Citrus Sinensis ID: 002199


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950----
MESQKVKASEAGFDGNGGFSCCEGYGEGIFVFGGGKKKSSCSDDCGILNCSNDVKLDSKSFGNADNIGKAENGNLDFDVNKKSNIASESCSSNVLGSASTTDPEFKLPGEMQKLNINEDENDDSTETKNESNKNSCSNADTIFVFSGGIKPSSSSDGSSGRADEHILGHTAAVDQMARDNFGNCNSDQNYQSFMSQAGLPKSSKVNSETQNNVATGRASLSSDSFESQQNDNVSEMPSMVGAQKDESSPTNTQHELGMSFTEFVIPNWDPSCFKASLYTEPNKKLEFSVKSKSIKDKRSKKTGGKSKQPSLKQGQKQRGSGNAVASAEHADGMNTDSHESGKYCFASEVDGCKYFTFSSLSSADGGLTLRKCKLRKKSKKKVGNNSFVISPSPNDKVSFSHQASSSLCKTVNGEEENKYEDKVQNKFEAAEEVKQRTVSPTAAFQETCEMWRLRGNQAYKNNNLTEAEDFYTQGINSVPLSETAGCCIKPLVLCYSNRAATRISLGRMREALEDCMMAATVDPNFLKVYMRAAKCHLVLGEIENAQHYYHKLLNSAAAVCLDRRITIEAADGLQKAQKVTEYINCSGKLLEQKTSEAASSALERINEALSISSCSEKLLEMKADALYMLRKYEEAIQLCEHTLPVAEKNFASVLADNGSVTYSLARLWRWRLISKSYFCIGKLEVALDLLQKLEQVGSISDRYGSEILESSMSLAGTVRALLHHKSAGNEAFKSGRYTEAVEHYTVALSTNIESRPFAAICFCNRAAALQALGQIADAIADCSLAMALDENYTKAVSRRAALHEMIRDYTQAASDLQRLVSILENQSAEKAKQSRSPGRTISSRDLRQACRHLSSMEEDAKKGEPLDFYLILGVKASDTAADIKKAYRKAALKHHPDKRSEYDQEQEIRKATKESPQNSHYGRSSDAYGYACRSSRRQSRQDNWKTYGNSYSRW
cccccHHHccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccHHccccccHHHHHHHHHccccccccccccccHHHccccccHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccHcccccHHccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHccccccccccccHHHcccccccccccccccc
************************YGEGIFVFGG***********GILNC*******************************************************KLPGEMQKL**************************TIFVF***************************************************************************************************************GMSFTEFVIPNWDPSCFKASLYT**************************************************ADGMNTDSHESGKYCFASEVDGCKYFTFSSLS*********************************************************************************AFQETCEMWRLRGNQAYKNNNLTEAEDFYTQGINSVPLSETAGCCIKPLVLCYSNRAATRISLGRMREALEDCMMAATVDPNFLKVYMRAAKCHLVLGEIENAQHYYHKLLNSAAAVCLDRRITIEAADGLQKAQKVTEYINCSGKLLEQKTSEAASSALERINEALSISSCSEKLLEMKADALYMLRKYEEAIQLCEHTLPVAEKNFASVLADNGSVTYSLARLWRWRLISKSYFCIGKLEVALDLLQKLEQVGSISDRYGSEILESSMSLAGTVRALLHHKSAGNEAFKSGRYTEAVEHYTVALSTNIESRPFAAICFCNRAAALQALGQIADAIADCSLAMALDENYTKAVSRRAALHEMIRDYTQAASDLQRLVSILENQ*************************************EPLDFYLILGVKASDTAADIKKAYRKAALKHHPDKRSEY***Q***KATKESPQNSHYGRSSDAY**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESQKVKASEAGFDGNGGFSCCEGYGEGIFVFGGGKKKSSCSDDCGILNCSNDVKLDSKSFGNADNIGKAENGNLDFDVNKKSNIASESCSSNVLGSASTTDPEFKLPGEMQKLNINEDENDDSTETKNESNKNSCSNADTIFVFSGGIKPSSSSDGSSGRADEHILGHTAAVDQMARDNFGNCNSDQNYQSFMSQAGLPKSSKVNSETQNNVATGRASLSSDSFESQQNDNVSEMPSMVGAQKDESSPTNTQHELGMSFTEFVIPNWDPSCFKASLYTEPNKKLEFSVKSKSIKDKRSKKTGGKSKQPSLKQGQKQRGSGNAVASAEHADGMNTDSHESGKYCFASEVDGCKYFTFSSLSSADGGLTLRKCKLRKKSKKKVGNNSFVISPSPNDKVSFSHQASSSLCKTVNGEExxxxxxxxxxxxxxxxxxxxxTVSPTAAFQETCEMWRLRGNQAYKNNNLTEAEDFYTQGINSVPLSETAGCCIKPLVLCYSNRAATRISLGRMREALEDCMMAATVDPNFLKVYMRAAKCHLVLGEIENAQHYYHKLLNSAAAVCLDRRITIEAADGLQKAQKVTEYINCSGKLLEQKTSEAASSALERINEALSISSCSEKLLEMKADALYMLRKYEEAIQLCEHTLPVAEKNFASVLADNGSVTYSLARLWRWRLISKSYFCIGKLEVALDLLQKLEQVGSISDRYGSEILESSMSLAGTVRALLHHKSAGNEAFKSGRYTEAVEHYTVALSTNIESRPFAAICFCNRAAALQALGQIADAIADCSLAMALDENYTKAVSRRAALHEMxxxxxxxxxxxxxxxxxxxxxSAEKAKQSRSPGRTISSRDLRQACRHLSSMEEDAKKGEPLDFYLILGVKASDTAADIKKAYRKAALKHHPDKRSEYDQEQEIRKATKESPQNSHYGRSSDAYGYACRSSRRQSRQDNWKTYGNSYSRW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 444-482,493-559,579-651,669-702,723-823,837-854
View the alignment between query and template
View the model in PyMOL
Template: 2GW1, chain A
Confidence level:very confident
Coverage over the Query: 448-482,493-562,575-651,669-828
View the alignment between query and template
View the model in PyMOL
Template: 2XPI, chain A
Confidence level:very confident
Coverage over the Query: 449-482,493-651,669-701,722-859
View the alignment between query and template
View the model in PyMOL
Template: 2Y4T, chain A
Confidence level:very confident
Coverage over the Query: 445-482,493-651,669-823,837-922
View the alignment between query and template
View the model in PyMOL
Template: 2Y4T, chain A
Confidence level:very confident
Coverage over the Query: 422-482,493-559,579-703,720-826
View the alignment between query and template
View the model in PyMOL
Template: 2CTQ, chain A
Confidence level:confident
Coverage over the Query: 863-949
View the alignment between query and template
View the model in PyMOL
Template: 3UGM, chain A
Confidence level:probable
Coverage over the Query: 424-484,495-721,735-818
View the alignment between query and template
View the model in PyMOL