Citrus Sinensis ID: 002318

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930------

MDLMRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNTVASGGLHISHTKDVKVLVFSKYGCMQ

ccccccccccEEEEEEEccccccEEEEEEEccEEEEEEEccEEEEEEccccccccccccccccccccEEEEEEcccccEEEEEEEEccccCEEEEEccccccCCcccccccEEEEEEEcccccccccccEEEEEEccccEEEEEEEccccccEEEEEEEEcccccccEEEEEEEECccccccCEEEEEEcccEEEEEEcccccHHHHHHcccccccEEEcccccccccEEEEEcccccEEEEEEccccEEEEEEcccccccccccccccccccccccccccccccccccccccEEccEEEEEEEccEEEEEEcccccEEEEEEcccccccccccEEEEEEcccccEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccEEECccccEEEEEEcccccc

***MRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSS*N****F**********************SMAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKV**DEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNT**SGGLHISHTKDVKVLVFSKYGCMQ

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDLMRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNTVASGGLHISHTKDVKVLVFSKYGCMQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar protein sorting-associated protein 18 homolog	May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.	probable	Q9P253
Vacuolar protein sorting-associated protein 18 homolog	May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.	probable	Q8R307
Vacuolar protein sorting-associated protein 18 homolog	May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. May be involved in vesicle trafficking to the hepatocyte apical membrane and play a role in development of the intra-hepatic biliary tree. May target endosomes to the pigment granule in melanocytes. Essential for early embryonic development.	probable	P59015

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XI4, chain A
Confidence level:confident
Coverage over the Query: 289-474,492-683,697-717
View the alignment between query and template
View the model in PyMOL

Template: 1B89, chain A
Confidence level:confident
Coverage over the Query: 475-476,496-506,523-793
View the alignment between query and template
View the model in PyMOL

Template: 1V87, chain A
Confidence level:confident
Coverage over the Query: 832-884
View the alignment between query and template
View the model in PyMOL

Template: 1BPO, chain A
Confidence level:probable
Coverage over the Query: 29-450
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain A
Confidence level:probable
Coverage over the Query: 371-477,495-526,540-659,670-807
View the alignment between query and template
View the model in PyMOL

Template: 4A2L, chain A
Confidence level:probable
Coverage over the Query: 22-257,269-363
View the alignment between query and template
View the model in PyMOL