Citrus Sinensis ID: 002318

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930------
MDLMRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNTVASGGLHISHTKDVKVLVFSKYGCMQ
ccccccccccEEEEEEEccccccEEEEEEEccEEEEEEEccEEEEEEccccccccccccccccccccEEEEEEcccccEEEEEEEEccccEEEEEEccccccEEcccccccEEEEEEEcccccccccccEEEEEEccccEEEEEEEccccccEEEEEEEEcccccccEEEEEEEEEccccccEEEEEEEcccEEEEEEcccccHHHHHHcccccccEEEcccccccccEEEEEcccccEEEEEEccccEEEEEEcccccccccccccccccccccccccccccccccccccccEEccEEEEEEEccEEEEEEcccccEEEEEEcccccccccccEEEEEEcccccEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccEEEEccccEEEEEEcccccc
cccccccccHcHEEEEcccccccEEEEEEEccEEEEEEcccEEEEEEccccccccEEcccccccccEEEEEEEcccccEEEEEEEEcccccEEEEEccccccccHHHHcccEEEEEEEcccccccccccEEEEEccccEEEEEEEccccccccEEEEEEEcccccccccEEEEEEccccccccEEEEEEcccEEEEEEcccccHHHHHHHccccccccccccccccccEEEcccccccccEEEEccccEEEEEEcccccccccccccHccccHHcccccccccccccccccEEEEEHHEEEEEccccEEEEEcccccEEEEEEcccccccccccEEEEEEcccccEEEEEEccEEEEEEEcccccHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccEEHHHHcccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccHcccEEEEcccccccccccccccccccEEEEcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccEEcccHHHHHHHHccccccc
MDLMRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSkgwlirhdfgagdsydidlsagrpgeqsihkvfvdpggshcIATIVGsggaetfythakwskprvlsKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMEtaslsngtryyvmavtptrlysftgfgsLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSgagiyhgglnfgaqrsspngdenfveNKALLSYSKlsegaeavkpgsmavSEYHFLLLMGNKVKVVNRISEQIIEELqfdqtsdsisRGIIGlcsdatagvfyaydqnsifqVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDnlakddkcqiTMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLrkpavpidlqykfapdliMLDAYETVESWMttnnlnprklipammryssephaknetHEVIKYLEFCVHRlhnedpgvHNLLLSLYAKQEDDSALLRFLQCkfgkgrengpeffydpkYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVdpelamaeadkveddEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETdgllkiedilpffpdfalidDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAvidrdedcgVCRRKILVAGRDYRmargyasvgpmapfyvfpcghafhAQCLIAHVTQCTNETQVSVVDIVLSYKRLQsgwntvasgglhishtkDVKVLVFSKYGCMQ
MDLMRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNrqqiteastkeiilgtdtgqlheMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNKVKVVNRISEQIIEELqfdqtsdsISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKldnlakddkcQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFgkgrengpeffydPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKVEDDEDLRKKLWLMVAKHvieqekgtkreniRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYavidrdedcgvCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNTVasgglhishtkdvKVLVFSKYGCMQ
MDLMRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNTVASGGLHISHTKDVKVLVFSKYGCMQ
*****QVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFG**********************************SMAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMM***********THEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAM**********DLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDDYNKQIE************ADNIRNDISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNTVASGGLHISHTKDVKVLVFSKYGC**
***MRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSA****EQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDT***********************LHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSS*N****F***********************MAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFL************EFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKV**DEDLRKKLWLMVAKHVIEQEK**KRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNI*N***A*AQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQ****************************************VLVFSKYGCMQ
MDLMRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNTVASGGLHISHTKDVKVLVFSKYGCMQ
****RQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNT**SGGLHISHTKDVKVLVFSKYGCMQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLMRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVHFAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEADKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVVDIVLSYKRLQSGWNTVASGGLHISHTKDVKVLVFSKYGCMQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query936 2.2.26 [Sep-21-2011]
P59015974 Vacuolar protein sorting- yes no 0.852 0.819 0.348 1e-138
Q9P253973 Vacuolar protein sorting- yes no 0.854 0.822 0.344 1e-123
Q8R307973 Vacuolar protein sorting- yes no 0.840 0.808 0.348 1e-123
Q243141002 Vacuolar protein sorting- yes no 0.829 0.774 0.290 6e-84
O74925900 Vacuolar membrane protein yes no 0.872 0.907 0.254 4e-73
P27801918 Vacuolar membrane protein yes no 0.649 0.662 0.243 2e-54
>sp|P59015|VPS18_DANRE Vacuolar protein sorting-associated protein 18 homolog OS=Danio rerio GN=vps18 PE=2 SV=2 Back     alignment and function desciption
 Score =  492 bits (1266), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 310/889 (34%), Positives = 488/889 (54%), Gaps = 91/889 (10%)

Query: 24  ITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIAT 83
           I   S  N+ + +   K  L+R D G  D  +  +  GR  +  +H++F+DP GSH +  
Sbjct: 57  INQFSVCNNQLCMSLGKDTLLRIDLGKPDQPN-QIELGRKDDSKVHRLFLDPTGSHLVIC 115

Query: 84  IVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEM 143
           +  +   E  Y +    K R LS+ +G ++ ++ WN+   +E +T  I++GT  G + E 
Sbjct: 116 LTTN---ECVYLNRNTQKVRGLSRWRGHLIESIGWNKLIGSETNTGPILVGTSQGIIFEA 172

Query: 144 AVDEKD------KREKYIKLLFELNE--LPEAFMGLQMETASLSNGTRYYVMAVTPTRLY 195
            +   +        ++Y + +  L E   P     L++E       T+Y+++A T  RL+
Sbjct: 173 EISASEGSLFNTNPDQYFRQVHYLEEDGKPAPVCCLEVERGL---ETKYFIIATTRKRLF 229

Query: 196 SFTGF---GS----LDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRA--VHFAWLSG 246
            F G    GS      ++FA   D    F E P  +  SE+ F+  + R+    FAW+ G
Sbjct: 230 QFVGKLAEGSEQQGFSSIFAQNQDLLPSFQEFPVNMGYSEITFYTSKLRSRPKTFAWMMG 289

Query: 247 AGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEA-----VKPGSMAVSEYHFL 301
            G+ +G L++             V   +LLS  ++ E  +      VKP S+ ++++HFL
Sbjct: 290 NGVLYGQLDY-------------VRPDSLLSDVQVWEYTQDIDLNFVKPISIVLTQFHFL 336

Query: 302 LLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVN 361
           LL+ ++V+ +  ++ Q++ E  F +   ++ + I     D   G+ + Y + ++F+  + 
Sbjct: 337 LLLPDRVRGICTLNGQVVHEDVFPEKFGTLQKMI----KDPITGLVWIYTEKAVFRYHIQ 392

Query: 362 DEGRDMWKVYLDMKEYAAALANCRD-PLQRDQVYLVQAEAAFATKDFHRAASFYAKI-NY 419
            E RD+W++Y++M ++  A   C+D P   D V   +AE  F  K +  +A  YA   NY
Sbjct: 393 KEARDVWQMYMNMNKFDLAKEYCKDRPECLDMVLAKEAEHCFQNKRYLESAKCYALTQNY 452

Query: 420 ILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLE 479
              FEEI LKFI   +++AL+ FL++KL NL   +K QIT++ TW TELYL+++ +L   
Sbjct: 453 ---FEEIALKFIEAKQEEALKEFLIKKLVNLKPSEKTQITLLVTWLTELYLNRLGQL--- 506

Query: 480 DDTALENRSSEYQSIMREFRAFLSDCK--DVL--DEATTMKLLESYGRVEELVFFASLKE 535
              A E +   +     EFR FL   K  D    + +T   LL S+G V+ +V+F+ + +
Sbjct: 507 --EADEGKQHLFLETREEFRTFLKSPKHKDCFYNNRSTIYDLLASHGDVDNMVYFSVIMQ 564

Query: 536 QHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNN-LNP 594
            +E V+ HY Q  +   AL +L K      L YKF+P L+     + V++W+   N L+P
Sbjct: 565 DYERVISHYCQHDDYSAALDVLSK-HCDDKLFYKFSPVLMQHIPKKVVDAWIQMGNRLDP 623

Query: 595 RKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLR 654
           + LIPA++ YS +  +  + +E I+Y+EFCV+ L  ++  +HN LLSLYAK + D ALL 
Sbjct: 624 KNLIPALVNYS-QMGSMQQINETIRYMEFCVYELDVKEEAIHNYLLSLYAKHKPD-ALLW 681

Query: 655 FLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPEL 714
           +L+    +   +  +  YD KYALRLC +   ++ACV +Y +M ++EEAV LAL+VD +L
Sbjct: 682 YLE----QAGTHVSDIHYDLKYALRLCSEHGYLQACVLVYKIMELYEEAVDLALKVDVDL 737

Query: 715 AMAEADKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPF 774
           A + AD  EDDE+LRKKLWL +A+HV+++EK     +++KA+  L   + LLKIEDILPF
Sbjct: 738 AKSCADLPEDDEELRKKLWLKIARHVVQEEK-----DVKKAMNCLSSCN-LLKIEDILPF 791

Query: 775 FPDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDE 834
           FPDF  ID FKEAICSSL++YNK IE+LKQEM +AT  A  IR DI  +  +Y V++  E
Sbjct: 792 FPDFVTIDHFKEAICSSLEEYNKHIEELKQEMEEATESAKRIREDIQEMRNKYGVVESQE 851

