Citrus Sinensis ID: 002284


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940---
MHDLVNDLAQWAAGEMYFRMEYISEVNKQQSFSRNLHHLSYIRGDYDGVKRFEDLYDIQHLRTLLPVTLLSSRPGYLARSILPRLLKLQRLRVFSLRGYLISEVPDSIGDLSYLRYLNLSGTQIRTLPESVNKLYNLHTLLLEGCRELKKKCADMGNLIKLHHLNNSNTDSLEEMPLGIGKLTCLLTLCNFVVGKDSGSGLRELKLLTHLCGTLNISKLENVKYVGDAMEAQLDGKKNLKVLMLEWTRSTNGLSSREAQTEKGVLDMLKPHRSLEQFCISGFGGKKFPTWLGYSLFSNLVTLKFQDCSMCTSMPSVGQLPSLKHLEVRGMSRVKRLGSEFYGNDSPIPFPCLETLHFAEMQEWEEWIPHGCSQEIEGFPKLRELHIVRCSKLQGTLPTHLTLLDILVVQNFTSLPALCKLRIDRCKKVVWRSTTDCESQLYKDISNQMFLGGPLKLQLPKLDELDISIIIDGLSYIWQNETQLLQDIATLKRLKIERCPKLQFLEEEDQWQFGLSFRLEHLELINCQDLEKLPKSLLSLSSLTEMRIHNCSSLVSFPEAVLPSQLRVISIWDSGALKFLPEAWMLDNNSSLEILDIRHCHLLTYIAGVQLPPSLKQLEIYNCDNLRTLTAEEGIHSSRRHTSLLECLEIHSCPSLTCLISKNELRAALDYLVVGNLPQALKFLSIWHCSKLESIVERLDNKISLEVIEIVSCENLKMLPHGLHKLWHLQEIDIQDCENLVSFPEGGLLSAKLKRLVIYGCKKLEALPEGMHNLSSLQYLTIGGVPSLLCFTEDGLFPTNLHSLEIDGMKIWKSLMQLGGFHRYTSLRRLAISGCDEDMVSFPLEDIRLGTTLPACLTQLEIFNFPNLERLSSSICDQNLTSLKLTNCPKLKYFPEKGLPASLLRLEIKKCPLIEKMCRQDIGPYWHLLIHIPCVLIECSCTVN
ccHHHHHHHHHHHHccEEEEEccccccccccccccEEEEEEECcccccccccccccccccccEEEccccccccccccHHHHHHHHHccccEEEEEEcccccccccccccccccccEEEccccccccccccHHccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHcccccccccEEEEccccccccccHHHHccccccccccEEEEEEEcccccccccccccHHHHHcccccccccccEEEECcccccccccccccccccCEEEEECccccccccccccccccccEEEEccccccEECcccccccccccccccccEEEEcccccccccccccccccccccccccEEEEcccccccccccccccccEEEEEEcccccccccEEEEcccccEEEcccccccccccccccccccccccccccccccccccCEEEccccccccccHHHHccccccccEEEEECcccccccccHHHHcccccccccEEEECcccccccccccccccccccEEEECccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccEEEECcccccccccHHccccccccccccccCEEECccccccccccccHHHHHHHHHHcccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEECcccccCCccccccccccccEEEEEcccccccccccccccccccEEEECcccccccccccccccccccEEEEEcccccccccccccccccccccEEEECcccccccccccccccccccccccccEEEECccccccccccccccccccEEEECccccccccccccccccccEEEECccHHHHHccccccccccccccccccEEEccEEEEc
MHDLVNDLAQWAAGEMYFRMEYISEVNKQQSFSRNLHHLSYIRGDYDGVKRFEDLYDIQHLRTLLPVTLLSSRPGYLARSILPRLLKLQRLRVFSLRGYLISEVPDSIGDLSYLRYLNLSGTQIRTLPESVNKLYNLHTLLLEGCRELKKKCADMGNLIKLHHLNNSNTDSLEEMPLGIGKLTCLLTLCNFVVGKDSGSGLRELKLLTHLCGTLNISKLENVKYVGDAMEAQLDGKKNLKVLMLEWTRSTNG*****AQTEKGVLDMLKPHRSLEQFCISGFGGKKFPTWLGYSLFSNLVTLKFQDCSMCTSMPSVGQLPSLKHLEVRGMSRVKRLGSEFYGNDSPIPFPCLETLHFAEMQEWEEWIPHGCSQEIEGFPKLRELHIVRCSKLQGTLPTHLTLLDILVVQNFTSLPALCKLRIDRCKKVVWRSTTDCESQLYKDISNQMFLGGPLKLQLPKLDELDISIIIDGLSYIWQNETQLLQDIATLKRLKIERCPKLQFLEEEDQWQFGLSFRLEHLELINCQDLEKLPKSLLSLSSLTEMRIHNCSSLVSFPEAVLPSQLRVISIWDSGALKFLPEAWMLDNNSSLEILDIRHCHLLTYIAGVQLPPSLKQLEIYNCDNLRTLTAEEGIHSSRRHTSLLECLEIHSCPSLTCLISKNELRAALDYLVVGNLPQALKFLSIWHCSKLESIVERLDNKISLEVIEIVSCENLKMLPHGLHKLWHLQEIDIQDCENLVSFPEGGLLSAKLKRLVIYGCKKLEALPEGMHNLSSLQYLTIGGVPSLLCFTEDGLFPTNLHSLEIDGMKIWKSLMQLGGFHRYTSLRRLAISGCDEDMVSFPLEDIRLGTTLPACLTQLEIFNFPNLERLSSSICDQNLTSLKLTNCPKLKYFPEKGLPASLLRLEIKKCPLIEKMCRQDIGPYWHLLIHIPCVLIECSCTVN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDLVNDLAQWAAGEMYFRMEYISEVNKQQSFSRNLHHLSYIRGDYDGVKRFEDLYDIQHLRTLLPVTLLSSRPGYLARSILPRLLKLQRLRVFSLRGYLISEVPDSIGDLSYLRYLNLSGTQIRTLPESVNKLYNLHTLLLEGCRELKKKCADMGNLIKLHHLNNSNTDSLEEMPLGIGKLTCLLTLCNFVVGKDSGSGLRELKLLTHLCGTLNISKLENVKYVGDAMEAQLDGKKNLKVLMLEWTRSTNGLSSREAQTEKGVLDMLKPHRSLEQFCISGFGGKKFPTWLGYSLFSNLVTLKFQDCSMCTSMPSVGQLPSLKHLEVRGMSRVKRLGSEFYGNDSPIPFPCLETLHFAEMQEWEEWIPHGCSQEIEGFPKLRELHIVRCSKLQGTLPTHLTLLDILVVQNFTSLPALCKLRIDRCKKVVWRSTTDCESQLYKDISNQMFLGGPLKLQLPKLDELDISIIIDGLSYIWQNETQLLQDIATLKRLKIERCPKLQFLEEEDQWQFGLSFRLEHLELINCQDLEKLPKSLLSLSSLTEMRIHNCSSLVSFPEAVLPSQLRVISIWDSGALKFLPEAWMLDNNSSLEILDIRHCHLLTYIAGVQLPPSLKQLEIYNCDNLRTLTAEEGIHSSRRHTSLLECLEIHSCPSLTCLISKNELRAALDYLVVGNLPQALKFLSIWHCSKLESIVERLDNKISLEVIEIVSCENLKMLPHGLHKLWHLQEIDIQDCENLVSFPEGGLLSAKLKRLVIYGCKKLEALPEGMHNLSSLQYLTIGGVPSLLCFTEDGLFPTNLHSLEIDGMKIWKSLMQLGGFHRYTSLRRLAISGCDEDMVSFPLEDIRLGTTLPACLTQLEIFNFPNLERLSSSICDQNLTSLKLTNCPKLKYFPEKGLPASLLRLEIKKCPLIEKMCRQDIGPYWHLLIHIPCVLIECSCTVN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 515-621,672-806
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 87-183,230-253,266-337
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 89-188,215-254,265-331
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 59-188
View the alignment between query and template
View the model in PyMOL
Template: 3VQ2, chain A
Confidence level:very confident
Coverage over the Query: 490-630,672-833
View the alignment between query and template
View the model in PyMOL
Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 89-178,236-251,265-399,414-467
View the alignment between query and template
View the model in PyMOL
Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 33-66
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 98-194,219-253,266-270,296-399,411-608,673-894,913-921
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 88-188,243-400,411-426,449-451,479-641,678-913
View the alignment between query and template
View the model in PyMOL
Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 484-889
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:probable
Coverage over the Query: 85-425,439-472,483-598
View the alignment between query and template
View the model in PyMOL