Citrus Sinensis ID: 002129


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960--
MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGKWVFDD
ccHHHHHHHHHHHHccEEEEEccccccccccccccEEEEEEEEccccccccccccccccccEEEEcccccccccccccccHHHHcccccccEEEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccHHHHHHccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHcccccccccEEEEcccccccccHHHHHccccccccccEEEEEEcccccccccHHHHHHHHccccccccccEEEEEccccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEcccccccccccccccEEEEEcccccEEEEccccccccccEEEEccccccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccccccccccccHHHccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccEEEEEEcccccccHHHcccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEEEcccccccccccccccccEEEEEccccccccccccccccccEEEEcccHHHHHHHHHccccccccccccEEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEEEEc
cccHHHHHHHHHHccEEEEEEcccccccccccccccEEEEEEccccccccccccHHHHHcccEEEEcccccccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccHEEEEEcccccHcccccHHHHHHHHHHHHHcccHHHHHccHcHcccccccEEEccccccHHcccccccccccccEccEEEEcccccccHHHHHHHHHcccEEEEccccccccHHHHHHHcHHccccccEEEEEEccccccccccHHHHHHHHHcccccccEEEEEEcccccccccccccccHHHcEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccccccEEEEccHHHHHHHccccccccccccccHcEEEEccccHHccccccHccccEEEEEccccccccccccccccEEEEEccccccEccccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccHHHcccccccccEEEEcccccccccccccccccccEEEEcccccHccccHHHccccccccccccccccEEEccccccccccccccccccHHHHcccccccccccEEEEcccccHccccHHccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccccccEEEEcccHcHcccccHccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHHHHccccccccccEEEEcccccccccccHHcccccccccccccccccEEEEcccccHHcccHHccccccccEEEEcccccHcccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEcccEEccc
MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIrgdydgvqrfgdlydiQHLRTFLPvilsnskpgylapsmlpkllklqSLRVFSLrgyrilelpdsvgdlrYLRYLNlsgteirtlpESVSKLYNLHSLLLEDCDRLEKLCADMGnlvklhhlknsntksleempvgigRLTCLQTLCSFvvgkdsgsglRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEmgvldmlkphtnleqfcikgyggmkfptwlgdssfsklvtlkfkncdmctalpsvgqlpslkhltvRGMSKvkrlgsefygddspipfprletlrfedlqewedsiphgssqgverfpkLRELRILRCSKlkgtfpehlpALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWesatghlgsqnsvvcrdtsnqvflagplkpqlpKLEELILSTKEQTYIWKShdgllqdvcslksleirscpklqsLVAEEEKDQQQQLYELLEYLRLSYCEGlvklpqsslslsslreIEIYGCrslvsfpevalpsklkkIEISSCDalkslpeawmcdtnssleileisgcdsltyiagvqlppslkrlkichcdnirtltveegiqcssgrrytSSLLEhleiyscpsltcifsknelpatleslevgnlppsLKLLLVWGCSKLESIAEMLdnntslekinisgcgnlqtlpsglhnlCQLQEISiascgnlvsspegglpcAKLAMLAIYNCKRLEALPKGLHNLKSLQElrigkgvalpsleedglptnLHVLLINGNMEIWKSMIERgrgfhrfsslrqltimncdddmvsfppkaddkgsgtvlplpasltylriegfpnlerlTSSIVDLqnltglvlgncpklkyfpekglpssllqlsinrcplieekcrkdggQYWDLLthiprveisgkwvfdd
MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRIlelpdsvgdlrYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVgkdsgsglRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTAlpsvgqlpslkhlTVRGMSKVKRlgsefygddspipfPRLETLRFEDLQEWEdsiphgssqgverfpkLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFlagplkpqlpKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLtveegiqcssgRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLlthiprveisgkwvfdd
MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGplkpqlpkleelilSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAeeekdqqqqlyelleylrlSYCEGLVKLPQsslslsslREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGKWVFDD
*****SDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEW************ERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLV********QQLYELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSF*********GTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGKWVF**
MHDLVSDLAQWAAGEMYFTMEYTSE*****RFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGS******TEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEE***QQQLYELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPE*****TNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTV*************SSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKS*******FHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGKWVFD*
MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGKWVFDD
*HDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGKWVFD*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLKSLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGKWVFDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query962 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.913 0.617 0.307 4e-94
Q9LRR41054 Putative disease resistan no no 0.417 0.381 0.392 8e-72
Q7XA42979 Putative disease resistan N/A no 0.475 0.466 0.302 3e-48
Q7XBQ9970 Disease resistance protei N/A no 0.454 0.450 0.335 1e-44
Q7XA39988 Putative disease resistan N/A no 0.453 0.441 0.316 2e-43
Q7XA40992 Putative disease resistan N/A no 0.486 0.471 0.313 3e-42
P0DI181049 Probable disease resistan no no 0.355 0.326 0.292 2e-10
P0DI171049 Probable disease resistan no no 0.355 0.326 0.292 2e-10
Q38834852 Disease resistance RPP13- no no 0.267 0.301 0.282 2e-08
Q9RBS21024 Protein PopC OS=Ralstonia no no 0.299 0.281 0.259 2e-07
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  346 bits (888), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 311/1013 (30%), Positives = 472/1013 (46%), Gaps = 134/1013 (13%)

Query: 1    MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQH 60
            MHDL++DLA+  +G+  F +E     +         RH S+ R   D    F  +   + 
Sbjct: 487  MHDLMNDLAKAVSGDFCFRLED----DNIPEIPSTTRHFSFSRSQCDASVAFRSICGAEF 542

Query: 61   LRTFLPVILSNSKPGYLAPSML------PKLLKLQSLRVFSLRGYRILELPDSVGDLRYL 114
            LRT LP     + P  L    L      P L  L  LR+ SL  Y+I  LP S+  L+ L
Sbjct: 543  LRTILPF----NSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLL 598

Query: 115  RYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEE 174
            RYL+LS T+I+ LPE V  L NL +LLL +C  L  L   +  L+ L  L    T  L E
Sbjct: 599  RYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTP-LVE 657

Query: 175  MPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLD 234
            MP GI +L  LQ L +FV+G+ SG+GL ELK L+ LRGTL IS L+NV    +A+DA L 
Sbjct: 658  MPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLK 717

Query: 235  RKENLKELWLRWTLYGS------YSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTW 288
            RK  L  L L+WT+ GS      ++  A  +  VL ML+PH +L+ FCI+ Y G  FP W
Sbjct: 718  RKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKW 777

Query: 289  LGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFY---GDDSPI 345
            LGDSSF  + ++   +C++C +LP VGQLPSLK+L++   + ++++G +F+    +   +
Sbjct: 778  LGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGV 837

Query: 346  PFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLV 405
            PF  L+ L+F  +  W++ I      G+  FP L++L I RC  L+  FPE LP+   + 
Sbjct: 838  PFQSLQILKFYGMPRWDEWICPELEDGI--FPCLQKLIIQRCPSLRKKFPEGLPSSTEVT 895

Query: 406  IEGCEELLV---------SVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCR----- 451
            I  C    V         S++++P     I S  ++ +  S TG+  S  S   +     
Sbjct: 896  ISDCPLRAVSGGENSFRRSLTNIPESPASIPSMSRREL-SSPTGNPKSDASTSAQPGFAS 954

Query: 452  ----DTSNQV-----FLAGPLKPQLPKLEE-------LILSTKEQTYIWKSHDGLLQDVC 495
                +  N+V       + P   Q    ++       L    +E   I   + G + D+ 
Sbjct: 955  SSQSNDDNEVTSTSSLSSLPKDRQTEDFDQYETQLGSLPQQFEEPAVISARYSGYISDIP 1014

Query: 496  S-----LKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEGLVKLPQSSLSLSS 550
            S     +    +   PK +  +       Q   Y +   +        +K  Q     + 
Sbjct: 1015 STLSPYMSRTSLVPDPKNEGSILPGSSSYQYHQYGIKSSVPSPRSSEAIKPSQYDDDETD 1074

Query: 551  LREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDS 610
            +  +++     L+  P+      L+ + I SCD L SLPE  + ++  +L  L I  C S
Sbjct: 1075 MEYLKVTDISHLMELPQ-----NLQSLHIDSCDGLTSLPEN-LTESYPNLHELLIIACHS 1128

Query: 611  LTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEI-YSCPSLTC 669
            L    G   P +LK L I  C   + L   E +Q +  R Y  S LE+L I  SC +L  
Sbjct: 1129 LESFPGSHPPTTLKTLYIRDC---KKLNFTESLQPT--RSY--SQLEYLFIGSSCSNLV- 1180

Query: 670  IFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESI---AEMLDNNTSLEKINISGCGN 726
                   P +L         P L+ L +  C   ++    A + D+  +LE + I  C N
Sbjct: 1181 -----NFPLSLF--------PKLRSLSIRDCESFKTFSIHAGLGDDRIALESLEIRDCPN 1227

Query: 727  LQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKRLEALPKGLHNLK 786
            L+T                         P+GGLP  KL+ + + NCK+L+ALP+ L  L 
Sbjct: 1228 LETF------------------------PQGGLPTPKLSSMLLSNCKKLQALPEKLFGLT 1263

Query: 787  SLQELRIGKGVALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGR-GFHRFSSLRQLTIM 845
            SL  L I K   + ++   G P+NL  L I+    +   +  R   G     +LR L I 
Sbjct: 1264 SLLSLFIIKCPEIETIPGGGFPSNLRTLCIS----LCDKLTPRIEWGLRDLENLRNLEID 1319

Query: 846  NCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLT-SSIVDLQNLTGLVLGN 904
              ++D+ SFP +           LP S+  LRI  F NL+ L      D + +  + +  
Sbjct: 1320 GGNEDIESFPEEG---------LLPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISG 1370

Query: 905  CPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPRVEISGK 957
            C KL+   ++ LP  L  L I+ C L+ E   +   +++ +L +IP VEI G+
Sbjct: 1371 CDKLQISIDEDLP-PLSCLRISSCSLLTETFAEVETEFFKVL-NIPYVEIDGE 1421




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description
>sp|P0DI17|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query962
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.948 0.640 0.413 1e-174
400131587 1388 FB_MR5 [Malus x robusta] 0.912 0.632 0.410 1e-162
225449649 1418 PREDICTED: putative disease resistance p 0.928 0.629 0.395 1e-156
356554923 1399 PREDICTED: putative disease resistance R 0.920 0.633 0.384 1e-150
225450023 1396 PREDICTED: putative disease resistance p 0.905 0.623 0.369 1e-143
224059584 1418 cc-nbs-lrr resistance protein [Populus t 0.939 0.637 0.388 1e-142
147766392 1471 hypothetical protein VITISV_007674 [Viti 0.898 0.587 0.365 1e-140
359487225 1373 PREDICTED: putative disease resistance R 0.900 0.630 0.375 1e-139
359487424 1453 PREDICTED: putative disease resistance R 0.948 0.627 0.376 1e-139
225450003 1452 PREDICTED: putative disease resistance R 0.943 0.625 0.376 1e-139
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
 Score =  620 bits (1598), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 401/970 (41%), Positives = 567/970 (58%), Gaps = 58/970 (5%)

Query: 1    MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQH 60
            MHDL++DLAQW AG  YF +E   + N+Q + S   RHLS++   YDG ++F  + + +H
Sbjct: 491  MHDLITDLAQWVAGISYFRLETKLKGNEQSKVSSKARHLSFVGSRYDGAKKFEAISEFKH 550

Query: 61   LRTFLPVILSNSKPGYLAPSMLPKLL-KLQSLRVFSLRGYRILELPDSVGDLRYLRYLNL 119
            LRTFLP++       YL+  ++ +LL KLQ+LRV SL GYRI+ LP ++GDL++LRYL+L
Sbjct: 551  LRTFLPLMAPYVGYSYLSYHIINQLLPKLQNLRVLSLSGYRIVYLPQTIGDLKHLRYLDL 610

Query: 120  SGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGI 179
            S T++R+LP S+S LYNL +LLLE+C  L+ L  D G L  L HL    +  LE MP+ I
Sbjct: 611  SCTQLRSLPTSISTLYNLQTLLLENCTSLKFLPPDFGKLFNLRHLNIFGSNLLEGMPLSI 670