Query: 835 DCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHV 883
            C  C   +L                   PFY+F CGH FH  CL+  V
Sbjct: 852 KCATCDFPLL-----------------NRPFYLFLCGHMFHYDCLLQEV 883
May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. May be involved in vesicle trafficking to the hepatocyte apical membrane and play a role in development of the intra-hepatic biliary tree. May target endosomes to the pigment granule in melanocytes. Essential for early embryonic development.
Danio rerio (taxid: 7955)
>sp|Q9P253|VPS18_HUMAN Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens GN=VPS18 PE=1 SV=2 Back     alignment and function description
>sp|Q8R307|VPS18_MOUSE Vacuolar protein sorting-associated protein 18 homolog OS=Mus musculus GN=Vps18 PE=1 SV=2 Back     alignment and function description
>sp|Q24314|VPS18_DROME Vacuolar protein sorting-associated protein 18 homolog OS=Drosophila melanogaster GN=dor PE=1 SV=3 Back     alignment and function description
>sp|O74925|PEP3_SCHPO Vacuolar membrane protein pep3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep3 PE=3 SV=1 Back     alignment and function description
>sp|P27801|PEP3_YEAST Vacuolar membrane protein PEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query936
255553905987 vacuolar membrane protein pep3, putative 0.956 0.906 0.890 0.0
225447639986 PREDICTED: vacuolar protein sorting-asso 0.977 0.927 0.874 0.0
356549956990 PREDICTED: vacuolar protein sorting-asso 0.956 0.904 0.862 0.0
334182501988 zinc ion binding protein [Arabidopsis th 0.951 0.901 0.851 0.0
449438056989 PREDICTED: vacuolar protein sorting-asso 0.956 0.904 0.853 0.0
2978441121006 T12C24.2 [Arabidopsis lyrata subsp. lyra 0.951 0.885 0.835 0.0
95023671010 T12C24.2 [Arabidopsis thaliana] 0.951 0.882 0.813 0.0
8778633 1063 F5O11.22 [Arabidopsis thaliana] 0.948 0.835 0.757 0.0
440583708 1054 similar to vacuolar protein sorting-asso 0.885 0.786 0.837 0.0
242078359995 hypothetical protein SORBIDRAFT_07g00494 0.943 0.887 0.754 0.0
>gi|255553905|ref|XP_002517993.1| vacuolar membrane protein pep3, putative [Ricinus communis] gi|223542975|gb|EEF44511.1| vacuolar membrane protein pep3, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1696 bits (4392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 797/895 (89%), Positives = 852/895 (95%)

Query: 1   MDLMRQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSA 60
           M+  RQVF VD+LERYAAKGRGVITCM+AGNDVIV+GTSKGW+IRHDFG GDSYDIDLSA
Sbjct: 1   MEQGRQVFTVDLLERYAAKGRGVITCMAAGNDVIVIGTSKGWVIRHDFGVGDSYDIDLSA 60

Query: 61  GRPGEQSIHKVFVDPGGSHCIATIVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNR 120
           GR GEQ IH+VFVDPGGSHCIAT+VG GGAET+YTHAKWSKPRVL+KLKGLVVNAVAWNR
Sbjct: 61  GRGGEQCIHRVFVDPGGSHCIATVVGGGGAETYYTHAKWSKPRVLTKLKGLVVNAVAWNR 120

Query: 121 QQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELNELPEAFMGLQMETASLSN 180
           Q ITEASTKE+ILGTD GQLHE+AVDEKDKREKY+K LF+LNELPEAFMGLQMETA+LSN
Sbjct: 121 QSITEASTKEVILGTDNGQLHEIAVDEKDKREKYVKFLFQLNELPEAFMGLQMETANLSN 180

Query: 181 GTRYYVMAVTPTRLYSFTGFGSLDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRAVH 240
           GTRYYVMAVTPTRLYSFTG GSL+TVFA YL+RAVHFMELPGEILNSELHFFIKQRRAVH
Sbjct: 181 GTRYYVMAVTPTRLYSFTGIGSLETVFAGYLERAVHFMELPGEILNSELHFFIKQRRAVH 240

Query: 241 FAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHF 300
           FAWLSGAGIYHGGLNFGAQ S PNGDENFVENKALL YSKLSEGA A+KP SMAVSE+HF
Sbjct: 241 FAWLSGAGIYHGGLNFGAQHSYPNGDENFVENKALLDYSKLSEGAGAIKPTSMAVSEFHF 300

Query: 301 LLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSV 360
           LLL+GNKVKVVNRISEQIIEEL+FDQTS+S+SR IIGLCSDATAG+FYAYDQNSIFQVSV
Sbjct: 301 LLLIGNKVKVVNRISEQIIEELRFDQTSESVSRDIIGLCSDATAGLFYAYDQNSIFQVSV 360

Query: 361 NDEGRDMWKVYLDMKEYAAALANCRDPLQRDQVYLVQAEAAFATKDFHRAASFYAKINYI 420
           NDEGRDMWKVYLDMKEYAAALANCRDP QRDQVYL+QA+AAFA++DF RAASFYAK+NY+
Sbjct: 361 NDEGRDMWKVYLDMKEYAAALANCRDPFQRDQVYLLQADAAFASRDFLRAASFYAKVNYM 420

Query: 421 LSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLED 480
           LSFEEITLKFIS SEQDALRTFLLRKLDNL KDDKCQITMISTWATELYLDKINR+LLE+
Sbjct: 421 LSFEEITLKFISASEQDALRTFLLRKLDNLMKDDKCQITMISTWATELYLDKINRMLLEE 480

Query: 481 DTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIV 540
           D A E+RSSEYQSI++EFRAFLSD KDVLDEATTM+LL+  GRVEELV+FASLKEQ+EIV
Sbjct: 481 DNASEDRSSEYQSIIQEFRAFLSDSKDVLDEATTMRLLKGSGRVEELVYFASLKEQYEIV 540

Query: 541 VHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPA 600
           + HYI+QGEAKKAL++L+KPAVPIDLQYKFAPDLI LDAYETVESWM T NLNPRKLIPA
Sbjct: 541 IDHYIEQGEAKKALEVLQKPAVPIDLQYKFAPDLIALDAYETVESWMVTKNLNPRKLIPA 600

Query: 601 MMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKF 660
           MMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPG+HNLLLSLYAKQEDD ALLRFLQCKF
Sbjct: 601 MMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGIHNLLLSLYAKQEDDGALLRFLQCKF 660

Query: 661 GKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEAD 720
           GKGRENGP+FFYDPKYALRLCL EKRMRACVHIY MMSMHEEAVALALQVDPELAMAEAD
Sbjct: 661 GKGRENGPDFFYDPKYALRLCLIEKRMRACVHIYSMMSMHEEAVALALQVDPELAMAEAD 720

Query: 721 KVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFAL 780
           KVEDDEDLRKKLWLM+AKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFAL
Sbjct: 721 KVEDDEDLRKKLWLMIAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFAL 780

Query: 781 IDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDEDCGVCR 840
           IDDFKEAICSSL+DYNKQIEQLK+EMNDATHGADNIRNDISALAQRYAVIDRDE+CG C+
Sbjct: 781 IDDFKEAICSSLEDYNKQIEQLKEEMNDATHGADNIRNDISALAQRYAVIDRDEECGACK 840

Query: 841 RKILVAGRDYRMARGYASVGPMAPFYVFPCGHAFHAQCLIAHVTQCTNETQVSVV 895
           RKIL+ G DYRM+RGY SVGPMAPFYVFPCGHAFHA CLIAHVT+CT +TQ   +
Sbjct: 841 RKILIVGGDYRMSRGYTSVGPMAPFYVFPCGHAFHAHCLIAHVTRCTTDTQAEYI 895

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225447639|ref|XP_002271384.1| PREDICTED: vacuolar protein sorting-associated protein 18 homolog [Vitis vinifera] gi|296084966|emb|CBI28381.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356549956|ref|XP_003543356.1| PREDICTED: vacuolar protein sorting-associated protein 18 homolog [Glycine max] Back     alignment and taxonomy information
>gi|334182501|ref|NP_172709.2| zinc ion binding protein [Arabidopsis thaliana] gi|332190766|gb|AEE28887.1| zinc ion binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449438056|ref|XP_004136806.1| PREDICTED: vacuolar protein sorting-associated protein 18 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|297844112|ref|XP_002889937.1| T12C24.2 [Arabidopsis lyrata subsp. lyrata] gi|297335779|gb|EFH66196.1| T12C24.2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|9502367|gb|AAF88074.1|AC025417_2 T12C24.2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8778633|gb|AAF79641.1|AC025416_15 F5O11.22 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|440583708|emb|CCH47212.1| similar to vacuolar protein sorting-associated protein [Lupinus angustifolius] Back     alignment and taxonomy information
>gi|242078359|ref|XP_002443948.1| hypothetical protein SORBIDRAFT_07g004940 [Sorghum bicolor] gi|241940298|gb|EES13443.1| hypothetical protein SORBIDRAFT_07g004940 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query936
ZFIN|ZDB-GENE-020419-33974 vps18 "vacuolar protein sortin 0.829 0.796 0.352 1.8e-131
DICTYBASE|DDB_G02699241077 vps18 "7-fold repeat in clathr 0.657 0.571 0.358 8.2e-128
UNIPROTKB|F1SSU6973 VPS18 "Uncharacterized protein 0.824 0.793 0.350 4.5e-124
UNIPROTKB|A6QR33973 VPS18 "VPS18 protein" [Bos tau 0.830 0.798 0.345 7.2e-124
UNIPROTKB|Q9P253973 VPS18 "Vacuolar protein sortin 0.829 0.797 0.347 7.2e-124
UNIPROTKB|E2RAT8973 VPS18 "Uncharacterized protein 0.829 0.797 0.347 1.5e-123
MGI|MGI:2443626973 Vps18 "vacuolar protein sortin 0.829 0.797 0.348 2.4e-123
RGD|1311556973 Vps18 "vacuolar protein sortin 0.829 0.797 0.351 3.1e-123
UNIPROTKB|E1BSK2974 VPS18 "Uncharacterized protein 0.831 0.798 0.356 8.2e-123
ASPGD|ASPL0000051037963 digA [Emericella nidulans (tax 0.842 0.819 0.318 3.7e-116
ZFIN|ZDB-GENE-020419-33 vps18 "vacuolar protein sorting protein 18" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1234 (439.4 bits), Expect = 1.8e-131, Sum P(2) = 1.8e-131
 Identities = 296/840 (35%), Positives = 475/840 (56%)

Query:    24 ITCMSAGNDVIVLGTSKGWLIRHDFGAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIAT 83
             I   S  N+ + +   K  L+R D G  D  +  +  GR  +  +H++F+DP GSH +  
Sbjct:    57 INQFSVCNNQLCMSLGKDTLLRIDLGKPDQPN-QIELGRKDDSKVHRLFLDPTGSHLVIC 115

Query:    84 IVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEM 143
             +  +   E  Y +    K R LS+ +G ++ ++ WN+   +E +T  I++GT  G + E 
Sbjct:   116 LTTN---ECVYLNRNTQKVRGLSRWRGHLIESIGWNKLIGSETNTGPILVGTSQGIIFEA 172

Query:   144 AVDEKD------KREKYIKLLFELNE--LPEAFMGLQMETASLSNGTRYYVMAVTPTRLY 195
              +   +        ++Y + +  L E   P     L++E   L   T+Y+++A T  RL+
Sbjct:   173 EISASEGSLFNTNPDQYFRQVHYLEEDGKPAPVCCLEVERG-LE--TKYFIIATTRKRLF 229

Query:   196 SFTGF---GS----LDTVFASYLDRAVHFMELPGEILNSELHFFIKQRRA--VHFAWLSG 246
              F G    GS      ++FA   D    F E P  +  SE+ F+  + R+    FAW+ G
Sbjct:   230 QFVGKLAEGSEQQGFSSIFAQNQDLLPSFQEFPVNMGYSEITFYTSKLRSRPKTFAWMMG 289

Query:   247 AGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGN 306
              G+ +G L++      P   ++ + +  +  Y++  +    VKP S+ ++++HFLLL+ +
Sbjct:   290 NGVLYGQLDY----VRP---DSLLSDVQVWEYTQDID-LNFVKPISIVLTQFHFLLLLPD 341

Query:   307 KVKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRD 366
             +V+ +  ++ Q++ E  F +   ++ + I     D   G+ + Y + ++F+  +  E RD
Sbjct:   342 RVRGICTLNGQVVHEDVFPEKFGTLQKMI----KDPITGLVWIYTEKAVFRYHIQKEARD 397

Query:   367 MWKVYLDMKEYAAALANCRD-PLQRDQVYLVQAEAAFATKDFHRAASFYAKI-NYILSFE 424
             +W++Y++M ++  A   C+D P   D V   +AE  F  K +  +A  YA   NY   FE
Sbjct:   398 VWQMYMNMNKFDLAKEYCKDRPECLDMVLAKEAEHCFQNKRYLESAKCYALTQNY---FE 454

Query:   425 EITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTAL 484
             EI LKFI   +++AL+ FL++KL NL   +K QIT++ TW TELYL+++ +L  E D   
Sbjct:   455 EIALKFIEAKQEEALKEFLIKKLVNLKPSEKTQITLLVTWLTELYLNRLGQL--EAD--- 509

Query:   485 ENRSSEYQSIMREFRAFLSDCK--DVL--DEATTMKLLESYGRVEELVFFASLKEQHEIV 540
             E +   +     EFR FL   K  D    + +T   LL S+G V+ +V+F+ + + +E V
Sbjct:   510 EGKQHLFLETREEFRTFLKSPKHKDCFYNNRSTIYDLLASHGDVDNMVYFSVIMQDYERV 569

Query:   541 VHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNN-LNPRKLIP 599
             + HY Q  +   AL +L K      L YKF+P L+     + V++W+   N L+P+ LIP
Sbjct:   570 ISHYCQHDDYSAALDVLSKHCDD-KLFYKFSPVLMQHIPKKVVDAWIQMGNRLDPKNLIP 628

Query:   600 AMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCK 659
             A++ YS +  +  + +E I+Y+EFCV+ L  ++  +HN LLSLYAK + D ALL +L+  
Sbjct:   629 ALVNYS-QMGSMQQINETIRYMEFCVYELDVKEEAIHNYLLSLYAKHKPD-ALLWYLE-- 684

Query:   660 FGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEA 719
               +   +  +  YD KYALRLC +   ++ACV +Y +M ++EEAV LAL+VD +LA + A
Sbjct:   685 --QAGTHVSDIHYDLKYALRLCSEHGYLQACVLVYKIMELYEEAVDLALKVDVDLAKSCA 742

Query:   720 DKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFA 779
             D  EDDE+LRKKLWL +A+HV+++EK     +++KA+  L   + LLKIEDILPFFPDF 
Sbjct:   743 DLPEDDEELRKKLWLKIARHVVQEEK-----DVKKAMNCLSSCN-LLKIEDILPFFPDFV 796

Query:   780 LIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDEDCGVC 839
              ID FKEAICSSL++YNK IE+LKQEM +AT  A  IR DI  +  +Y V++  E C  C
Sbjct:   797 TIDHFKEAICSSLEEYNKHIEELKQEMEEATESAKRIREDIQEMRNKYGVVESQEKCATC 856
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0007634 "optokinetic behavior" evidence=IMP
GO:0048757 "pigment granule maturation" evidence=IMP
GO:0048069 "eye pigmentation" evidence=IMP
GO:0015721 "bile acid and bile salt transport" evidence=IMP
GO:0043485 "endosome to pigment granule transport" evidence=IMP
GO:0008333 "endosome to lysosome transport" evidence=IMP
GO:0045176 "apical protein localization" evidence=IMP
GO:0005622 "intracellular" evidence=IMP
GO:0046872 "metal ion binding" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0005764 "lysosome" evidence=IEA
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0005768 "endosome" evidence=IEA
GO:0015031 "protein transport" evidence=IEA
GO:0031902 "late endosome membrane" evidence=IEA
GO:0005765 "lysosomal membrane" evidence=IEA
DICTYBASE|DDB_G0269924 vps18 "7-fold repeat in clathrin and VPS proteins repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSU6 VPS18 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A6QR33 VPS18 "VPS18 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P253 VPS18 "Vacuolar protein sorting-associated protein 18 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAT8 VPS18 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2443626 Vps18 "vacuolar protein sorting 18 (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311556 Vps18 "vacuolar protein sorting 18 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSK2 VPS18 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ASPGD|ASPL0000051037 digA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9P253VPS18_HUMANNo assigned EC number0.34490.85470.8221yesno
P59015VPS18_DANRENo assigned EC number0.34870.85250.8193yesno
Q8R307VPS18_MOUSENo assigned EC number0.34830.84080.8088yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029182001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (986 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00029140001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (912 aa)
    • • 0.574
GSVIVG00018876001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (838 aa)
   •• • 0.554
GSVIVG00024931001
SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (1006 aa)
   •  • 0.501
GSVIVG00014287001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (568 aa)
    • • 0.489

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query936
pfam05131147 pfam05131, Pep3_Vps18, Pep3/Vps18/deep orange fami 9e-44
pfam00637143 pfam00637, Clathrin, Region in Clathrin and VPS 3e-09
smart00299140 smart00299, CLH, Clathrin heavy chain repeat homol 5e-08
>gnl|CDD|218453 pfam05131, Pep3_Vps18, Pep3/Vps18/deep orange family Back     alignment and domain information 
 Score =  155 bits (393), Expect = 9e-44
 Identities = 55/157 (35%), Positives = 84/157 (53%), Gaps = 12/157 (7%)

Query: 248 GIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNK 307
           GIY+G LN      S N  E  +E   +L  S+L        P S+A++++H LLL G++
Sbjct: 1   GIYYGTLNN-----SVNDAEKVLEESKVLPRSQLPPSTSP--PKSIALTQFHILLLYGDR 53

Query: 308 VKVVNRISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDM 367
           V  VNR++ Q++    ++Q        ++GL  D     F+ Y   +IF++ V DE RD+
Sbjct: 54  VIAVNRLNGQVV----YEQVILEPGGKLLGLVVDPVKNTFWLYTAQNIFEIVVEDEDRDV 109

Query: 368 WKVYLDMKEYAAALANCR-DPLQRDQVYLVQAEAAFA 403
           WK+YLD  ++  AL   + DP QRD V   QA+  F 
Sbjct: 110 WKLYLDKGKFDLALEYAKTDPAQRDAVLTKQADYLFE 146

This region is found in a number of protein identified as involved in golgi function and vacuolar sorting. The molecular function of this region is unknown. The members of this family contain a C-terminal ring finger domain. Length = 147
>gnl|CDD|216037 pfam00637, Clathrin, Region in Clathrin and VPS Back     alignment and domain information
>gnl|CDD|128594 smart00299, CLH, Clathrin heavy chain repeat homology Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 936
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 100.0
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 100.0
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 100.0
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 100.0
PF05131147 Pep3_Vps18: Pep3/Vps18/deep orange family; InterPr 99.97
smart00299140 CLH Clathrin heavy chain repeat homology. 99.66
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 99.65
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 99.38
KOG20791206 consensus Vacuolar assembly/sorting protein VPS8 [ 98.78
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.55
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.33
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.19
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.89
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.86
smart00299140 CLH Clathrin heavy chain repeat homology. 97.67
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.65
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.42
KOG2048691 consensus WD40 repeat protein [General function pr 97.26
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.17
KOG0289506 consensus mRNA splicing factor [General function p 97.15
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.12
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 97.06
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.02
KOG0315311 consensus G-protein beta subunit-like protein (con 96.7
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 96.61
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.61
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.48
PLN03077 857 Protein ECB2; Provisional 96.42
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 96.39
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 96.38
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 96.33
KOG3621726 consensus WD40 repeat-containing protein [General 96.29
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 96.28
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 96.25
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 96.23
PLN03218 1060 maturation of RBCL 1; Provisional 96.21
KOG0289506 consensus mRNA splicing factor [General function p 96.12
PLN032181060 maturation of RBCL 1; Provisional 96.12
PLN03077857 Protein ECB2; Provisional 96.11
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 95.97
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 95.92
KOG0646476 consensus WD40 repeat protein [General function pr 95.88
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 95.8
KOG0270463 consensus WD40 repeat-containing protein [Function 95.73
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 95.68
PLN00181793 protein SPA1-RELATED; Provisional 95.67
cd0016245 RING RING-finger (Really Interesting New Gene) dom 95.64
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 95.58
KOG1539910 consensus WD repeat protein [General function pred 95.57
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 95.55
PRK15174656 Vi polysaccharide export protein VexE; Provisional 95.52
KOG1941518 consensus Acetylcholine receptor-associated protei 95.48
KOG0316307 consensus Conserved WD40 repeat-containing protein 95.47
KOG2106626 consensus Uncharacterized conserved protein, conta 95.4
PLN00181793 protein SPA1-RELATED; Provisional 95.23
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 95.18
KOG1539910 consensus WD repeat protein [General function pred 95.11
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 95.02
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 94.98
KOG1274933 consensus WD40 repeat protein [General function pr 94.76
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.76
PTZ00420568 coronin; Provisional 94.75
PTZ00421493 coronin; Provisional 94.72
PHA02929238 N1R/p28-like protein; Provisional 94.72
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 94.69
KOG2048691 consensus WD40 repeat protein [General function pr 94.68
KOG0315311 consensus G-protein beta subunit-like protein (con 94.47
PTZ00421493 coronin; Provisional 94.46
KOG1273405 consensus WD40 repeat protein [General function pr 94.45
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 94.4
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 94.19
KOG2055514 consensus WD40 repeat protein [General function pr 93.98
PF10366108 Vps39_1: Vacuolar sorting protein 39 domain 1; Int 93.92
KOG0291893 consensus WD40-repeat-containing subunit of the 18 93.88
KOG0294362 consensus WD40 repeat-containing protein [Function 93.81
KOG0266456 consensus WD40 repeat-containing protein [General 93.79
KOG0284464 consensus Polyadenylation factor I complex, subuni 93.75
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 93.62
PRK11788389 tetratricopeptide repeat protein; Provisional 93.39
KOG0643327 consensus Translation initiation factor 3, subunit 93.3
KOG36161636 consensus Selective LIM binding factor [Transcript 92.96
KOG0310487 consensus Conserved WD40 repeat-containing protein 92.94
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 92.94
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 92.92
KOG2055514 consensus WD40 repeat protein [General function pr 92.92
KOG0646476 consensus WD40 repeat protein [General function pr 92.8
PF1463444 zf-RING_5: zinc-RING finger domain 92.74
KOG0293519 consensus WD40 repeat-containing protein [Function 92.63
PRK11788389 tetratricopeptide repeat protein; Provisional 92.57
KOG149384 consensus Anaphase-promoting complex (APC), subuni 92.41
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 92.34
KOG0278334 consensus Serine/threonine kinase receptor-associa 92.11
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 91.93
KOG0318603 consensus WD40 repeat stress protein/actin interac 91.69
KOG0283712 consensus WD40 repeat-containing protein [Function 91.34
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 91.27
KOG1274933 consensus WD40 repeat protein [General function pr 90.87
PTZ00420568 coronin; Provisional 90.71
KOG2076 895 consensus RNA polymerase III transcription factor 90.69
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 90.62
smart0050463 Ubox Modified RING finger domain. Modified RING fi 90.49
KOG0266456 consensus WD40 repeat-containing protein [General 90.43
KOG2076 895 consensus RNA polymerase III transcription factor 90.38
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 90.34
KOG0279315 consensus G protein beta subunit-like protein [Sig 90.21
KOG2321703 consensus WD40 repeat protein [General function pr 90.14
KOG4714319 consensus Nucleoporin [Nuclear structure] 90.12
PRK14720 906 transcript cleavage factor/unknown domain fusion p 90.07
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 90.06
KOG0647347 consensus mRNA export protein (contains WD40 repea 90.02
KOG20411189 consensus WD40 repeat protein [General function pr 89.68
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 89.64
KOG0288459 consensus WD40 repeat protein TipD [General functi 89.63
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 89.6
KOG0295406 consensus WD40 repeat-containing protein [Function 89.33
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.33
KOG0291893 consensus WD40-repeat-containing subunit of the 18 89.31
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 89.24
KOG0318603 consensus WD40 repeat stress protein/actin interac 89.21
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 89.19
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 89.18
KOG2321703 consensus WD40 repeat protein [General function pr 89.06
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 89.05
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 88.53
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 88.53
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 88.5
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 88.23
KOG2110391 consensus Uncharacterized conserved protein, conta 88.13
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 88.06
KOG4340459 consensus Uncharacterized conserved protein [Funct 87.8
KOG0270463 consensus WD40 repeat-containing protein [Function 87.76
KOG0288459 consensus WD40 repeat protein TipD [General functi 87.75
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 87.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 87.72
KOG0268433 consensus Sof1-like rRNA processing protein (conta 87.43
KOG1188376 consensus WD40 repeat protein [General function pr 87.36
PRK10049765 pgaA outer membrane protein PgaA; Provisional 87.18
PRK05137435 tolB translocation protein TolB; Provisional 86.86
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 86.85
KOG0275508 consensus Conserved WD40 repeat-containing protein 86.81
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 86.63
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 86.54
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 86.34
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 86.26
COG4946668 Uncharacterized protein related to the periplasmic 85.85
PF12816196 Vps8: Golgi CORVET complex core vacuolar protein 8 85.66
PRK03629429 tolB translocation protein TolB; Provisional 85.6
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 85.52
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 85.48
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 85.22
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.08
PF14779257 BBS1: Ciliary BBSome complex subunit 1 85.08
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 85.02
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 84.89
KOG0268433 consensus Sof1-like rRNA processing protein (conta 84.88
KOG0639705 consensus Transducin-like enhancer of split protei 84.65
KOG0282503 consensus mRNA splicing factor [Function unknown] 84.62
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 84.51
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 84.35
KOG0286343 consensus G-protein beta subunit [General function 84.24
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 83.93
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 83.71
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 83.71
KOG1407313 consensus WD40 repeat protein [Function unknown] 83.65
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 83.13
KOG4445 368 consensus Uncharacterized conserved protein, conta 82.99
KOG0293519 consensus WD40 repeat-containing protein [Function 82.9
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 82.89
KOG1407313 consensus WD40 repeat protein [Function unknown] 82.66
KOG0282503 consensus mRNA splicing factor [Function unknown] 82.61
KOG0641350 consensus WD40 repeat protein [General function pr 82.6
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 82.38
PRK04922433 tolB translocation protein TolB; Provisional 82.29
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 82.26
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 82.08
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 82.04
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 81.62
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 81.38
KOG0316307 consensus Conserved WD40 repeat-containing protein 81.06
PRK05137435 tolB translocation protein TolB; Provisional 81.0
PF1383866 Clathrin_H_link: Clathrin-H-link; PDB: 2XZG_A 3GD1 80.95
PRK15174656 Vi polysaccharide export protein VexE; Provisional 80.85
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 80.84
PF0830942 LVIVD: LVIVD repeat; InterPro: IPR013211 This repe 80.78
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 80.76
KOG0263707 consensus Transcription initiation factor TFIID, s 80.32
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=3.2e-126  Score=1082.15  Aligned_cols=835  Identities=42%  Similarity=0.686  Sum_probs=721.4

Q ss_pred             CcceehhHHHHHhhcCCCceeEEEEeCCEEEEEecCCeEEEEeC-CCCCceeeEcCCCCCCccceeEEEeCCCCCeEEEE
Q 002318            5 RQVFQVDVLERYAAKGRGVITCMSAGNDVIVLGTSKGWLIRHDF-GAGDSYDIDLSAGRPGEQSIHKVFVDPGGSHCIAT   83 (936)
Q Consensus         5 ~~~f~~~~~~~~~~~~~~~i~~l~v~~n~l~l~~~~g~l~ridl-~~~~~~~~~l~~~~~~~~~i~~i~lDp~G~hlli~   83 (936)
                      +++|..+.+...+|-  ..|.+++|++|++|+.+.   ++|  + .+.+..++++++..  .++++++|+||+|+|+++.
T Consensus        23 ~~~~s~~~~~~~~~~--~~~~~l~vs~~~~i~~l~---l~~--~~~~~~~~d~~l~k~~--~~~~~k~f~dp~Gs~i~ia   93 (911)
T KOG2034|consen   23 FLTFSREKIHLKVPS--EDIDQLAVSKNWLIMRLG---LLD--LGRANNPIDCELGKKL--EAKIHKMFLDPTGSHILIA   93 (911)
T ss_pred             hhhccccceEEecCC--ccceeEEeecceEEEEee---ccc--cCCCCCccccccccee--cceeeEEEeCCCCcEEEEE
Confidence            345555555554442  236777777777777766   333  6 56656677777654  4699999999999999999


Q ss_pred             eecCCCccEEEEecCCCCceeccCCCCceEEEEEecCCCCCCCCcceEEEEcCCCcEEEEEEecCCcccceeeEEeeeC-
Q 002318           84 IVGSGGAETFYTHAKWSKPRVLSKLKGLVVNAVAWNRQQITEASTKEIILGTDTGQLHEMAVDEKDKREKYIKLLFELN-  162 (936)
Q Consensus        84 ~~~~~~g~~~Y~~~~~~k~k~L~klkg~~I~sVaw~~~~~~~~st~~iLiGt~~G~i~e~~i~~~~~~~~~~k~v~~l~-  162 (936)
                      ++   ++.++|+|.. .|+|.|+|+||+.|++|+|.   .++++|+++++||.+|.++|..+...++...+.+.++.+- 
T Consensus        94 ~~---s~~~m~t~~~-~k~r~Ltk~k~~~veav~w~---ite~st~~~li~t~qg~~~e~~~~~~~~~~~q~~~l~~l~~  166 (911)
T KOG2034|consen   94 TT---STEYLYTHDN-QKVRVLTKLKGQLVEAVAWW---ITESSTLPILIGTIQGFIFELELPKNKKGIAQIKRLINLIL  166 (911)
T ss_pred             ec---CCceEEeccc-CceeeHHHHhhhhHHHHHhh---ccCCCchhhhhccccceEEEeccCccccchhhHHHHHhhhc
Confidence            99   7899999987 78999999999999999994   6788999999999999999999877654444444444332 


Q ss_pred             -CCCCceeeEEEEeeccCCCceEEEEEECCCeEEEEecC-----CchHHHHhhhhcccccccccCCCcCCCcceeee---
Q 002318          163 -ELPEAFMGLQMETASLSNGTRYYVMAVTPTRLYSFTGF-----GSLDTVFASYLDRAVHFMELPGEILNSELHFFI---  233 (936)
Q Consensus       163 -~~~~~I~gi~~~~~~~~~~~~~~i~ast~~rly~f~~~-----~~l~~~f~~~~~~~~~~~el~~~~~~s~~~~~~---  233 (936)
                       ..|.||.++.-.       +|++++++|+.|+|.|.++     .+|...|..|.+.++++.+.+.+.+.+.+.+++   
T Consensus       167 ~~e~~pv~~Le~~-------~r~~~~~tt~q~il~f~~t~~a~~~~f~~~f~~~~~~~h~i~s~k~~~~~~~~~f~~~~~  239 (911)
T KOG2034|consen  167 SNEPAPVVKLEGE-------RRYFVSATTPQRILMFLATEGAEFTSFSPFFAGYMELEHPIRSFKSDEGFSNLRFSTMPK  239 (911)
T ss_pred             cCCCCceeeeccc-------cceEEEEechhhhHhhHhhhcCcccccchhhhcccccCCccccccchhhhhhheeecCCc
Confidence             226778766643       4899999999999999865     357788888877767777766655555555543   


Q ss_pred             ccCCCceEEEeecCceEEEEeccCCCCCCCCCCCccccccccccccccCCCCCCCCccccccCCceEEEEECCEEEEEec
Q 002318          234 KQRRAVHFAWLSGAGIYHGGLNFGAQRSSPNGDENFVENKALLSYSKLSEGAEAVKPGSMAVSEYHFLLLMGNKVKVVNR  313 (936)
Q Consensus       234 ~~~~~~~faW~t~~gi~~g~i~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~p~si~lT~fHillL~~~~l~ivn~  313 (936)
                      ..+.|..+||+++.||-+|.+....+++     ...+.+.-.++++ +.+++..++|.+|++|+||++||+.|++.+||+
T Consensus       240 ~~a~pk~~aw~~~~gi~~G~~~~~~n~~-----~~ll~~e~~~e~~-~~eg~~~~~p~~ivLT~yH~LLl~~d~V~avs~  313 (911)
T KOG2034|consen  240 NIAEPKTWAWKSPDGINFGNVNIYANRD-----QDLLEEEFNIELP-LGEGRKLEPPKAIVLTEFHFLLLYADRVLAVSL  313 (911)
T ss_pred             cchhHHHHHhhCCCcceeccccccCCch-----HHHHHHhhhhccc-cccCCCCCCcceehHHHHHHHHHhcCceeeeec
Confidence            2356899999999999999887643221     1122221112222 223333467999999999999999999999999


Q ss_pred             CCCcEEEEEEecCCCCCcccceeEEEeecCCCeEEEEeCCcEEEEEcccchhhHHHHHHchhhHHHHHHhcCC-hhhHHH
Q 002318          314 ISEQIIEELQFDQTSDSISRGIIGLCSDATAGVFYAYDQNSIFQVSVNDEGRDMWKVYLDMKEYAAALANCRD-PLQRDQ  392 (936)
Q Consensus       314 l~~~vv~~~~~~~~~~~~~~~~~gl~~D~~~~~~~i~S~~~i~~~~~~~e~~~~W~~ll~~~~f~~Al~~~~~-~~~~~~  392 (936)
                      +|+++|+++.++.   +..|.++|+|+|...++||+||.+.++++.+.+|.|++|+.|+++|+|++|+++|++ |..++.
T Consensus       314 Ln~~vI~~~~~n~---s~~g~~LGlv~D~va~~~w~YTq~~vf~~~vndE~R~vWk~yLd~g~y~kAL~~ar~~p~~le~  390 (911)
T KOG2034|consen  314 LNGEVIYRDQFNE---SELGGILGLVSDSVAETFWLYTQTSVFEYGVNDEARDVWKTYLDKGEFDKALEIARTRPDALET  390 (911)
T ss_pred             cCccccchhccCc---hhcccceeeeeccccceEEEEEeceeeeeeeccchHHHHHHHHhcchHHHHHHhccCCHHHHHH
Confidence            9999999999964   247899999999999999999999999999999999999999999999999999997 589999


Q ss_pred             HHHHHHHHHHhcCCHHHHHHHHHHhcCCCChHHHHHHhcCcChHHHHHHHHHHHhhcccCchhHHHHHHHHHHHHHHHHH
Q 002318          393 VYLVQAEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDK  472 (936)
Q Consensus       393 I~~~~~~~L~~~g~y~~Aa~~y~~~~~~~~~E~v~lkFl~~~~~~~L~~YL~~~l~~l~~~~~~~~~lL~~Wl~ely~~~  472 (936)
                      |+.+|||++|+.++|..||++||++.  .+||+|+|||+..++.++|..||.+||+++++.+++|+++|++|++|+|+.+
T Consensus       391 Vl~~qAdf~f~~k~y~~AA~~yA~t~--~~FEEVaLKFl~~~~~~~L~~~L~KKL~~lt~~dk~q~~~Lv~WLlel~L~~  468 (911)
T KOG2034|consen  391 VLLKQADFLFQDKEYLRAAEIYAETL--SSFEEVALKFLEINQERALRTFLDKKLDRLTPEDKTQRDALVTWLLELYLEQ  468 (911)
T ss_pred             HHHHHHHHHHhhhHHHHHHHHHHHhh--hhHHHHHHHHHhcCCHHHHHHHHHHHHhhCChHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999998  8999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhcccchhhccchHHHHHHHHHHHHHHhcccccCCHHHHHHHHHHcCChhHHHHHHHhhhhHHHHHHHHHhcccHHH
Q 002318          473 INRLLLEDDTALENRSSEYQSIMREFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKK  552 (936)
Q Consensus       473 l~~~~~e~~~~~~~~~~~~~~~~~~l~~fl~~~~~~ld~~tv~~ll~~~g~~e~~l~~a~~~~dy~~ll~~yi~~~~~~~  552 (936)
                      ||+++..+....++...+++....+|..|+..++..+|.+++|+++.+||+.+++++||.+++||+.|+.+|+++++|++
T Consensus       469 Ln~l~~~de~~~en~~~~~~~~~re~~~~~~~~~~~~nretv~~l~~~~~~~e~ll~fA~l~~d~~~vv~~~~q~e~yee  548 (911)
T KOG2034|consen  469 LNDLDSTDEEALENWRLEYDEVQREFSKFLVLHKDELNRETVYQLLASHGRQEELLQFANLIKDYEFVVSYWIQQENYEE  548 (911)
T ss_pred             HhcccccChhHHHHHHHHHHHHHHHHHHHHHhhHHhhhHHHHHHHHHHccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99996444344456667778888889999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCCchhhHHhhHHHHHhHChHHHHHHHHccCCCCCCcchhHhhhcCCCCCCCCChHHHHHHHHHHHhhcCCCC
Q 002318          553 ALQMLRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNED  632 (936)
Q Consensus       553 AL~~L~~~~d~~~li~k~~~~Ll~~~p~~ti~ll~~~~~ld~~~li~~L~~~~~~~~~~~~~~~~~~YLe~li~~~~~~~  632 (936)
                      ||++|.++.+ .++.|+|++.|+.+.|.+||+.|++.+.++|.+++|.+++|....+.....+.+++||++|+...+..+
T Consensus       549 aLevL~~~~~-~el~yk~ap~Li~~~p~~tV~~wm~~~d~~~~~li~~~L~~~~~~~~~~~~~~~i~yl~f~~~~l~~~~  627 (911)
T KOG2034|consen  549 ALEVLLNQRN-PELFYKYAPELITHSPKETVSAWMAQKDLDPNRLIPPILSYFSNWHSEYEENQAIRYLEFCIEVLGMTN  627 (911)
T ss_pred             HHHHHHhccc-hhhHHHhhhHHHhcCcHHHHHHHHHccccCchhhhHHHHHHHhcCCccccHHHHHHHHHHHHHhccCcC
Confidence            9999999966 699999999999999999999999999999999999999998777766788999999999999999999


Q ss_pred             HhHHHHHHHHhhcCCChHHHHHHHHHhhCCCCCCCCcccCChHHHHHHHHhcCcceeeehhhhccccHHHHHHHHHhcCH
Q 002318          633 PGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDP  712 (936)
Q Consensus       633 ~~~hn~ll~Ly~~~~~~~~Ll~fL~~~~~~~~~~~~~~~yd~~~aLrlc~~~~~~~~~v~L~~~~g~~~eAl~l~l~~di  712 (936)
                      +.+||.++.||+++. ++.++.+|... +.   .+...+||+++|+|+|.+++..+++|+||++|++|++||++|++.|+
T Consensus       628 ~~ihn~ll~lya~~~-~~~ll~~le~~-~~---~~~~~~YDl~~alRlc~~~~~~ra~V~l~~~l~l~~~aVdlAL~~d~  702 (911)
T KOG2034|consen  628 PAIHNSLLHLYAKHE-RDDLLLYLEII-KF---MKSRVHYDLDYALRLCLKFKKTRACVFLLCMLNLFEDAVDLALQFDI  702 (911)
T ss_pred             HHHHHHHHHHhhcCC-ccchHHHHHHH-hh---ccccceecHHHHHHHHHHhCccceeeeHHHHHHHHHHHHHHHhhcCH
Confidence            999999999999987 56777777765 11   12237899999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhccCCCHHHHHHHHHHHHHHHhhcccCCChHhHHHHHHHHHhcCCccccccccCcCCCCcchhHHHHHHHHHH
Q 002318          713 ELAMAEADKVEDDEDLRKKLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSL  792 (936)
Q Consensus       713 ~lA~~~a~~~~~d~~~~kkLWl~ll~~~i~~~~~~~~~~i~~~l~~L~~~~~~L~i~diL~~~p~~~~I~~~Kd~I~~~L  792 (936)
                      ++|+..|+.+++|+++||+||+++++|++.+.     .++++++.+|+++ ++|+|+|+||+|||+++|++||+.||+.|
T Consensus       703 dlak~~A~~~ee~e~lrKkLWLkIAkh~v~~~-----~~ikk~i~~Lk~~-~lLkiedlLpffpdf~~id~~keaic~~L  776 (911)
T KOG2034|consen  703 DLAKVIANDPEEDEDLRKKLWLKIAKHVVKQE-----NDIKKAIRFLKEN-ELLTIEDLLPFFPDFTKIDNLKEAICDFL  776 (911)
T ss_pred             HHHhhhhcChhhHHHHHHHHHHHHHHHHHHhh-----ccHHHHHHHhccC-cccchhhhhccccchhhhhhhHHHHHHHH
Confidence            99999999999999999999999999999885     5899999999995 69999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccEeecccccccccchhhhhcccccccccccCCCCCCCCEEEEcCCC
Q 002318          793 DDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDEDCGVCRRKILVAGRDYRMARGYASVGPMAPFYVFPCGH  872 (936)
Q Consensus       793 ~~y~~~i~~l~~~m~~~~~~~~~i~~~i~~~~~r~~~i~~~~~C~~C~k~L~~~~~~~~~~~~~~~~~~~~~fvvFpCgH  872 (936)
                      ++|+.+|++++.+|.+++..+..|+.+++++++||.+++|++.|.+|+++|..     +            ||+||||||
T Consensus       777 ~~~n~rieel~~em~eat~~a~~I~~~~~~l~~ry~v~ep~d~C~~C~~~ll~-----~------------pF~vf~CgH  839 (911)
T KOG2034|consen  777 EDYNKRIEELQEEMIEATELADEIRTEISKLRQRYRVLEPQDSCDHCGRPLLI-----K------------PFYVFPCGH  839 (911)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhcceEEecCccchHHhcchhhc-----C------------cceeeeccc
Confidence            99999999999999999999999999999999999999999999999999999     7            999999999


Q ss_pred             hhHHHhHHHHHhhcCCcc---------chHHHHHHHhhh
Q 002318          873 AFHAQCLIAHVTQCTNET---------QVSVVDIVLSYK  902 (936)
Q Consensus       873 ~fH~~CL~~~~~~~~~~~---------~~~~~~~~~~~~  902 (936)
                      +||.+|+...+.+.++.+         +.+++++...++
T Consensus       840 ~FH~~Cl~~~v~~~~~~~~~~~~a~~l~~k~~~l~~~l~  878 (911)
T KOG2034|consen  840 CFHRDCLIRHVLSLLSEELSQKTAIELQAKRKKLKNELE  878 (911)
T ss_pred             hHHHHHHHHHHHccccHhhhhhhhhhhhhHHHHHHHHHH
Confidence            999999999998887754         345666666666

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05131 Pep3_Vps18: Pep3/Vps18/deep orange family; InterPro: IPR007810 This region is found in a number of proteins identified as being involved in Golgi function and vacuolar sorting Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10366 Vps39_1: Vacuolar sorting protein 39 domain 1; InterPro: IPR019452 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF12816 Vps8: Golgi CORVET complex core vacuolar protein 8 Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14779 BBS1: Ciliary BBSome complex subunit 1 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13838 Clathrin_H_link: Clathrin-H-link; PDB: 2XZG_A 3GD1_I 1BPO_C 1C9I_B 1C9L_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF08309 LVIVD: LVIVD repeat; InterPro: IPR013211 This repeat is found in bacterial and archaeal cell surface proteins, many of which are hypothetical Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query936
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-06
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 1e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 78.4 bits (192), Expect = 7e-15
 Identities = 93/659 (14%), Positives = 181/659 (27%), Gaps = 211/659 (32%)

Query: 295 VSEYHFLLLMGNKVKVVNRISEQIIEELQFDQTSDSISRGI--------IGLCSDATAGV 346
             E+ +      K  +++   +  ++        D   + I        I +  DA +G 
Sbjct: 11  TGEHQY----QYK-DILSVFEDAFVDNFDCKDVQDMP-KSILSKEEIDHIIMSKDAVSGT 64

Query: 347 FYAYD-----QNSIFQVSVNDEGRDMWKVYLDMKEY---AAALAN-CRDPLQRDQVYLVQ 397
              +      Q  + Q  V +         +    Y    + +    R P    ++Y+ Q
Sbjct: 65  LRLFWTLLSKQEEMVQKFVEE---------VLRINYKFLMSPIKTEQRQPSMMTRMYIEQ 115

Query: 398 AEAAFATKDFHRAASFYAKINYILSFEEITLKFISVSEQDALRTFL--LRKLDNL----- 450
            +        +     +AK N +   +              LR  L  LR   N+     
Sbjct: 116 RDR------LYNDNQVFAKYN-VSRLQPYL----------KLRQALLELRPAKNVLIDGV 158

Query: 451 ------------AKDDKCQITM---ISTWAT-------ELYLDKINRLLLEDDTALENRS 488
                           K Q  M   I  W         E  L+ + +LL + D    +RS
Sbjct: 159 LGSGKTWVALDVCLSYKVQCKMDFKIF-WLNLKNCNSPETVLEMLQKLLYQIDPNWTSRS 217

Query: 489 SEYQSIMR-------EFRAFLS-----DCKDVLDEATTMKLLESYG---------RVEEL 527
               +I         E R  L      +C  VL      K   ++          R +++
Sbjct: 218 DHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQV 277

Query: 528 VFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQ------YKFAPDLIML---- 577
             F S      I + H+       +   +L K  +    Q          P  + +    
Sbjct: 278 TDFLSAATTTHISLDHHSMTLTPDEVKSLLLK-YLDCRPQDLPREVLTTNPRRLSIIAES 336

Query: 578 --------DAYETVESW-------MTTNNLNP---RKL------------IPA--MMRYS 605
                   D ++ V           + N L P   RK+            IP   +    
Sbjct: 337 IRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIW 396

Query: 606 SEPHAKNETHEVIKYLEFCVHR-LHNEDP-----GVHNLLLSLYAKQEDDSALLRFLQCK 659
            +        +V+  +       L  + P      + ++ L L  K E++ AL R +   
Sbjct: 397 FDV----IKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDH 452

Query: 660 FGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAEA 719
           +   +       +D    +   L +       + Y  +  H               +   
Sbjct: 453 YNIPKT------FDSDDLIPPYLDQ-------YFYSHIGHH---------------LKNI 484

Query: 720 DKVEDDEDLRKKL----WLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFF 775
           +  E     R       +L        ++K      IR        +  +L         
Sbjct: 485 EHPERMTLFRMVFLDFRFL--------EQK------IRHDSTAWNASGSIL--------- 521

