhhhhheeeeeeccccccccchhhhcccceEECCCCcccCC
Q 002097          706 HGLIPSCFDNTTLHESYNNNSSPDKPFKTSFSISGPQGSVEKKILEIFEFTTKNIAYAYQGRVLSLLAGLDLSCNKLVGH  785 (967)
Q Consensus       706 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~  785 (967)
                      ++..|..+..+                                                      ....++++++...+.
T Consensus       187 ~~~~~~~~~~l------------------------------------------------------~~~~l~l~~~~~~~~  212 (313)
T d1ogqa_         187 TGKIPPTFANL------------------------------------------------------NLAFVDLSRNMLEGD  212 (313)
T ss_dssp             EEECCGGGGGC------------------------------------------------------CCSEEECCSSEEEEC
T ss_pred             ccccccccccc------------------------------------------------------ccccccccccccccc
Confidence            98888776553                                                      345799999999999


Q ss_pred             CcccccCCCCCCEEECcCccccccCcccccCCCCCCEEECcCCcCcccCCccccCCCcCCeEecCCCcCccCCCCCcccc
Q 002097          786 IPPQIGNLTRIQTLNLSHNNLTGTIPLTFSNLRHIESLDLSYNKLSGKIPRQLVDLNTLAIFIVAYNNLSGKIPEWTAQF  865 (967)
Q Consensus       786 ~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~  865 (967)
                      +|..+..+++|+.+++++|.+++.+| .++.+++|+.|||++|+++|.+|+.+.++++|++|++++|+++|.+|.. +.+
T Consensus       213 ~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~-~~L  290 (313)
T d1ogqa_         213 ASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNL  290 (313)
T ss_dssp             CGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTG
T ss_pred             cccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc-ccC
Confidence            99999999999999999999998765 6888999999999999999999999999999999999999999999985 788


Q ss_pred             cccCcccccCCcCCCCCCCCCCC
Q 002097          866 ATFNKSSYDGNPFLCGLPLPICR  888 (967)
Q Consensus       866 ~~~~~~~~~~n~~lc~~~l~~c~  888 (967)
                      .+++..++.||+.+||.|+..|.
T Consensus       291 ~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         291 QRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             GGSCGGGTCSSSEEESTTSSCCC
T ss_pred             CCCCHHHhCCCccccCCCCCCCC
Confidence            99999999999999999987773



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure