Citrus Sinensis ID: 002169

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------
MMVFLNQTPFFVQAGNSDLSYHRDCSQIYPFFQVLKNEVRLSSSLSYTMGCPLSGRTVFVYTIQSQFLTGLVNGSNKPYNGEANHFSVCTCQELHLELVPLRSRLKMNGAAFSKMKVSAERSRDQLGNGIDSSPKTPMYQPRLSSQSVNQLASPVSEDSVSKSLNWNSLNVDAFDIKEVLEDESAIKLLQTCAASWLYSRSLLCGNLVAVPMLSEISIFLVIGANKLPADLTNERSQPQVTESMDHESNAFVINHETKVYLYPPLNAVSKSLREGTLPNAQIEFQNVQATVEQDISKLGGLSKEYAILKDIIISSSVKSTLSSLGLRPTKGVLLHGPPGTGKTSLARLCAHDSGVNLFTVNGPEVVSQNYGESEQALHEVFDSASQSAPAVVFIDELDAIAPARKDGGEELSQRMVATLLNLMDGVCRTDGVLVIAATNRPDSIEPALRRPGRLDREIEIAVPSPAQRLEILHALLSGMEHSLLDSEVEYLSMATHGFVGADLAALCNEAALVCLRRYSKIQTSSDVLHSTGTLFEFEGHSDTMLQDSDCSRNITESSRDCLDSASPCTSDLPTSLLSSSLPLRGTVSEIADNFHNGVSDSSGGMFMSEKGCALKLELVDFEKARMKVRPSAMREVILEVPKVKWEDVGGQREVKTQLMEAVEWPQKHQEAFKRIGTRPPTGILMFGPPGCSKTLMARAVASEAGLNFLAVKGPELFSKWVGESEKAVRSLFAKARANAPSIIFFDEIDGLAAIRGKESDGVSVSDRVMSQLLVELDGLHQRVNVTVIAATNRPDKIDPALLRPGRFDRLLYVGPPNETDREEIFRIHLRKIPCSSDVNIRELACLSEGCTGADISLICREAAISAIEENLDASRITMQHLKTAIRHVQPSEIHSYKELSAKFQRLVHSNAEADESGYQLRPSKSIGSNMWTLIKSISLFLCRFPAGLSQSESGSSG
cccccccccccccccccccccccCEEEccccccccccccEEcccccccccccccccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHcccccccccEEEEcccccEEEEEEEccccccccccccccccccccccccccccCECcccccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHcccCEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccEEEEEccccHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccHHHHHHHHHHccccccccEEECcccccccccccHHHHHHHHHHHHHHHHHcHHHHHHcccccccccEEEccccccHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHcccccccccccccccccccccHHHcccccccccccccccc
*MVFLNQTPFFVQAGNSDLSYHRDCSQIYPFFQVLKNEVRLSSSLSYTMGCPLSGRTVFVYTIQSQFLTGLVNGSNKPYNGEANHFSVCTCQELHLELVPLRSR***********************************************************LN***LNVDAFDIKEVLEDESAIKLLQTCAASWLYSRSLLCGNLVAVPMLSEISIFLVIGANKL**********************AFVINHETKVYLYPPLNAVSKSLREGTLPNAQIEFQNVQATVEQDISKLGGLSKEYAILKDIIISSSVKSTLSSLGLRPTKGVLLHGPPGTGKTSLARLCAHDSGVNLFTVNGPEVVSQNYGESEQALHEVFDSASQSAPAVVFIDELDAIAP*********SQRMVATLLNLMDGVCRTDGVLVIAATNRPDSIEPALRRPGRLDREIEIAVPSPAQRLEILHALLSGMEHSLLDSEVEYLSMATHGFVGADLAALCNEAALVCLRRYSKIQTSSDVLHSTGTLFEFE****************TESSRDCLDSASPCTSDLPTSLLSSSLPLRGTVSEIADNFHNGVSDSSGGMFMSEKGCALKLELVDFEKARMKVRPSAMREVILEVPKVKWEDVGGQREVKTQLMEAVEWPQKHQEAFKRIGTRPPTGILMFGPPGCSKTLMARAVASEAGLNFLAVKGPELFSKWVGESEKAVRSLFAKARANAPSIIFFDEIDGLAAIR******VSVSDRVMSQLLVELDGLHQRVNVTVIAATNRPDKIDPALLRPGRFDRLLYVGPPNETDREEIFRIHLRKIPCSSDVNIRELACLSEGCTGADISLICREAAISAIEENLDASRITMQHLKTAIRHVQPSEIHSYK*LSAKFQRLVHS************PSKSIGSNMWTLIKSISLFLCRFPA***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVFLNQTPFFVQAGNSDLSYHRDCSQIYPFFQVLKNEVRLSSSLSYTMGCPLSGRTVFVYTIQSQFLTGLVNGSNKPYNGEANHFSVCTCQELHLELVPLRSRLKMNGAAFSKMKVSAERSRDQLGNGIDSSPKTPMYQPRLSSQSVNQLASPVSEDSVSKSLNWNSLNVDAFDIKEVLEDESAIKLLQTCAASWLYSRSLLCGNLVAVPMLSEISIFLVIGANKLPADLTNERSQPQVTESMDHESNAFVINHETKVYLYPPLNAVSKSLREGTLPNAQIEFQNVQATVEQDISKLGGLSKEYAILKDIIISSSVKSTLSSLGLRPTKGVLLHGPPGTGKTSLARLCAHDSGVNLFTVNGPEVVSQNYGESEQALHEVFDSASQSAPAVVFIDELDAIAPARKDGGEELSQRMVATLLNLMDGVCRTDGVLVIAATNRPDSIEPALRRPGRLDREIEIAVPSPAQRLEILHALLSGMEHSLLDSEVEYLSMATHGFVGADLAALCNEAALVCLRRYSKIQTSSDVLHSTGTLFEFEGHSDTMLQDSDCSRNITESSRDCLDSASPCTSDLPTSLLSSSLPLRGTVSEIADNFHNGVSDSSGGMFMSEKGCALKLELVDFEKARMKVRPSAMREVILEVPKVKWEDVGGQREVKTQLMEAVEWPQKHQEAFKRIGTRPPTGILMFGPPGCSKTLMARAVASEAGLNFLAVKGPELFSKWVGESEKAVRSLFAKARANAPSIIFFDEIDGLAAIRGKESDGVSVSDRVMSQLLVELDGLHQRVNVTVIAATNRPDKIDPALLRPGRFDRLLYVGPPNETDREEIFRIHLRKIPCSSDVNIRELACLSEGCTGADISLICREAAISAIEENLDASRITMQHLKTAIRHVQPSEIHSYKELSAKFQRLVHSNAEADESGYQLRPSKSIGSNMWTLIKSISLFLCRFPAGLSQSESGSSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calmodulin-interacting protein 111 probableQ9LET7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 640-891
View the alignment between query and template
View the model in PyMOL
Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 193-227,249-267,279-527,605-638
View the alignment between query and template
View the model in PyMOL
Template: 3CF2, chain A
Confidence level:very confident
Coverage over the Query: 188-227,249-272,286-527,605-751,765-837,854-885
View the alignment between query and template
View the model in PyMOL
Template: 3CF2, chain A
Confidence level:very confident
Coverage over the Query: 639-921,934-951
View the alignment between query and template
View the model in PyMOL
Template: 1QVR, chain A
Confidence level:confident
Coverage over the Query: 292-314,327-397,420-527,551-719,730-751,765-870
View the alignment between query and template
View the model in PyMOL