Query: 180  GRLTCLQTLCSFVVGK-DSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKEN 238
            G L+ LQTL +FVVGK DS   +REL  L  LRGTLCIS LENV    +A D+ L  K++
Sbjct: 671  GNLSSLQTLSNFVVGKADSFCVIRELGPLVHLRGTLCISKLENVTKAQEARDSYLYGKQD 730

Query: 239  LKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLV 298
            L E+ + W+   + S++ ET++ VL+ML+P+  L++  +K YGG KFPTW+GD SFS LV
Sbjct: 731  LNEVVMEWSSNLNESQDEETQLEVLNMLQPNVKLKELTVKCYGGTKFPTWIGDPSFSNLV 790

Query: 299  TLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDL 358
             L+F+NCD C +LP VGQLP LK L ++GM+ VK +G EFYG+    PF  LETL FED+
Sbjct: 791  LLRFENCDNCNSLPPVGQLPFLKDLLIKGMAGVKSVGREFYGESCSRPFQSLETLHFEDM 850

Query: 359  QEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSS 418
              W + IP G +   E F  L +L I+RC  L    P+HLP+L+ LVI GC  ++VSVS+
Sbjct: 851  PRWVNWIPLGVN---EAFACLHKLSIIRCHNLVRKLPDHLPSLKKLVIHGCWNMVVSVSN 907

Query: 419  LPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEEL-ILST 477
            LP LC  +I GCK+V  ES+ G  GS  S+     S        L   + K+E L I+ +
Sbjct: 908  LPMLCVLVIEGCKRVECESSVG-FGSPYSMAFSKISEFGNATAGLMHGVSKVEYLKIVDS 966

Query: 478  KEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEG 537
            ++ T +W+     L  +  L+ L I  CP L S  A            +L+ +++  C G
Sbjct: 967  EKLTTLWEKIPEGLHRLKFLRELSIEDCPTLVSFPA-------SGFPSMLKVIQIKSCSG 1019

Query: 538  LVK-LPQSSLSL---SSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDALKSLPEAWM 593
            L   LP+ +L     + L  + +  C S+ S     LP+ LKK+EIS C  L+ + +   
Sbjct: 1020 LKSLLPEGTLHSRENACLERLCVVRCDSMKSIARGQLPTTLKKLEISHCMNLQCVLDEGE 1079

Query: 594  CDTNSSLEILEISGCDSLTYIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTS 653
              ++SS    E     S T+         L+ L I  C ++ TLT       SSG+    
Sbjct: 1080 GSSSSSGMHDEDINNRSKTH---------LQYLDIKSCPSLTTLT-------SSGK--LP 1121

Query: 654  SLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNN 713
            + L HL +  CP L C+ S  +LPA L+ LE+ ++            SKL+ IAE L  N
Sbjct: 1122 ATLTHLLLRECPKLMCLSSTGKLPAALQYLEIQSI------------SKLQKIAERLHQN 1169

Query: 714  TSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCK 773
            TSLE I I  C  L++LP  LHNL +L++  I  C +  S P  GLP + L +L I NCK
Sbjct: 1170 TSLECIKIWNCHGLKSLPEDLHNLSKLRQFLIFWCQSFSSFPAAGLP-SNLRVLGIKNCK 1228

Query: 774  RLEALPKGLHNLKSLQELRIGKGV-ALPSLEEDGLPTNLHVLLINGNMEIWKSMIERGRG 832
             L+ALP G+ NL SLQ+L I   + +LPS +E GLPTNL + L   +++ +K M E   G
Sbjct: 1229 NLKALPNGMRNLTSLQKLDISHRLDSLPSPQE-GLPTNL-IELNMHDLKFYKPMFE--WG 1284

Query: 833  FHRFSSLRQLTIMNCDDDMVSFPPKADDKGSGTVLPLPASLTYLRIEGFPNLERLT-SSI 891
              + +SL +L+I     D+ S+P    ++ +G ++ LP SL+ L I  F NLE L+    
Sbjct: 1285 LQQPTSLIKLSIHGECLDVDSYP---GERENGVMMLLPNSLSILCISYFQNLECLSPKGF 1341

Query: 892  VDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIEEKCRKDGGQYWDLLTHIPR 951
             +L +L  L + NC KL   P++GLP SL QL I  CPL+ + C  + GQ W  + HIP 
Sbjct: 1342 QNLTSLNQLKIYNCLKLTSLPKEGLPPSLTQLEIRNCPLLSQHCNNEKGQEWSKIAHIPC 1401

Query: 952  VEISGKWVFD 961
            V I  K++ +
Sbjct: 1402 VLIDNKFIHE 1411




Source: Quercus suber

Species: Quercus suber

Genus: Quercus

Family: Fagaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|225450023|ref|XP_002272823.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi|451798994|gb|AGF69195.1| disease resistance protein At3g14460-like protein 2 [Vitis labrusca] Back     alignment and taxonomy information
>gi|224059584|ref|XP_002299919.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222847177|gb|EEE84724.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147766392|emb|CAN67818.1| hypothetical protein VITISV_007674 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487225|ref|XP_002268551.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487424|ref|XP_002271822.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450003|ref|XP_002272221.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query962
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.424 0.286 0.401 1.7e-92
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.417 0.381 0.402 1.2e-77
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.268 0.143 0.277 1.1e-23
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.314 0.255 0.257 1.1e-15
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.357 0.173 0.262 3.1e-13
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.373 0.295 0.248 2.9e-14
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.303 0.245 0.272 1.6e-13
TAIR|locus:2129236 1301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.385 0.285 0.239 2.9e-08
TAIR|locus:2117617549 PIRL4 "plant intracellular ras 0.107 0.187 0.377 3.6e-12
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.401 0.248 0.238 6.9e-08
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 688 (247.2 bits), Expect = 1.7e-92, Sum P(2) = 1.7e-92
 Identities = 171/426 (40%), Positives = 244/426 (57%)

Query:     1 MHDLVSDLAQWAAGEMYFTMEYTSEVNKQQRFSRYLRHLSYIRGDYDGVQRFGDLYDIQH 60
             MHDL++DLA+  +G+  F +E   + N  +  S   RH S+ R   D    F  +   + 
Sbjct:   487 MHDLMNDLAKAVSGDFCFRLE---DDNIPEIPST-TRHFSFSRSQCDASVAFRSICGAEF 542

Query:    61 LRTFLPVILSNSKPGY-LAPSMLPKLLK-LQSLRVFSLRGYRILELPDSVGDLRYLRYLN 118
             LRT LP     S     L   +L  LL  L  LR+ SL  Y+I  LP S+  L+ LRYL+
Sbjct:   543 LRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLD 602

Query:   119 LSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVG 178
             LS T+I+ LPE V  L NL +LLL +C  L  L   +  L+ L  L    T  L EMP G
Sbjct:   603 LSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTP-LVEMPPG 661

Query:   179 IGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKEN 238
             I +L  LQ L +FV+G+ SG+GL ELK L+ LRGTL IS L+NV    +A+DA L RK  
Sbjct:   662 IKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPF 721

Query:   239 LKELWLRWTLYGS------YSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDS 292
             L  L L+WT+ GS      ++  A  +  VL ML+PH +L+ FCI+ Y G  FP WLGDS
Sbjct:   722 LDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDS 781

Query:   293 SFSKLVTLKFKNCDMCTALPSVGQLPSLKHLTVRGMSKVKRLGSEFY-GDDSP--IPFPR 349
             SF  + ++   +C++C +LP VGQLPSLK+L++   + ++++G +F+ G+++   +PF  
Sbjct:   782 SFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQS 841

Query:   350 LETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGC 409
             L+ L+F  +  W++ I      G+  FP L++L I RC  L+  FPE LP+   + I  C
Sbjct:   842 LQILKFYGMPRWDEWICPELEDGI--FPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDC 899

Query:   410 EELLVS 415
                 VS
Sbjct:   900 PLRAVS 905


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00010803001
SubName- Full=Chromosome chr13 scaffold_286, whole genome shotgun sequence; (1418 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query962
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-13
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-09
PLN032101153 PLN03210, PLN03210, Resistant to P 5e-09
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-06
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 5e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 75.3 bits (185), Expect = 1e-13
 Identities = 71/245 (28%), Positives = 120/245 (48%), Gaps = 36/245 (14%)

Query: 536 EGLVKL--PQSSL--------SLSSLREIEIYGCRSLVSFPEVALPSKLKKIEISSCDAL 585
           E LVKL    S L        SL+ LR I++ G ++L   P++++ + L+ +++S C +L
Sbjct: 611 ENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSL 670

Query: 586 KSLPEAWMCDTNSSLEILEISGCDSLTYI-AGVQLPPSLKRLKICHCD----------NI 634
             LP +      + LE L++S C++L  +  G+ L  SL RL +  C           NI
Sbjct: 671 VELPSS--IQYLNKLEDLDMSRCENLEILPTGINL-KSLYRLNLSGCSRLKSFPDISTNI 727

Query: 635 RTLTVEEGIQCSSGRRYTSSL-LEHL-EIYSCPSLTCIFSKNELPAT-LESLEVGNLPPS 691
             L ++E    ++   + S+L LE+L E+  C   +    +   P T L ++    L PS
Sbjct: 728 SWLDLDE----TAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTM----LSPS 779

Query: 692 LKLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNL 751
           L  L +     L  +   + N   LE + I  C NL+TLP+G+ NL  L+ + ++ C  L
Sbjct: 780 LTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRL 838

Query: 752 VSSPE 756
            + P+
Sbjct: 839 RTFPD 843


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 962
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.61
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.61
KOG4237498 consensus Extracellular matrix protein slit, conta 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.5
KOG0617264 consensus Ras suppressor protein (contains leucine 99.5
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.46
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.11
KOG4341483 consensus F-box protein containing LRR [General fu 99.11
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.1
KOG4341483 consensus F-box protein containing LRR [General fu 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.84
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.83
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.77
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.71
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.67
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.63
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.58
PLN03150623 hypothetical protein; Provisional 98.55
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.54
PRK15386 426 type III secretion protein GogB; Provisional 98.52
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.43
PRK15386426 type III secretion protein GogB; Provisional 98.42
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.4
PLN03150623 hypothetical protein; Provisional 98.33
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.28
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.25
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.12
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.09
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.9
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.82
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.75
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.66
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.64
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.44
KOG18591096 consensus Leucine-rich repeat proteins [General fu 97.42
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.37
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.3
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.24
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.2
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.94
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.61
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.55
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.21
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.04
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.97
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.94
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.28
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.02
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.01
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.99
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.49
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.9
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.19
smart0037026 LRR Leucine-rich repeats, outliers. 92.19
smart0037026 LRR Leucine-rich repeats, outliers. 86.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.88
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.19
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.18
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4e-41  Score=418.76  Aligned_cols=533  Identities=17%  Similarity=0.171  Sum_probs=315.8

Q ss_pred             CceeEEeeccccCCCCCCCCcccccccccCCcccEEEecCCCCc-ccCccc-cCCCcCcEEEcCCCccc-ccChhhhccC
Q 002129           59 QHLRTFLPVILSNSKPGYLAPSMLPKLLKLQSLRVFSLRGYRIL-ELPDSV-GDLRYLRYLNLSGTEIR-TLPESVSKLY  135 (962)
Q Consensus        59 ~~Lr~L~l~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~i~-~lp~~~-~~L~~L~~L~Ls~n~i~-~lp~~i~~L~  135 (962)
                      .+++.|.+.++.      +....++.+..+++|++|+|++|.++ .+|..+ ..+++||+|+|++|.++ .+|.  +.++
T Consensus        69 ~~v~~L~L~~~~------i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~  140 (968)
T PLN00113         69 SRVVSIDLSGKN------ISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIP  140 (968)
T ss_pred             CcEEEEEecCCC------ccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccC
Confidence            356666655432      12233333446777777777777765 566554 36777777777777665 3443  4566


Q ss_pred             CccEEecCCCcchhccchhhhccCCCcEEeccCCcccccccccccccccccccceeeecCCCCCCcccccccccccceeE
Q 002129          136 NLHSLLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLC  215 (962)
Q Consensus       136 ~L~~L~L~~~~~~~~lp~~i~~L~~L~~L~l~~n~~~~~lp~~~~~L~~L~~L~~~~~~~~~~~~~~~l~~L~~L~~~l~  215 (962)
                      +|++|++++|...+.+|..++.+++|++|++++|.+.+.+|..++++++|++|++..+..                    
T Consensus       141 ~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l--------------------  200 (968)
T PLN00113        141 NLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQL--------------------  200 (968)
T ss_pred             CCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCC--------------------
Confidence            777777777655556676677777777777777765556666666666666664422110                    


Q ss_pred             EecCCCCcchhhhhhhccCCCCCCCcEEEEeecCCCCchhhhhHhhhcccCCCCCCcceEEEeccCCC-CCCccccCCCC
Q 002129          216 ISNLENVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGM-KFPTWLGDSSF  294 (962)
Q Consensus       216 ~~~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~l~~~~~L~~L~l~~~~~~-~~p~~~~~~~l  294 (962)
                                ....+..+..+++|+.|++++                                 +... .+|.++.  .+
T Consensus       201 ----------~~~~p~~l~~l~~L~~L~L~~---------------------------------n~l~~~~p~~l~--~l  235 (968)
T PLN00113        201 ----------VGQIPRELGQMKSLKWIYLGY---------------------------------NNLSGEIPYEIG--GL  235 (968)
T ss_pred             ----------cCcCChHHcCcCCccEEECcC---------------------------------CccCCcCChhHh--cC
Confidence                      000111122333333333332                                 2221 3444443  35


Q ss_pred             CCceEEEEecCCCCCCCC-CCCCCCCCCeEEEcCCCCceeeCccccCCCCCCCCCCcceeeccCcccccccccCCCCccc
Q 002129          295 SKLVTLKFKNCDMCTALP-SVGQLPSLKHLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGV  373 (962)
Q Consensus       295 ~~L~~L~L~~~~~~~~l~-~l~~l~~L~~L~L~~~~~~~~i~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~  373 (962)
                      ++|++|++++|.+.+.+| .++.+++|++|++++|.....+..                                   ..
T Consensus       236 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-----------------------------------~l  280 (968)
T PLN00113        236 TSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP-----------------------------------SI  280 (968)
T ss_pred             CCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCch-----------------------------------hH
Confidence            666666666666555544 456666666666665532111100                                   02


Q ss_pred             ccCCCccEEEeccCCcccccCCCCCCCccEEEEcCcccccccCCCCCcceEEEEccCCCceeeccccCCCCCCcceeccC
Q 002129          374 ERFPKLRELRILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDT  453 (962)
Q Consensus       374 ~~~~~L~~L~l~~c~~l~~~~p~~l~~L~~L~l~~~~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~  453 (962)
                      ..+++|++|++++| .+.+.+|.                  .+..+++|+.|++.+|.....                  
T Consensus       281 ~~l~~L~~L~Ls~n-~l~~~~p~------------------~~~~l~~L~~L~l~~n~~~~~------------------  323 (968)
T PLN00113        281 FSLQKLISLDLSDN-SLSGEIPE------------------LVIQLQNLEILHLFSNNFTGK------------------  323 (968)
T ss_pred             hhccCcCEEECcCC-eeccCCCh------------------hHcCCCCCcEEECCCCccCCc------------------
Confidence            33455555555555 33334442                  122233333333333321110                  


Q ss_pred             CccccccCCCCCCCCCcceEEecccccceeecccCCccccCCCccEEEEcCCCCccccchhhhHHHHHHHHhhcceeecc
Q 002129          454 SNQVFLAGPLKPQLPKLEELILSTKEQTYIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLS  533 (962)
Q Consensus       454 ~~~~~~~~~~~~~~~~L~~L~l~~n~~~~i~~~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~~~~l~~~L~~L~ls  533 (962)
                            .......+++|+.|++++|.+.+.   .+..+..+++|+.|+++++.-...++..     +..+ ++|+.|+++
T Consensus       324 ------~~~~~~~l~~L~~L~L~~n~l~~~---~p~~l~~~~~L~~L~Ls~n~l~~~~p~~-----~~~~-~~L~~L~l~  388 (968)
T PLN00113        324 ------IPVALTSLPRLQVLQLWSNKFSGE---IPKNLGKHNNLTVLDLSTNNLTGEIPEG-----LCSS-GNLFKLILF  388 (968)
T ss_pred             ------CChhHhcCCCCCEEECcCCCCcCc---CChHHhCCCCCcEEECCCCeeEeeCChh-----HhCc-CCCCEEECc
Confidence                  000112455666667766665532   2334566788888888885333333321     2222 678888888


Q ss_pred             cccCccccCccCCCCCCccEEEecCCCCccccC-CCCCCCCCcEEEEcCCCCCCCChhhhhcCCCCCccEEEecCCCCCC
Q 002129          534 YCEGLVKLPQSSLSLSSLREIEIYGCRSLVSFP-EVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLT  612 (962)
Q Consensus       534 ~~~~l~~~~~~~~~l~~L~~L~l~~~~~l~~~~-~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~  612 (962)
                      +|.....+|..+..+++|+.|++++|+....+| .+..+++|+.|++++|...+.++...  ..+++|+.|++++|....
T Consensus       389 ~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~--~~l~~L~~L~L~~n~~~~  466 (968)
T PLN00113        389 SNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRK--WDMPSLQMLSLARNKFFG  466 (968)
T ss_pred             CCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhh--ccCCCCcEEECcCceeee
Confidence            888777788778888888888888876665555 35567788888888887555555444  567888888888876655


Q ss_pred             cccCCCCCCCCceEEecccCCCccccccccccccCCCCccccccceeEeeCCCCccccccCCCccccccccccCCCccCc
Q 002129          613 YIAGVQLPPSLKRLKICHCDNIRTLTVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSL  692 (962)
Q Consensus       613 ~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~l~~l~~~~l~~~L  692 (962)
                      .+|.....++|+.|++++|.-...++                                       ..+..+      ++|
T Consensus       467 ~~p~~~~~~~L~~L~ls~n~l~~~~~---------------------------------------~~~~~l------~~L  501 (968)
T PLN00113        467 GLPDSFGSKRLENLDLSRNQFSGAVP---------------------------------------RKLGSL------SEL  501 (968)
T ss_pred             ecCcccccccceEEECcCCccCCccC---------------------------------------hhhhhh------hcc
Confidence            55544334556666666553221111                                       111111      678


