Citrus Sinensis ID: 002129

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960--

MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGKWVFDD

ccHHHHHHHHHHHHccEEEEEccccccccccccccEEEEEEECccccccccccccccccccEEEEcccccccccccccccHHHHcccccccEEEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccHHHHHHccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHcccccccccEEEEcccccccccHHHHHccccccccccEEEEEEcccccccccHHHHHHHHccccccccccEEEEEccccccccccccccccccCEEEEECccccccccccccccccccEEEEccccccEECcccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEcccccccccccccccEEEEEcccccEEECccccccccccEEEEccccccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccccccccccccHHHccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccccccccccccccEEEECccccccccccccccccccEEEECccccccccccccccccccccccccccccEEEECccccccccccccccccccccccccccccccEEEEEEcccccccHHHcccccccccEEEECcccccccccccccccccccEEEECcccccccccccccccccccEEEEEEEcccccccccccccccccEEEECccccccccccccccccccEEEEcccHHHHHHHHHccccccccccccEEEECcccccccccccccccccccccccccccccEEEECcccccccccccccccccccEEEECccccccccccccccccccEEEECccHHHHHHHcccccccccccccccEEEEccCEEECc

MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEE***QQQLYELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGKWVFD*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 690-749,768-823
View the alignment between query and template
View the model in PyMOL

Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 533-584
View the alignment between query and template
View the model in PyMOL

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 122-195,225-234,262-401,413-434,459-481,510-632
View the alignment between query and template
View the model in PyMOL

Template: 3G06, chain A
Confidence level:very confident
Coverage over the Query: 525-640,689-821
View the alignment between query and template
View the model in PyMOL

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 87-183,230-252,263-330
View the alignment between query and template
View the model in PyMOL

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 90-195,250-397,415-435,460-494,525-638,678-798
View the alignment between query and template
View the model in PyMOL

Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 466-632,673-923
View the alignment between query and template
View the model in PyMOL

Template: 3BZ5, chain A
Confidence level:very confident
Coverage over the Query: 53-198,229-252,264-357,377-428,466-511,525-537
View the alignment between query and template
View the model in PyMOL

Template: 3O6N, chain A
Confidence level:very confident
Coverage over the Query: 465-639,653-673,687-826
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 89-196,224-248,282-398,416-435,460-638,678-939
View the alignment between query and template
View the model in PyMOL

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 32-195,226-329
View the alignment between query and template
View the model in PyMOL

Template: 3FXI, chain A
Confidence level:probable
Coverage over the Query: 85-143,161-423,466-607
View the alignment between query and template
View the model in PyMOL