Query: 776 PDFALIDDFKEAICSSLDDYNKQIEQLKQEMNDATHGADNIRNDISALAQRYAVIDRDE 834
                +  +K  IC +   Y + +  +   +       + I +  + L +  A++  DE
Sbjct: 522 NTLQQLKFYKPYICDNDPKYERLVNAILDFL--PKIEENLICSKYTDLLRI-ALMAEDE 577
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query936
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.41
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.19
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.19
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.61
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 98.32
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.24
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.19
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 98.02
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 98.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.84
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.83
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.82
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.81
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.81
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.78
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.75
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.75
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.73
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.73
3jrp_A379 Fusion protein of protein transport protein SEC13 97.72
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.72
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.68
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.67
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.66
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.66
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.63
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.62
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.6
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.59
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.59
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.58
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.57
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.55
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.52
3jrp_A379 Fusion protein of protein transport protein SEC13 97.49
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.49
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.49
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.47
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.47
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.46
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.44
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 97.44
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.43
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.42
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.41
3jro_A753 Fusion protein of protein transport protein SEC13 97.41
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.41
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.4
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.38
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.37
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.36
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.34
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.33
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.32
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.31
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.3
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.27
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.27
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.26
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.26
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.26
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.26
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.24
2ymu_A577 WD-40 repeat protein; unknown function, two domain 97.24
4e54_B435 DNA damage-binding protein 2; beta barrel, double 97.24
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.24
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.23
2pm7_B297 Protein transport protein SEC13, protein transport 97.23
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.19
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.17
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.16
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.16
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.13
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.13
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.1
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.09
2ymu_A577 WD-40 repeat protein; unknown function, two domain 97.07
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.06
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.05
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.03
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.02
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 96.99
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.99
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.97
3jro_A753 Fusion protein of protein transport protein SEC13 96.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.95
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.95
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.93
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.93
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.88
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 96.86
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.85
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 96.85
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.85
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.85
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.83
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.81
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 96.76
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 96.69
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.69
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.68
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 96.68
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.63
2pm7_B297 Protein transport protein SEC13, protein transport 96.61
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.56
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.53
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.51
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 96.5
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.44
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.37
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.36
2gw1_A514 Mitochondrial precursor proteins import receptor; 96.32
2ecm_A55 Ring finger and CHY zinc finger domain- containing 96.31
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.24
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.2
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.19
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.16
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.14
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.13
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 96.12
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.12
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 96.1
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.06
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 96.05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 96.02
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 96.02
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 95.96
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 95.95
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.94
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.9
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 95.9
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 95.87
2ysj_A63 Tripartite motif-containing protein 31; ring-type 95.83
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.76
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 95.74
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 95.73
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.7
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 95.68
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.65
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.63
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 95.63
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 95.56
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 95.51
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 95.44
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 95.44
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 95.39
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 95.38
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 95.34
2ect_A78 Ring finger protein 126; metal binding protein, st 95.33
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 95.33
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.32
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.23
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 95.12
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 95.11
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 95.1
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.06
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 95.05
2ysl_A73 Tripartite motif-containing protein 31; ring-type 94.99
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.97
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 94.93
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 94.92
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.91
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 94.87
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.77
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 94.74
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 94.74
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 94.72
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 94.67
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 94.67
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 94.66
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 94.66
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 94.56
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 94.56
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 94.43
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.43
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 94.42
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 94.39
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.25
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 94.24
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 94.22
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 94.19
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 94.15
2ecw_A85 Tripartite motif-containing protein 30; metal bind 94.14
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 94.05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 94.01
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 93.96
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.95
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 93.93
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 93.92
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.82
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 93.56
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 93.48
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.4
3v9f_A781 Two-component system sensor histidine kinase/RESP 93.35
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 93.35
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 93.23
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.16
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 93.15
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 93.1
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 92.95
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 92.93
4eqf_A365 PEX5-related protein; accessory protein, tetratric 92.81
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 92.72
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 92.63
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 92.62
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 92.61
3ott_A758 Two-component system sensor histidine kinase; beta 92.42
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 92.39
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 92.38
2gw1_A514 Mitochondrial precursor proteins import receptor; 92.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 92.22
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 92.21
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 92.18
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 92.01
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 91.95
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 91.85
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 91.69
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 91.58
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 91.5
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 91.45
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 91.44
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 91.37
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 91.2
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 91.16
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 91.05
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 90.83
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 90.59
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 90.56
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 90.52
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 90.49
3u4t_A272 TPR repeat-containing protein; structural genomics 90.46
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 90.46
1z6u_A150 NP95-like ring finger protein isoform B; structura 90.27
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 90.13
2f42_A179 STIP1 homology and U-box containing protein 1; cha 90.12
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 90.11
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 90.09
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 90.02
3ott_A758 Two-component system sensor histidine kinase; beta 90.01
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 89.68
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 89.66
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 89.62
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 89.62
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 89.6
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 89.56
4eqf_A365 PEX5-related protein; accessory protein, tetratric 89.54
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 89.42
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 89.16
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 89.02
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 88.95
1k32_A1045 Tricorn protease; protein degradation, substrate g 88.95
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 88.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 88.89
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 88.75
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 88.74
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 88.64
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 88.45
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 88.42
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 88.07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 88.0
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 87.98
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 87.96
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 87.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 87.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 87.51
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 87.46
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 87.03
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 86.94
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 86.81
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 86.79
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 86.77
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 86.77
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal do 86.76
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 86.59
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 86.41
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 85.9
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-i 85.77
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 85.5
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 85.27
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 85.21
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 85.2
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 85.16
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 85.08
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 84.89
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 84.77
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 84.64
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 84.31
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 84.02
3q15_A378 PSP28, response regulator aspartate phosphatase H; 83.99
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 82.93
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 82.65
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 82.64
3q15_A378 PSP28, response regulator aspartate phosphatase H; 81.99
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 81.94
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 81.87
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 81.38
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 81.37
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 81.01
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 80.94
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 80.8
4d9s_A406 UVB-resistance protein UVR8; UV resistance, UV-B p 80.65
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 80.32
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 80.28
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 80.09
4i17_A228 Hypothetical protein; TPR repeats protein, structu 80.06
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
Probab=99.41  E-value=4.7e-11  Score=148.60  Aligned_cols=372  Identities=14%  Similarity=0.104  Sum_probs=249.8

Q ss_pred             hhHHHHHHchhhHHHHHHhcCC---h--h---------------------hHHHHHHHHHHHHHhcCCHHHHHHHHHHhc
Q 002318          365 RDMWKVYLDMKEYAAALANCRD---P--L---------------------QRDQVYLVQAEAAFATKDFHRAASFYAKIN  418 (936)
Q Consensus       365 ~~~W~~ll~~~~f~~Al~~~~~---~--~---------------------~~~~I~~~~~~~L~~~g~y~~Aa~~y~~~~  418 (936)
                      ..+..++.+.|+|++|.++-+.   .  +                     ....+..++|..+...|+|.+|+..|.+..
T Consensus      1053 ~eIA~Iai~lglyEEAf~IYkKa~~~~~A~~VLie~i~nldrAiE~Aervn~p~vWsqLAKAql~~G~~kEAIdsYiKAd 1132 (1630)
T 1xi4_A         1053 PDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKAD 1132 (1630)
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHcCCHHHHHHHHHHHHhhHHHHHHHHHhcCCHHHHHHHHHHHHhCCCHHHHHHHHHhcC
Confidence            4567788888999998887441   0  0                     124788899999999999999999999987


Q ss_pred             CCCChHHHHHHhcCcChHHHHHHHHHHHhhcccCchhHHHHHHHHHHHHHHHHHHhhhhcccchhhccchHHHHHHHHHH
Q 002318          419 YILSFEEITLKFISVSEQDALRTFLLRKLDNLAKDDKCQITMISTWATELYLDKINRLLLEDDTALENRSSEYQSIMREF  498 (936)
Q Consensus       419 ~~~~~E~v~lkFl~~~~~~~L~~YL~~~l~~l~~~~~~~~~lL~~Wl~ely~~~l~~~~~e~~~~~~~~~~~~~~~~~~l  498 (936)
                      +...|.+|+..+.+.++.+.+..||..-....+ +     ..+-+|+...|-. ++++                   +++
T Consensus      1133 D~say~eVa~~~~~lGkyEEAIeyL~mArk~~~-e-----~~Idt~LafaYAK-l~rl-------------------eel 1186 (1630)
T 1xi4_A         1133 DPSSYMEVVQAANTSGNWEELVKYLQMARKKAR-E-----SYVETELIFALAK-TNRL-------------------AEL 1186 (1630)
T ss_pred             ChHHHHHHHHHHHHcCCHHHHHHHHHHHHhhcc-c-----ccccHHHHHHHHh-hcCH-------------------HHH
Confidence            667888999999999999999999986443221 1     1234456666642 2322                   245


Q ss_pred             HHHHhcccccCCHHHHHHHHHHcCChhHHHHHHHhhhhHHHHHHHHHhcccHHHHHHHHhCCCCchhhHHhhHHHHHhHC
Q 002318          499 RAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLIMLD  578 (936)
Q Consensus       499 ~~fl~~~~~~ld~~tv~~ll~~~g~~e~~l~~a~~~~dy~~ll~~yi~~~~~~~AL~~L~~~~d~~~li~k~~~~Ll~~~  578 (936)
                      ..|+..... -+...+-+.+.+.|++++|+.+....++|..++..|++.|+|++|++...+-.+ .+.+.+.+...++..
T Consensus      1187 e~fI~~~n~-ad~~~iGd~le~eg~YeeA~~~Y~kA~ny~rLA~tLvkLge~q~AIEaarKA~n-~~aWkev~~acve~~ 1264 (1630)
T 1xi4_A         1187 EEFINGPNN-AHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANS-TRTWKEVCFACVDGK 1264 (1630)
T ss_pred             HHHHhCCCH-HHHHHHHHHHHhcCCHHHHHHHHHhhhHHHHHHHHHHHhCCHHHHHHHHHHhCC-HHHHHHHHHHHhhhh
Confidence            666653321 122345667889999999999999999999999999999999999999988766 355554444443211


Q ss_pred             h-HHHHHHHHccCCCCCCcchhHhhhcCCCCCCCCChHHHHHHHHHHHhhcCCCCHhHHHHHHHHhhcCCChHHHHHHHH
Q 002318          579 A-YETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQ  657 (936)
Q Consensus       579 p-~~ti~ll~~~~~ld~~~li~~L~~~~~~~~~~~~~~~~~~YLe~li~~~~~~~~~~hn~ll~Ly~~~~~~~~Ll~fL~  657 (936)
                      - ..+....+. -..+|+.+ +.+..|....   ..-+++++++|.-+.-. ..-..+++.+-.||+++. ++++++.++
T Consensus      1265 Ef~LA~~cgl~-Iiv~~deL-eeli~yYe~~---G~feEAI~LlE~aL~Le-raH~gmftELaiLyaKy~-peklmEhlk 1337 (1630)
T 1xi4_A         1265 EFRLAQMCGLH-IVVHADEL-EELINYYQDR---GYFEELITMLEAALGLE-RAHMGMFTELAILYSKFK-PQKMREHLE 1337 (1630)
T ss_pred             HHHHHHHHHHh-hhcCHHHH-HHHHHHHHHc---CCHHHHHHHHHHHhccC-hhHhHHHHHHHHHHHhCC-HHHHHHHHH
Confidence            1 111111111 11233332 2332222111   24567999999877543 233567778888999998 689999998


Q ss_pred             HhhCCCCCCCCcccCChHHHHHHHHhcCcceeeehhhhccccHHHHHHHHHhc-----CHHHHHHHhhccCCCHHHHHHH
Q 002318          658 CKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQV-----DPELAMAEADKVEDDEDLRKKL  732 (936)
Q Consensus       658 ~~~~~~~~~~~~~~yd~~~aLrlc~~~~~~~~~v~L~~~~g~~~eAl~l~l~~-----di~lA~~~a~~~~~d~~~~kkL  732 (936)
                      -..         ..-+..+++|.|.+...+.+.|+||.+-|.|+.|+..++++     +-+.-++.+.+.. +.+    |
T Consensus      1338 ~f~---------~rini~k~~r~~e~~~lW~elv~LY~~~~e~dnA~~tm~~h~~~a~~~~~Fk~~i~kv~-n~e----l 1403 (1630)
T 1xi4_A         1338 LFW---------SRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVA-NVE----L 1403 (1630)
T ss_pred             HHH---------HhcccchHhHHHHHHHHHHHHHHHHHhcccHHHHHHHHHhccHhhhhhHHHHHHhcccc-cHH----H
Confidence            873         35678899999999999999999999999999999888873     2334444554544 565    8