Q ss_pred             cEEEecCCCCchhhhhhccCCCCcceEeecCCccccccCccccCCCCccEEEcccCCCcccCCCCCCCcccccccccccc
Q 002129          693 KLLLVWGCSKLESIAEMLDNNTSLEKINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNC  772 (962)
Q Consensus       693 ~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~L~~~~~l~~~~~~~~~~~~L~~L~l~~c  772 (962)
                      ++|++++|...+.+|..+.++++|++|++++|...+.+|..+.++++|++|++++|...+.+|.....+++|+.|++++|
T Consensus       502 ~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N  581 (968)
T PLN00113        502 MQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHN  581 (968)
T ss_pred             CEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCC
Confidence            88888888888888888888888888888888888888888888888888888888777778877777778888888888


Q ss_pred             cccccCccccCCCcccceeecCCCCCC
Q 002129          773 KRLEALPKGLHNLKSLQELRIGKGVAL  799 (962)
Q Consensus       773 ~~l~~~~~~~~~l~~L~~L~l~~~~~l  799 (962)
                      +..+.+|.. +.+..+....+.+|+.+
T Consensus       582 ~l~~~~p~~-~~~~~~~~~~~~~n~~l  607 (968)
T PLN00113        582 HLHGSLPST-GAFLAINASAVAGNIDL  607 (968)
T ss_pred             cceeeCCCc-chhcccChhhhcCCccc
Confidence            877777753 33444555555666544



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query962
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-12
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
4fdw_A401 Leucine rich hypothetical protein; putative cell s 4e-06
4fdw_A401 Leucine rich hypothetical protein; putative cell s 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 89.2 bits (222), Expect = 3e-19
 Identities = 28/109 (25%), Positives = 45/109 (41%)

Query: 80  SMLPKLLKLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHS 139
               +   L +L+   L    I  LP S+ +L+ L+ L +  + +  L  ++  L  L  
Sbjct: 174 DASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEE 233

Query: 140 LLLEDCDRLEKLCADMGNLVKLHHLKNSNTKSLEEMPVGIGRLTCLQTL 188
           L L  C  L       G    L  L   +  +L  +P+ I RLT L+ L
Sbjct: 234 LDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKL 282


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query962
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.66
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.62
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.61
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.56
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.52
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.51
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.48
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.46
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.44
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.44
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.43
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.43
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.42
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.42
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.41
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.41
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.41
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.41
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.4
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.38
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.36
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.32
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.31
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.29
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.27
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.22
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.21
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.18
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.15
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.13
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.03
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.01
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.79
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.77
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.61
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.58
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.21
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.04
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.0
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.92
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.84
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.7
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.48
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-52  Score=504.41  Aligned_cols=679  Identities=17%  Similarity=0.078  Sum_probs=378.2

Q ss_pred             CcccEEEecCCCCc-c---cCccccCCCcCcEEEcCCCcccccChhhhccCCccEEecCCCcchhccch--hhhccCCCc
Q 002129           89 QSLRVFSLRGYRIL-E---LPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCA--DMGNLVKLH  162 (962)
Q Consensus        89 ~~L~~L~L~~~~i~-~---lp~~~~~L~~L~~L~Ls~n~i~~lp~~i~~L~~L~~L~L~~~~~~~~lp~--~i~~L~~L~  162 (962)
                      .+++.|+|+++.+. .   +|+++.++++|++++++.+.+..+|+.|+++++|++|+|++|...+.+|.  .++++++|+
T Consensus        50 ~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~  129 (768)
T 3rgz_A           50 DKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLK  129 (768)
T ss_dssp             TEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCC
T ss_pred             CcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCC
Confidence            45666666666655 2   56666666666666666666666666666666666666666555555665  666666666


Q ss_pred             EEeccCCcccccccccc-cccccccccceeeecCCCCCCcccccccccccceeEEecCCCCcchhhhhhhccCCCCCCCc
Q 002129          163 HLKNSNTKSLEEMPVGI-GRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLENVKHIVDAEDAQLDRKENLKE  241 (962)
Q Consensus       163 ~L~l~~n~~~~~lp~~~-~~L~~L~~L~~~~~~~~~~~~~~~l~~L~~L~~~l~~~~l~~~~~~~~~~~~~l~~~~~L~~  241 (962)
                      +|++++|.+.+.+|..+ +++++|++|++..+...                           .........+.++++|++
T Consensus       130 ~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~---------------------------~~~~~~~~~~~~l~~L~~  182 (768)
T 3rgz_A          130 FLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSIS---------------------------GANVVGWVLSDGCGELKH  182 (768)
T ss_dssp             EEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCE---------------------------EETHHHHHHTTCCTTCCE
T ss_pred             EEECcCCccCCcCCHHHhccCCCCCEEECCCCccC---------------------------CcCChhhhhhccCCCCCE
Confidence            66666666444444443 55566665543221100                           000000011344455555


Q ss_pred             EEEEeecCCCCchhhhhHhhhcccCCCCCCcceEEEeccCCCCCCccccCCCCCCceEEEEecCCCCCCCCCCCCCCCCC
Q 002129          242 LWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGYGGMKFPTWLGDSSFSKLVTLKFKNCDMCTALPSVGQLPSLK  321 (962)
Q Consensus       242 L~l~~~~~~~~~~~~~~~~~~l~~l~~~~~L~~L~l~~~~~~~~p~~~~~~~l~~L~~L~L~~~~~~~~l~~l~~l~~L~  321 (962)
                      |++++|.                                 .......   ..+++|++|++++|.+.+.+|.++.+++|+
T Consensus       183 L~Ls~n~---------------------------------l~~~~~~---~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~  226 (768)
T 3rgz_A          183 LAISGNK---------------------------------ISGDVDV---SRCVNLEFLDVSSNNFSTGIPFLGDCSALQ  226 (768)
T ss_dssp             EECCSSE---------------------------------EESCCBC---TTCTTCCEEECCSSCCCSCCCBCTTCCSCC
T ss_pred             EECCCCc---------------------------------ccccCCc---ccCCcCCEEECcCCcCCCCCcccccCCCCC
Confidence            5554443                                 1111111   135555666666655555555555566666


Q ss_pred             eEEEcCCCCceeeCccccCCCCCCCCCCcceeeccCcccccccccCCCCcccccCCCccEEEeccCCcccccCCCCCCCc
Q 002129          322 HLTVRGMSKVKRLGSEFYGDDSPIPFPRLETLRFEDLQEWEDSIPHGSSQGVERFPKLRELRILRCSKLKGTFPEHLPAL  401 (962)
Q Consensus       322 ~L~L~~~~~~~~i~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~p~~l~~L  401 (962)
                      +|++++|.....+...+      ..+++|+.|++.++. +.+..+      ...+++|++|++++| .+++.+|..+   
T Consensus       227 ~L~Ls~n~l~~~~~~~l------~~l~~L~~L~Ls~n~-l~~~~~------~~~l~~L~~L~L~~n-~l~~~ip~~~---  289 (768)
T 3rgz_A          227 HLDISGNKLSGDFSRAI------STCTELKLLNISSNQ-FVGPIP------PLPLKSLQYLSLAEN-KFTGEIPDFL---  289 (768)
T ss_dssp             EEECCSSCCCSCHHHHT------TTCSSCCEEECCSSC-CEESCC------CCCCTTCCEEECCSS-EEEESCCCCS---
T ss_pred             EEECcCCcCCCcccHHH------hcCCCCCEEECCCCc-ccCccC------ccccCCCCEEECcCC-ccCCccCHHH---
Confidence            66665554322222111      114445555554432 222111      124566666666666 4544555321   


Q ss_pred             cEEEEcCcccccccCCCCCcceEEEEccCCCceeeccccCCCCCCcceeccCCccccccCCCCCCCCCcceEEecccccc
Q 002129          402 EMLVIEGCEELLVSVSSLPALCKFIISGCKKVVWESATGHLGSQNSVVCRDTSNQVFLAGPLKPQLPKLEELILSTKEQT  481 (962)
Q Consensus       402 ~~L~l~~~~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~  481 (962)
                                    ...+++|++|++++|.....                        ....+..+++|++|++++|.+.
T Consensus       290 --------------~~~~~~L~~L~Ls~n~l~~~------------------------~p~~~~~l~~L~~L~L~~n~l~  331 (768)
T 3rgz_A          290 --------------SGACDTLTGLDLSGNHFYGA------------------------VPPFFGSCSLLESLALSSNNFS  331 (768)
T ss_dssp             --------------CTTCTTCSEEECCSSEEEEC------------------------CCGGGGGCTTCCEEECCSSEEE
T ss_pred             --------------HhhcCcCCEEECcCCcCCCc------------------------cchHHhcCCCccEEECCCCccc
Confidence                          01123333333333331110                        0001123455666666665554


Q ss_pred             eeecccCCccccCCCccEEEEcCCCCccccchhhhHHHHHHHHhhcceeecccccCccccCccCCC--CCCccEEEecCC
Q 002129          482 YIWKSHDGLLQDVCSLKSLEIRSCPKLQSLVAEEEKDQQQQLYELLEYLRLSYCEGLVKLPQSSLS--LSSLREIEIYGC  559 (962)
Q Consensus       482 ~i~~~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~~~~l~~~L~~L~ls~~~~l~~~~~~~~~--l~~L~~L~l~~~  559 (962)
                      +.  .+...+..+++|++|++++|.-...++..     +..+.++|+.|++++|...+.+|..+..  +++|++|++++|
T Consensus       332 ~~--ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~-----l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n  404 (768)
T 3rgz_A          332 GE--LPMDTLLKMRGLKVLDLSFNEFSGELPES-----LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN  404 (768)
T ss_dssp             EE--CCHHHHTTCTTCCEEECCSSEEEECCCTT-----HHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSS
T ss_pred             Cc--CCHHHHhcCCCCCEEeCcCCccCccccHH-----HHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCC
Confidence            21  12223455666666666664322233332     3334237777777777766666665555  667777777776


Q ss_pred             CCccccC-CCCCCCCCcEEEEcCCCCCCCChhhhhcCCCCCccEEEecCCCCCCcccCC-CCCCCCceEEecccCCCccc
Q 002129          560 RSLVSFP-EVALPSKLKKIEISSCDALKSLPEAWMCDTNSSLEILEISGCDSLTYIAGV-QLPPSLKRLKICHCDNIRTL  637 (962)
Q Consensus       560 ~~l~~~~-~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~-~~~~~L~~L~l~~~~~l~~l  637 (962)
                      .....+| .+..+++|++|++++|...+.+|..+  ..+++|++|++++|.....+|.. ..+++|+.|++++|.-...+
T Consensus       405 ~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l--~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~  482 (768)
T 3rgz_A          405 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL--GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEI  482 (768)
T ss_dssp             EEEEECCGGGGGCTTCCEEECCSSEEESCCCGGG--GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCC
T ss_pred             ccccccCHHHhcCCCCCEEECcCCcccCcccHHH--hcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcC
Confidence            6555555 35556777777777776555555554  56677777777776544444432 33455666666555322222


Q ss_pred             cccccccccCCCCccccccceeEeeCCCCccccccCCCccccccccccCCCccCccEEEecCCCCchhhhhhccCCCCcc
Q 002129          638 TVEEGIQCSSGRRYTSSLLEHLEIYSCPSLTCIFSKNELPATLESLEVGNLPPSLKLLLVWGCSKLESIAEMLDNNTSLE  717 (962)
Q Consensus       638 ~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~l~~l~~~~l~~~L~~L~l~~~~~~~~~~~~~~~l~~L~  717 (962)
                      +                                       ..+..+      ++|++|++++|.+.+.+|..++.+++|+
T Consensus       483 p---------------------------------------~~l~~l------~~L~~L~L~~N~l~~~~p~~~~~l~~L~  517 (768)
T 3rgz_A          483 P---------------------------------------SGLSNC------TNLNWISLSNNRLTGEIPKWIGRLENLA  517 (768)
T ss_dssp             C---------------------------------------GGGGGC------TTCCEEECCSSCCCSCCCGGGGGCTTCC
T ss_pred             C---------------------------------------HHHhcC------CCCCEEEccCCccCCcCChHHhcCCCCC
Confidence            2                                       111111      5677777777777777777777777777


Q ss_pred             eEeecCCccccccCccccCCCCccEEEcccCCCcccCCCCCCCcccccccccccccc----------------------c
Q 002129          718 KINISGCGNLQTLPSGLHNLCQLQEISIASCGNLVSSPEGGLPCAKLAMLAIYNCKR----------------------L  775 (962)
Q Consensus       718 ~L~l~~~~~~~~~~~~l~~l~~L~~L~L~~~~~l~~~~~~~~~~~~L~~L~l~~c~~----------------------l  775 (962)
                      +|++++|.+.+.+|..+.++++|+.|++++|+..+.+|...+....+..+.+..+..                      .
T Consensus       518 ~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  597 (768)
T 3rgz_A          518 ILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQ  597 (768)
T ss_dssp             EEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECT
T ss_pred             EEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccc
Confidence            777777777777777777777777777777766666666555544444443332110                      1


Q ss_pred             ccCccccCCCcccceeecCCCCCCCCCCC-CCCCCccceEeecCchhhhHHHHhccccccccCccceeecccCCCCCccC
Q 002129          776 EALPKGLHNLKSLQELRIGKGVALPSLEE-DGLPTNLHVLLINGNMEIWKSMIERGRGFHRFSSLRQLTIMNCDDDMVSF  854 (962)
Q Consensus       776 ~~~~~~~~~l~~L~~L~l~~~~~l~~~~~-~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~  854 (962)
                      +..+..+..++.++.+++..+..-..+|. .+.+++|++|++++|.+....+    ..++.+++|+.|++++|. ....+
T Consensus       598 ~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip----~~l~~l~~L~~L~Ls~N~-l~g~i  672 (768)
T 3rgz_A          598 GIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP----KEIGSMPYLFILNLGHND-ISGSI  672 (768)
T ss_dssp             TCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCC----GGGGGCTTCCEEECCSSC-CCSCC
T ss_pred             cccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCC----HHHhccccCCEEeCcCCc-cCCCC
Confidence            12222334444555555554432222332 2456778888888888776555    468889999999999963 44466


Q ss_pred             CCCCCCCCCCccccCCCccceEeeccCCCCcccccccccCCCcCeEeccCCCCCccCCCCCCccccceeeccCChhhH--
Q 002129          855 PPKADDKGSGTVLPLPASLTYLRIEGFPNLERLTSSIVDLQNLTGLVLGNCPKLKYFPEKGLPSSLLQLSINRCPLIE--  932 (962)
Q Consensus       855 ~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~sL~~L~i~~c~~l~--  932 (962)
                      |...         ..+++|++|+|+++.--..+|..+.++++|++|++++|+--..+|..+...++....+.+||.+.  
T Consensus       673 p~~l---------~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~  743 (768)
T 3rgz_A          673 PDEV---------GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGY  743 (768)
T ss_dssp             CGGG---------GGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEEST
T ss_pred             ChHH---------hCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCC
Confidence            6544         57899999999996555589999999999999999998766788887777788888888887543  


Q ss_pred             --HhhccccCCcccccCcccEEE
Q 002129          933 --EKCRKDGGQYWDLLTHIPRVE  953 (962)
Q Consensus       933 --~~~~~~~~~~~~~i~~~~~~~  953 (962)
                        ..|....+++|++|+|+|.++
T Consensus       744 ~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          744 PLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             TSCCCCSCC--------------
T ss_pred             CCcCCCCCccCCCCCCCCccccC
Confidence              268888899999999999864



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 962
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.0 bits (97), Expect = 2e-04
 Identities = 32/230 (13%), Positives = 68/230 (29%), Gaps = 12/230 (5%)

Query: 104 LPDSVGDL--RYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCD-RLEKLCADMGNLVK 160
            PD  G L  + +       + +          + +  + L +    +  L   +    K
Sbjct: 13  HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSK 72

Query: 161 LHHLKNSNTKSLEEMPVGIGRLTCLQTLCSFVVGKDSGSGLRELKLLTQLRGTLCISNLE 220
           L +L     +  + +   + + + L  L        S   L+          + C    E
Sbjct: 73  LQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQT-------LLSSCSRLDE 125

Query: 221 NVKHIVDAEDAQLDRKENLKELWLRWTLYGSYSREAETEMGVLDMLKPHTNLEQFCIKGY 280
                      +  +            L  S  R+   +  +  +++   NL    +   
Sbjct: 126 LNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS 185

Query: 281 GGMKFPTWLGDSSFSKLVTLKFKNCDMCT--ALPSVGQLPSLKHLTVRGM 328
             +K   +      + L  L    C       L  +G++P+LK L V G+
Sbjct: 186 VMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI 235


>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query962
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.65
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.47
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.45
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.31
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.27
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.2
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.16
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.01
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.0
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.89
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.87
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.43
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.88
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.71
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.54
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.4
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.25
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.84  E-value=1.1e-19  Score=198.97  Aligned_cols=85  Identities=19%  Similarity=0.354  Sum_probs=72.7

Q ss_pred             cCCcccEEEecCCCCcccCccccCCCcCcEEEcCCCcccccChhhhccCCccEEecCCCcchhccchhhhccCCCcEEec
Q 002129           87 KLQSLRVFSLRGYRILELPDSVGDLRYLRYLNLSGTEIRTLPESVSKLYNLHSLLLEDCDRLEKLCADMGNLVKLHHLKN  166 (962)
Q Consensus        87 ~l~~L~~L~L~~~~i~~lp~~~~~L~~L~~L~Ls~n~i~~lp~~i~~L~~L~~L~L~~~~~~~~lp~~i~~L~~L~~L~l  166 (962)
                      .+.+|++|++++++|+.+ ++++.+++|++|+|++|+|+++|. ++++++|++|++++| .+..++ .++.+++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n-~i~~i~-~l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNN-QIADIT-PLANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSS-CCCCCG-GGTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccc-cccccc-ccccccccccccc
Confidence            677899999999999988 578899999999999999999975 999999999999996 455555 4889999999999


Q ss_pred             cCCccccccc
Q 002129          167 SNTKSLEEMP  176 (962)
Q Consensus       167 ~~n~~~~~lp  176 (962)
                      +++. ...++
T Consensus       118 ~~~~-~~~~~  126 (384)
T d2omza2         118 FNNQ-ITDID  126 (384)
T ss_dssp             CSSC-CCCCG
T ss_pred             cccc-ccccc
Confidence            9887 54444



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure