Citrus Sinensis ID: 002287


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940--
MVRKKRTEQPSTGGESSESQETSAGGGRGSQRPSERSAPPSQGGGGGGTGYQGSGRGWGPPSQQGGRGGYGGGRGRGGPQQQHYGGTSEYQGRGRGGPPQPGGRGGYGGGRGGVGMGSGGRGGHSGGPTRSSQIPELHQATPTPFSSGVMTQPTQSQAGSSSHSPELSEVSQQFQQLSLPEEVSSSQVIQPAPPSSKSVRFPLRPGRGSTGTRCIVKANHFFAELPDKDLHQYDVTITPEVTSRGVNRAVMEQLVKLYRESHLGKRLPAYDGRKSLYTAGPLPFLSKEFRITLLDDDDGQGGQRREREFKVVIKLAARADLHHLGLFLQGRQADAPQEALQVLDIVLRELPTTRYCPVGRSFYSPDLGRRQPLGEGLESWRGFYQSIRPTQMGLSLNIDMSSTAFIEPLPVIDFVQQLLNRDVSSRPLSDADRVKIKKALRGVRVEVTHRGNMRRKYRISGLTSQTTGELTFPVDESGTLKSVVEYFYETYGFVIQHTQWPCLQVGNQQRPNYLPMEVCKIVEGQRYSKRLNERQITALLKVTCQRPHERERDIMQTVHHNAYHEDPYAREFGIKISEKLASVEARILPAPWLKYHDTGKEKDCLPQVGQWNMMNKKMVNGGTVNHWICINFSRHVQDSIARGFCFELAQMCYISGMAFNPEPVIPPISARPEHVEKVLKTRYHDAMTKLGQGKELDLLIVILPDNNGSLYGDLKRICETDLGLVSQCCLTKHVFKMSKQYMANVALKINVKVGGRNTVLVDAISRRIPLVSDRPTIIFGADVTHPHPGEDSSPSIAAVVASQDWPEVTKYAGLVCAQAHRQELIQDLFKTWQDPGTPYIFPDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTFVVVQKRHHTRLFANNHHDRNAVDRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQVSYFLRFCF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEcccccEEEEEEEECccccccHHHHHHHHHHHHHHHHcccccccCECccccCEECccccccccccEEEEEEcccccccccccccEEEEEEEEEEEEcHHHHHHHHcccccccHHHHHHHHHHHHHHcccccCEECccccccccccccccccccEEEEEEEEEEEEECccCEEEEEEcccccccccccHHHHHHHHHccccccccccHHHHHHHHHHccccEEEEECccccccEEEEEcccccccccccCCccccccEEEHHHHHHHHcccccccccccCEECcccccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHcccEEcccccEEEEEEcccccEEEccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEECccccccHHHHHHHHcccccccccEEcccccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccccEEEEECccccccccccccccEEEEEEECcccccccEEEEEEEccccHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccccccccccccccccccccCEEcccccccccccEEEEccccccccccccEEc
******************************************************************************************************************************************************************************************************************GTRCIVKANHFFAELPDKDLHQYDVTITPEVTSRGVNRAVMEQLVKLYRESHLGKRLPAYDGRKSLYTAGPLPFLSKEFRITLLDD**********REFKVVIKLAARADLHHLGLFLQGRQADAPQEALQVLDIVLRELPTTRYCPVGRSFYSPDLGRRQPLGEGLESWRGFYQSIRPTQMGLSLNIDMSSTAFIEPLPVIDFVQQLLNRDVSSRPLSDADRVKIKKALRGVRVEVTHRGNMRRKYRISGLTSQTTGELTFPVDESGTLKSVVEYFYETYGFVIQHTQWPCLQVGNQQRPNYLPMEVCKIVEGQRYSKRLNERQITALLKVTCQRPHERERDIMQTVHHNAYHEDPYAREFGIKISEKLASVEARILPAPWLKYHDTGKEKDCLPQVGQWNMMNKKMVNGGTVNHWICINFSRHVQDSIARGFCFELAQMCYISGMAFNPEPVIPPISARPEHVEKVLKTRYHDAMTKLGQGKELDLLIVILPDNNGSLYGDLKRICETDLGLVSQCCLTKHVFKMSKQYMANVALKINVKVGGRNTVLVDAISRRIPLVSDRPTIIFGADVTHPH******PSIAAVVASQDWPEVTKYAGLVCAQAHRQELIQDLFKTWQDPGTPYIFPDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTFVVVQKRHHTRLFANN*********SGNILPGTVVDSKICHPTEFDFYLCSHAGIQVSYFLRFCF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRKKRTEQPSTGGESSESQETSAGGGRGSQRPSERSAPPSQGGGGGGTGYQGSGRGWGPPSQQGGRGGYGGGRGRGGPQQQHYGGTSEYQGRGRGGPPQPGGRGGYGGGRGGVGMGSGGRGGHSGGPTRSSQIPELHQATPTPFSSGVMTQPTQSQAGSSSHSPELSEVSQQFQQLSLPEEVSSSQVIQPAPPSSKSVRFPLRPGRGSTGTRCIVKANHFFAELPDKDLHQYDVTITPEVTSRGVNRAVMEQLVKLYRESHLGKRLPAYDGRKSLYTAGPLPFLSKEFRITLLDDDDGQGGQRREREFKVVIKLAARADLHHLGLFLQGRQADAPQEALQVLDIVLRELPTTRYCPVGRSFYSPDLGRRQPLGEGLESWRGFYQSIRPTQMGLSLNIDMSSTAFIEPLPVIDFVQQLLNRDVSSRPLSDADRVKIKKALRGVRVEVTHRGNMRRKYRISGLTSQTTGELTFPVDESGTLKSVVEYFYETYGFVIQHTQWPCLQVGNQQRPNYLPMEVCKIVEGQRYSKRLNERQITALLKVTCQRPHERERDIMQTVHHNAYHEDPYAREFGIKISEKLASVEARILPAPWLKYHDTGKEKDCLPQVGQWNMMNKKMVNGGTVNHWICINFSRHVQDSIARGFCFELAQMCYISGMAFNPEPVIPPISARPEHVEKVLKTRYHDAMTKLGQGKELDLLIVILPDNNGSLYGDLKRICETDLGLVSQCCLTKHVFKMSKQYMANVALKINVKVGGRNTVLVDAISRRIPLVSDRPTIIFGADVTHPHPGEDSSPSIAAVVASQDWPEVTKYAGLVCAQAHRQELIQDLFKTWQDPGTPYIFPDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTFVVVQKRHHTRLFANNHHDRNAVDRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQVSYFLRFCF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein argonaute 1A Probably involved in the RNA silencing pathway. May bind to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them.confidentQ6EU14
Protein argonaute 1 Involved in RNA-mediated post-transcriptional gene silencing (PTGS). Main component of the RNA-induced silencing complex (RISC) that binds to a short guide RNA such as microRNA (miRNA) or small interfering RNA (siRNA). RISC uses the mature miRNA or siRNA as a guide for slicer-directed cleavage of homologous mRNAs to repress gene expression. Requires DRB1 for directional loading of the small RNA duplex (guide stand and passenger strand) onto RISC for passenger strand degradation. Unlike animal RISC that associates in high molecular weight complex, Arabidopsis RISC is probably composed only of the AGO1 protein and associated RNA without any other proteins. Associates mainly with miRNAs of 21 nucleotide in length and preferentially recruits small RNAs with a 5' terminal uridine. Associates with 22 nucleotide miRNAs to trigger RDR6-dependent secondary siRNAs biogenesis. This pathway amplifies silencing by using the target RNA as substrate to generate secondary siRNAs. Binds to miR168 which targets its own mRNA for repression, establishing a homeostatic regulatory loop. Involved in antiviral RNA silencing by contributing to viral RNA clearance. Is capable of targeting viral RNAs with more compact structures than AGO7 which favors less structured RNA targets. May not associate with 24 nucleotide siRNAs involved in chromatin silencing. Essential for multiple processes in development. Essential for proper development of leaves and floral organs, and formation of axillary meristems. Like AGO10, required for stem cell function and organ polarity.probableO04379

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G0X, chain A
Confidence level:very confident
Coverage over the Query: 615-760
View the alignment between query and template
View the model in PyMOL
Template: 4F3T, chain A
Confidence level:very confident
Coverage over the Query: 199-295,308-941
View the alignment between query and template
View the model in PyMOL