Q ss_pred             HHHHHHHHhhcccCCChHhHHHHHHHHHhcCCccccccccCcCCCCcchhHHHHHHHHHH
Q 002318          733 WLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSL  792 (936)
Q Consensus       733 Wl~ll~~~i~~~~~~~~~~i~~~l~~L~~~~~~L~i~diL~~~p~~~~I~~~Kd~I~~~L  792 (936)
                      +-+.+.+.+....    ..+..++..|   .|.+....+..++-..-.++-+|.++...-
T Consensus      1404 yykai~Fyl~~~P----~~lndLl~~l---~~rlD~~R~V~l~~~~~~l~lik~yl~~vq 1456 (1630)
T 1xi4_A         1404 YYRAIQFYLEFKP----LLLNDLLMVL---SPRLDHTRAVNYFSKVKQLPLVKPYLRSVQ 1456 (1630)
T ss_pred             HHHHHHHHHhhCh----HHHHHHHHHh---hhcCChHHHHHHHHHcCChHHhHHHHHHHH
Confidence            8888888886532    3344444444   234444444444443444555666554443
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 936
d1b89a_336 a.118.1.3 (A:) Clathrin heavy chain proximal leg s 2e-27
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.001
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Clathrin heavy chain proximal leg segment
domain: Clathrin heavy chain proximal leg segment
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  112 bits (282), Expect = 2e-27
 Identities = 42/340 (12%), Positives = 94/340 (27%), Gaps = 36/340 (10%)

Query: 497 EFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQM 556
           E   F++   +                 +      +       +    +  GE + A+  
Sbjct: 4   ELEEFINGPNNA-HIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDG 62

Query: 557 LRKPAVPIDLQYKFAPDLIMLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHE 616
            RK         +     +    +   +       ++  +L   +  Y    +      E
Sbjct: 63  ARKANST-RTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGY----FEE 117

Query: 617 VIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRFLQCKFGKGRENGPEFFYDPKY 676
           +I  LE  +  L     G+   L  LY+K      +   L+  + +          +   
Sbjct: 118 LITMLEAALG-LERAHMGMFTELAILYSKF-KPQKMREHLELFWSR---------VNIPK 166

Query: 677 ALRLCLKEKRMRACVHIYGMMSMHEEAVALALQVDPELAMAE-----ADKVEDDEDLRKK 731
            LR   +       V +Y     ++ A+   +    +            KV + E     
Sbjct: 167 VLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVE----- 221

Query: 732 LWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICS- 790
           L+    +  +E     K   +   +  L       +  +         L+  +  ++ + 
Sbjct: 222 LYYRAIQFYLEF----KPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNH 277

Query: 791 SLDDYNKQIEQLKQEMNDATHGADNIRN----DISALAQR 826
           +    N+ +  L     D      +I      D  +LAQR
Sbjct: 278 NNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQR 317
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query936
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 99.81
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.94
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.91
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.81
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.65
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.64
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.45
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 97.26
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.2
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.08
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.06
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.98
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.94
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.83
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.78
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 96.74
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.72
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.58
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 95.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 95.87
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 95.87
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.78
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.65
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 95.46
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.42
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 95.29
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.24
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 94.85
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.74
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 94.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.11
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 94.09
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.67
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 93.37
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 93.26
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 93.07
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 92.96
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 92.67
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 92.34
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 92.2
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.82
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 91.74
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 91.73
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 91.6
d1bpoa1157 Clathrin heavy-chain linker domain {Rat (Rattus no 91.53
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 91.06
d2c2la280 STIP1 homology and U box-containing protein 1, STU 90.94
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 90.0
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 89.44
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 88.52
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 86.48
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 85.73
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 84.94
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 83.17
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 82.95
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 81.6
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Clathrin heavy chain proximal leg segment
domain: Clathrin heavy chain proximal leg segment
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.81  E-value=1.3e-19  Score=196.98  Aligned_cols=270  Identities=13%  Similarity=0.088  Sum_probs=205.7

Q ss_pred             HHHHHHHhcccccCCHHHHHHHHHHcCChhHHHHHHHhhhhHHHHHHHHHhcccHHHHHHHHhCCCCchhhHHhhHHHHH
Q 002318          496 REFRAFLSDCKDVLDEATTMKLLESYGRVEELVFFASLKEQHEIVVHHYIQQGEAKKALQMLRKPAVPIDLQYKFAPDLI  575 (936)
Q Consensus       496 ~~l~~fl~~~~~~ld~~tv~~ll~~~g~~e~~l~~a~~~~dy~~ll~~yi~~~~~~~AL~~L~~~~d~~~li~k~~~~Ll  575 (936)
                      ++++.||+.+. ..|...|.+.|.+.|.++.|..++...+||+.++..|++.++|..|++++.+.+. .++++++.++++
T Consensus         3 ~~~e~fl~~~n-~~d~~~i~~~c~~~~lye~A~~lY~~~~d~~rl~~~~v~l~~~~~avd~~~k~~~-~~~~k~~~~~l~   80 (336)
T d1b89a_           3 AELEEFINGPN-NAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANS-TRTWKEVCFACV   80 (336)
T ss_dssp             HHHTTTTTCC-----------------CTTTHHHHHHHTTCHHHHHHHHHTTTCHHHHHHHHHHHTC-HHHHHHHHHHHH
T ss_pred             hhHHHHHcCCC-cCCHHHHHHHHHHCCCHHHHHHHHHhCCCHHHHHHHHHhhccHHHHHHHHHHcCC-HHHHHHHHHHHH
Confidence            45777887653 5588999999999999999999999999999999999999999999999999887 689999999999


Q ss_pred             hHChHHHHHHHHccCCCCCCcchhHhhhcCCCCCCCCChHHHHHHHHHHHhhcCCCCHhHHHHHHHHhhcCCChHHHHHH
Q 002318          576 MLDAYETVESWMTTNNLNPRKLIPAMMRYSSEPHAKNETHEVIKYLEFCVHRLHNEDPGVHNLLLSLYAKQEDDSALLRF  655 (936)
Q Consensus       576 ~~~p~~ti~ll~~~~~ld~~~li~~L~~~~~~~~~~~~~~~~~~YLe~li~~~~~~~~~~hn~ll~Ly~~~~~~~~Ll~f  655 (936)
                      ++.+.++..+.-....++++.+.+.+..|...    ...+.++.||+.++.. ...+..+|+.|+.|||+++ ++++++|
T Consensus        81 ~~~e~~la~i~~~~~~~~~d~l~~~v~~ye~~----~~~e~Li~~Le~~~~~-~~~~~~~~~~L~~lyak~~-~~kl~e~  154 (336)
T d1b89a_          81 DGKEFRLAQMCGLHIVVHADELEELINYYQDR----GYFEELITMLEAALGL-ERAHMGMFTELAILYSKFK-PQKMREH  154 (336)
T ss_dssp             HTTCHHHHHHTTTTTTTCHHHHHHHHHHHHHT----TCHHHHHHHHHHHTTS-TTCCHHHHHHHHHHHHTTC-HHHHHHH
T ss_pred             hCcHHHHHHHHHHHhhcCHHHHHHHHHHHHHc----CChHHHHHHHHHHHcC-CccchHHHHHHHHHHHHhC-hHHHHHH
Confidence            99998876664333467888887777766432    2467899999998854 4567889999999999998 7999999


Q ss_pred             HHHhhCCCCCCCCcccCChHHHHHHHHhcCcceeeehhhhccccHHHHHHHHHhc--C---HHHHHHHhhccCCCHHHHH
Q 002318          656 LQCKFGKGRENGPEFFYDPKYALRLCLKEKRMRACVHIYGMMSMHEEAVALALQV--D---PELAMAEADKVEDDEDLRK  730 (936)
Q Consensus       656 L~~~~~~~~~~~~~~~yd~~~aLrlc~~~~~~~~~v~L~~~~g~~~eAl~l~l~~--d---i~lA~~~a~~~~~d~~~~k  730 (936)
                      |+..+         ..||+++|+++|.+.++++++|+||.++|+|++|+.+++++  |   -+..++++.+.. |++   
T Consensus       155 l~~~s---------~~y~~~k~~~~c~~~~l~~elv~Ly~~~~~~~~A~~~~i~~~~~~~~~~~f~e~~~k~~-N~e---  221 (336)
T d1b89a_         155 LELFW---------SRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVA-NVE---  221 (336)
T ss_dssp             HHHHS---------TTSCHHHHHHHHHTTTCHHHHHHHHHHTTCHHHHHHHHHHSTTTTCCHHHHHHHHHHCS-STH---
T ss_pred             HHhcc---------ccCCHHHHHHHHHHcCChHHHHHHHHhcCCHHHHHHHHHHcchhhhhHHHHHHHHHccC-ChH---
Confidence            99851         57999999999999999999999999999999999999993  3   466677776665 455   


Q ss_pred             HHHHHHHHHHhhcccCCChHhHHHHHHHHHhcCCccccccccCcCCCCcchhHHHHHHHHHHHH
Q 002318          731 KLWLMVAKHVIEQEKGTKRENIRKAIAFLKETDGLLKIEDILPFFPDFALIDDFKEAICSSLDD  794 (936)
Q Consensus       731 kLWl~ll~~~i~~~~~~~~~~i~~~l~~L~~~~~~L~i~diL~~~p~~~~I~~~Kd~I~~~L~~  794 (936)
                       +|-+.+..+++..    ...|+.++..+..   .+.+.+++..++..-.++.++.++....+.
T Consensus       222 -~~~~~i~~yL~~~----p~~i~~lL~~v~~---~~d~~r~V~~~~k~~~l~li~p~Le~v~~~  277 (336)
T d1b89a_         222 -LYYRAIQFYLEFK----PLLLNDLLMVLSP---RLDHTRAVNYFSKVKQLPLVKPYLRSVQNH  277 (336)
T ss_dssp             -HHHHHHHHHHHHC----GGGHHHHHHHHGG---GCCHHHHHHHHHHTTCTTTTHHHHHHHHTT
T ss_pred             -HHHHHHHHHHHcC----HHHHHHHHHHhcc---CCCHHHHHHHHHhcCCcHHHHHHHHHHHHc
Confidence             8888888888632    1578888877643   455556666677667788888888775543
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure