Citrus Sinensis ID: 002395
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 928 | ||||||
| 224096506 | 1174 | predicted protein [Populus trichocarpa] | 0.996 | 0.787 | 0.844 | 0.0 | |
| 224083870 | 1173 | predicted protein [Populus trichocarpa] | 0.993 | 0.786 | 0.845 | 0.0 | |
| 225463689 | 1197 | PREDICTED: myosin-J heavy chain-like [Vi | 0.996 | 0.772 | 0.841 | 0.0 | |
| 297742765 | 1135 | unnamed protein product [Vitis vinifera] | 0.957 | 0.783 | 0.828 | 0.0 | |
| 255565536 | 1181 | myosin vIII, putative [Ricinus communis] | 0.982 | 0.772 | 0.822 | 0.0 | |
| 356576949 | 1176 | PREDICTED: myosin-J heavy chain-like [Gl | 0.995 | 0.785 | 0.801 | 0.0 | |
| 356530262 | 1177 | PREDICTED: myosin-J heavy chain-like [Gl | 0.996 | 0.785 | 0.798 | 0.0 | |
| 15231004 | 1166 | myosin 1 [Arabidopsis thaliana] gi|11994 | 0.988 | 0.786 | 0.803 | 0.0 | |
| 20268744 | 1166 | putative myosin [Arabidopsis thaliana] | 0.988 | 0.786 | 0.803 | 0.0 | |
| 449458801 | 1175 | PREDICTED: myosin-J heavy chain-like [Cu | 0.996 | 0.787 | 0.792 | 0.0 |
| >gi|224096506|ref|XP_002310637.1| predicted protein [Populus trichocarpa] gi|222853540|gb|EEE91087.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1649 bits (4271), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 787/932 (84%), Positives = 850/932 (91%), Gaps = 7/932 (0%)
Query: 1 MSQKPRVQPAFQSIKSLPVDFRFIGSPLSDQVEKSDDVNFRHSDVASLSVPENGELGNEF 60
M K +V P+ +SIKSLPVDFRF+GSP S+Q+EKS DV +S+ LS PE ++GN
Sbjct: 1 MLPKSQVLPSLESIKSLPVDFRFVGSPTSEQLEKSVDVKSLNSNAVCLSFPEKNDIGNGL 60
Query: 61 VEEGEN-------EESPYCGNNIVVEDRPSVGDEDLDSAASPLPSVSASHTDRRWSDTTS 113
VE E+ E+SPY I++E RPSVGDEDLD+ PLPS+S S +RRWSDT+S
Sbjct: 61 VEGAEDSVGNDVSEDSPYSRTAILIEQRPSVGDEDLDTVVMPLPSISTSRRERRWSDTSS 120
Query: 114 YAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVD 173
YA KKLQSWFQLPNGNWELGKILS SGTES ISLP+GKVLKVK+E+LV ANPDILDGVD
Sbjct: 121 YATNKKLQSWFQLPNGNWELGKILSTSGTESTISLPDGKVLKVKTESLVPANPDILDGVD 180
Query: 174 DLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE 233
DLMQLSYLNEPSVLYNL YRY +DMIYTKAGPVLVAINPFK+VPLYGN YIEAYK+KS+E
Sbjct: 181 DLMQLSYLNEPSVLYNLQYRYNRDMIYTKAGPVLVAINPFKEVPLYGNNYIEAYKNKSME 240
Query: 234 SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILK 293
SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILK
Sbjct: 241 SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILK 300
Query: 294 TNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERA 353
TNPILEAFGNAKT RNDNSSRFGKLIEIHFSETGKISGA IQTFLLEKSRVVQC EGER+
Sbjct: 301 TNPILEAFGNAKTLRNDNSSRFGKLIEIHFSETGKISGAKIQTFLLEKSRVVQCMEGERS 360
Query: 354 YHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVS 413
YHIFYQLC GA P LREK+NL A EYKYLRQS+CY+I GVDDAE+F V+EALDIVHVS
Sbjct: 361 YHIFYQLCAGASPKLREKINLKIASEYKYLRQSNCYTITGVDDAERFHAVMEALDIVHVS 420
Query: 414 KEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTR 473
KE+QESVFAMLAAVLWLGNVSF+V+DNENHVEP+ADEGL TVAKLIGC++GELKLALSTR
Sbjct: 421 KENQESVFAMLAAVLWLGNVSFSVVDNENHVEPMADEGLTTVAKLIGCNVGELKLALSTR 480
Query: 474 KMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILD 533
KMRVGNDTIVQ LTLSQA DTRDALAKSIY+CLF+WLVEQ+NKSLAVGKRRTGRSISILD
Sbjct: 481 KMRVGNDTIVQKLTLSQAIDTRDALAKSIYSCLFDWLVEQVNKSLAVGKRRTGRSISILD 540
Query: 534 IYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLN 593
IYGFESF+RNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDN+DCLN
Sbjct: 541 IYGFESFERNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNQDCLN 600
Query: 594 LFEKKPLGLLSLLDEESTFPNGTDLTFANKLKQHLNSNPCFRGERDKSFTVSHYAGEVIY 653
LFEKKPLGLLSLLDEESTFPNGTDLTFANKLKQHLNSN CFRGER K+F+VSHYAGEV Y
Sbjct: 601 LFEKKPLGLLSLLDEESTFPNGTDLTFANKLKQHLNSNSCFRGERGKAFSVSHYAGEVTY 660
Query: 654 DTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNKPVVGPLYKAGGADSQKLS 713
DTTGFLEKNRDLLHLDSI+LLSSCSCHLPQIFASNML+Q+ KPVVG LYKAGGADSQKLS
Sbjct: 661 DTTGFLEKNRDLLHLDSIQLLSSCSCHLPQIFASNMLTQTEKPVVGHLYKAGGADSQKLS 720
Query: 714 VATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVRISR 773
VATKFKGQLFQLMQRLE+TTPHFIRCIKPNN SPG YEQGLVLQQLRCCGVLEVVRISR
Sbjct: 721 VATKFKGQLFQLMQRLENTTPHFIRCIKPNNSPSPGSYEQGLVLQQLRCCGVLEVVRISR 780
Query: 774 SGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRAGQ 833
GFPTRMSHQKFARRYGFLLLE+VASQDPLSVSVAILHQF+I+PEMYQVGYTKLFFR GQ
Sbjct: 781 CGFPTRMSHQKFARRYGFLLLENVASQDPLSVSVAILHQFDIMPEMYQVGYTKLFFRTGQ 840
Query: 834 IGMLEDTRNRTLHGILRVQSCFRGHQARLCLKELRRGIVALQSFIRGEKIRKEYALVLQR 893
IG+LEDTRNRTLHGILRVQSCFRGHQAR L++LRRG+ ALQSF+RGEK RKEYA++ QR
Sbjct: 841 IGVLEDTRNRTLHGILRVQSCFRGHQARSYLRQLRRGVCALQSFVRGEKFRKEYAVLQQR 900
Query: 894 HRAAVVIQRQIKSRVARQKLKNIKYSSIMIQS 925
HRAAVVIQR IKS + R+K KN+ +SI+IQS
Sbjct: 901 HRAAVVIQRHIKSTICRKKYKNMHQASILIQS 932
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224083870|ref|XP_002307152.1| predicted protein [Populus trichocarpa] gi|222856601|gb|EEE94148.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225463689|ref|XP_002273898.1| PREDICTED: myosin-J heavy chain-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297742765|emb|CBI35399.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255565536|ref|XP_002523758.1| myosin vIII, putative [Ricinus communis] gi|223536970|gb|EEF38607.1| myosin vIII, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356576949|ref|XP_003556592.1| PREDICTED: myosin-J heavy chain-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356530262|ref|XP_003533701.1| PREDICTED: myosin-J heavy chain-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15231004|ref|NP_188630.1| myosin 1 [Arabidopsis thaliana] gi|11994771|dbj|BAB03161.1| myosin-like protein [Arabidopsis thaliana] gi|25054927|gb|AAN71940.1| putative myosin [Arabidopsis thaliana] gi|332642791|gb|AEE76312.1| myosin 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|20268744|gb|AAM14075.1| putative myosin [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449458801|ref|XP_004147135.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus] gi|449503518|ref|XP_004162042.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 928 | ||||||
| TAIR|locus:2011922 | 1153 | VIIIA [Arabidopsis thaliana (t | 0.979 | 0.788 | 0.782 | 0.0 | |
| TAIR|locus:2162550 | 1220 | ATM2 "myosin 2" [Arabidopsis t | 0.848 | 0.645 | 0.649 | 4.8e-280 | |
| TAIR|locus:2025535 | 1538 | XIC [Arabidopsis thaliana (tax | 0.844 | 0.509 | 0.432 | 1.3e-171 | |
| TAIR|locus:2199449 | 1529 | XIE [Arabidopsis thaliana (tax | 0.846 | 0.514 | 0.432 | 4.8e-170 | |
| TAIR|locus:2125929 | 1522 | XI-I [Arabidopsis thaliana (ta | 0.845 | 0.515 | 0.423 | 1.2e-169 | |
| UNIPROTKB|F1MMQ6 | 1845 | MYO5B "Uncharacterized protein | 0.809 | 0.407 | 0.432 | 3.8e-168 | |
| UNIPROTKB|Q02440 | 1829 | MYO5A "Unconventional myosin-V | 0.608 | 0.308 | 0.450 | 8.3e-168 | |
| UNIPROTKB|F1RZC1 | 1743 | MYO5C "Uncharacterized protein | 0.855 | 0.455 | 0.421 | 1.3e-167 | |
| TAIR|locus:2149932 | 1545 | XIK [Arabidopsis thaliana (tax | 0.845 | 0.508 | 0.424 | 1.7e-167 | |
| ZFIN|ZDB-GENE-050208-429 | 1836 | si:dkey-110c1.10 "si:dkey-110c | 0.858 | 0.434 | 0.419 | 3.4e-167 |
| TAIR|locus:2011922 VIIIA [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3669 (1296.6 bits), Expect = 0., Sum P(2) = 0.
Identities = 720/920 (78%), Positives = 783/920 (85%)
Query: 6 RVQPAFQSIKSLPVDFRFIGSPLSDQVEKSDDVNFRHSDVASLSVPXXXXXXXXXXXXXX 65
+V+ +FQS+K++P D+RF+GSP+SD +E N L
Sbjct: 4 KVKASFQSLKTMPADYRFLGSPISDHLE----TNLITPPNGHLKNGVNGTASSVGGMDSV 59
Query: 66 XXXSPYCGNNIVVEDRPSVGDEDLDXXXXXXXXXXXXHTDRRWSDTTSYAGKKKLQSWFQ 125
SPY +I+ +R S+GD D DR+WSDT YA KK LQ W Q
Sbjct: 60 NEDSPYSVRSILNGERSSIGDGD-------SILPLPESNDRKWSDTNVYARKKVLQFWVQ 112
Query: 126 LPNGNWELGKILSISGTESVISLPEGKVLKVKSENLVSANPDILDGVDDLMQLSYLNEPS 185
LPNGNWELGKI+S SG ESVI + EGKVLKVKSE LV ANPDILDGVDDLMQLSYLNEP+
Sbjct: 113 LPNGNWELGKIMSTSGEESVIVVTEGKVLKVKSETLVPANPDILDGVDDLMQLSYLNEPA 172
Query: 186 VLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIESPHVYAITDTAI 245
VLYNL YRY QDMIYTKAGPVLVA+NPFK+VPLYGN IEAY+ +S ESPHVYAI DTAI
Sbjct: 173 VLYNLEYRYNQDMIYTKAGPVLVAVNPFKEVPLYGNRNIEAYRKRSNESPHVYAIADTAI 232
Query: 246 REMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAK 305
REMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAK
Sbjct: 233 REMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAK 292
Query: 306 TSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAP 365
T RNDNSSRFGKLIEIHFSETGKISGA IQTFLLEKSRVVQC EGER+YHIFYQLC GA
Sbjct: 293 TLRNDNSSRFGKLIEIHFSETGKISGAQIQTFLLEKSRVVQCTEGERSYHIFYQLCAGAS 352
Query: 366 PALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLA 425
P LREKLNL SAK+Y YL+QS+CYSINGVDDAE+F V EALDIVHVSKEDQE+VFAMLA
Sbjct: 353 PTLREKLNLTSAKQYNYLKQSNCYSINGVDDAERFHAVKEALDIVHVSKEDQENVFAMLA 412
Query: 426 AVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQN 485
AVLWLGNVSFT+IDNENHVEP DE L TVAKLIGC+I ELKLALS R MRV NDTIVQ
Sbjct: 413 AVLWLGNVSFTIIDNENHVEPEPDESLSTVAKLIGCNINELKLALSKRNMRVNNDTIVQK 472
Query: 486 LTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSF 545
LTLSQA D RDALAKSIYACLF+WLVEQINKSLAVGKRRTGRSISILDIYGFESF++NSF
Sbjct: 473 LTLSQAIDARDALAKSIYACLFDWLVEQINKSLAVGKRRTGRSISILDIYGFESFNKNSF 532
Query: 546 EQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKKPLGLLSL 605
EQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDW +VDFEDN++CL+LFEKKPLGLLSL
Sbjct: 533 EQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWTRVDFEDNQECLSLFEKKPLGLLSL 592
Query: 606 LDEESTFPNGTDLTFANKLKQHLNSNPCFRGERDKSFTVSHYAGEVIYDTTGFLEKNRDL 665
LDEESTFPNGTDLT ANKLKQHLN N CFRG+R K+FTV+HYAGEV Y+TTGFLEKNRDL
Sbjct: 593 LDEESTFPNGTDLTLANKLKQHLNDNSCFRGDRGKAFTVAHYAGEVTYETTGFLEKNRDL 652
Query: 666 LHLDSIELLSSCSCHLPQIFASNMLSQSNKPVVGPLYKAGGADSQKLSVATKFKGQLFQL 725
LH DSI+LLSSCSCHLPQ FAS+ML S KP+VGPL+KAGGADSQ+LSVATKFKGQLFQL
Sbjct: 653 LHSDSIQLLSSCSCHLPQAFASSMLIYSEKPLVGPLHKAGGADSQRLSVATKFKGQLFQL 712
Query: 726 MQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVRISRSGFPTRMSHQKF 785
MQRL +TTPHFIRCIKPNN QS GLYEQGLVLQQLRCCGVLEVVRISRSGFPTRM H KF
Sbjct: 713 MQRLGNTTPHFIRCIKPNNVQSAGLYEQGLVLQQLRCCGVLEVVRISRSGFPTRMFHHKF 772
Query: 786 ARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRAGQIGMLEDTRNRTL 845
ARRYGFLLLE++A++DPLSVSVAILHQFNILPEMYQVGYTKLFFR GQIG+LEDTRNRTL
Sbjct: 773 ARRYGFLLLENIAAKDPLSVSVAILHQFNILPEMYQVGYTKLFFRTGQIGVLEDTRNRTL 832
Query: 846 HGILRVQSCFRGHQARLCLKELRRGIVALQSFIRGEKIRKEYALVLQRHRAAVVIQRQIK 905
HGILR+QS FRGHQAR LKEL+ GI LQSF+RGEK+RKEY +LQRHRA+ IQ +K
Sbjct: 833 HGILRLQSYFRGHQARCRLKELKTGITILQSFVRGEKMRKEYTELLQRHRASAAIQSHVK 892
Query: 906 SRVARQKLKNIKYSSIMIQS 925
R+A Q+ K +S +IQS
Sbjct: 893 RRIASQQYKATVDASAVIQS 912
|
|
| TAIR|locus:2162550 ATM2 "myosin 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025535 XIC [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199449 XIE [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2125929 XI-I [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MMQ6 MYO5B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q02440 MYO5A "Unconventional myosin-Va" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RZC1 MYO5C "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149932 XIK [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-429 si:dkey-110c1.10 "si:dkey-110c1.10" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.VII.2372.1 | SubName- Full=Putative uncharacterized protein; (1168 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 928 | |||
| cd01383 | 677 | cd01383, MYSc_type_VIII, Myosin motor domain, plan | 0.0 | |
| smart00242 | 677 | smart00242, MYSc, Myosin | 0.0 | |
| cd00124 | 679 | cd00124, MYSc, Myosin motor domain | 0.0 | |
| pfam00063 | 679 | pfam00063, Myosin_head, Myosin head (motor domain) | 0.0 | |
| cd01384 | 674 | cd01384, MYSc_type_XI, Myosin motor domain, plant- | 0.0 | |
| cd01377 | 693 | cd01377, MYSc_type_II, Myosin motor domain, type I | 0.0 | |
| cd01380 | 691 | cd01380, MYSc_type_V, Myosin motor domain, type V | 0.0 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 0.0 | |
| cd01378 | 674 | cd01378, MYSc_type_I, Myosin motor domain, type I | 0.0 | |
| cd01381 | 671 | cd01381, MYSc_type_VII, Myosin motor domain, type | 0.0 | |
| cd01387 | 677 | cd01387, MYSc_type_XV, Myosin motor domain, type X | 0.0 | |
| cd01385 | 692 | cd01385, MYSc_type_IX, Myosin motor domain, type I | 0.0 | |
| cd01382 | 717 | cd01382, MYSc_type_VI, Myosin motor domain, type V | 0.0 | |
| cd01379 | 653 | cd01379, MYSc_type_III, Myosin motor domain, type | 1e-165 | |
| PTZ00014 | 821 | PTZ00014, PTZ00014, myosin-A; Provisional | 1e-161 | |
| cd01386 | 767 | cd01386, MYSc_type_XVIII, Myosin motor domain, typ | 2e-74 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 6e-12 |
| >gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
Score = 1357 bits (3514), Expect = 0.0
Identities = 585/678 (86%), Positives = 624/678 (92%), Gaps = 2/678 (0%)
Query: 164 ANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYY 223
ANPDILDGVDDLMQLSYLNEPSVLYNL YRY QD+IYTKAGPVLVA+NPFK+VPLYGN Y
Sbjct: 2 ANPDILDGVDDLMQLSYLNEPSVLYNLQYRYSQDLIYTKAGPVLVAVNPFKEVPLYGNDY 61
Query: 224 IEAYKSKSIESPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGG 283
IEAY+ KS +SPHVYAI DTA EM+RDEVNQSIIISGESGAGKTETAKIAMQYLA+LGG
Sbjct: 62 IEAYRKKSNDSPHVYAIADTAYNEMMRDEVNQSIIISGESGAGKTETAKIAMQYLASLGG 121
Query: 284 GSGIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSR 343
GSGIEYEIL+TNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGA IQTFLLEKSR
Sbjct: 122 GSGIEYEILQTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGAKIQTFLLEKSR 181
Query: 344 VVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIV 403
VVQCA GER+YHIFYQLC GAPPAL+EKLNL SA EYKYL+QS CYSINGVDDA++F +
Sbjct: 182 VVQCARGERSYHIFYQLCAGAPPALKEKLNLKSASEYKYLKQSCCYSINGVDDAQRFHTL 241
Query: 404 VEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDI 463
VEALDIVH+SKEDQE+VFAMLAAVLWLGNVSFTVIDNENHVEPVADE L T AKLIGC+I
Sbjct: 242 VEALDIVHISKEDQENVFAMLAAVLWLGNVSFTVIDNENHVEPVADEALSTAAKLIGCNI 301
Query: 464 GELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKR 523
+L LALSTRKM V ND IVQ LTL QA D RDALAKSIYA LF+WLVEQINKSL VGKR
Sbjct: 302 EDLMLALSTRKMHVNNDNIVQKLTLQQAIDARDALAKSIYASLFDWLVEQINKSLEVGKR 361
Query: 524 RTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKV 583
RTGRSISILDIYGFESFD+NSFEQFCINYANERLQQHFNRHLFKLEQEEY +DGIDW KV
Sbjct: 362 RTGRSISILDIYGFESFDKNSFEQFCINYANERLQQHFNRHLFKLEQEEYEEDGIDWTKV 421
Query: 584 DFEDNKDCLNLFEKKPLGLLSLLDEESTFPNGTDLTFANKLKQHLNSNPCFRGERDKSFT 643
+FEDN++CL+LFEKKPLGLLSLLDEESTFPN TDLTFANKLKQHL +N CFRGER +FT
Sbjct: 422 EFEDNQECLDLFEKKPLGLLSLLDEESTFPNATDLTFANKLKQHLKTNSCFRGERGGAFT 481
Query: 644 VSHYAGEVIYDTTGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNKPVVGPLYK 703
V HYAGEV YDTTGFLEKNRDLLH DSI+LLSSC C LPQ+FAS+ML QS PVVGPLY
Sbjct: 482 VRHYAGEVTYDTTGFLEKNRDLLHSDSIQLLSSCKCQLPQLFASSMLIQS--PVVGPLYV 539
Query: 704 AGGADSQKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCC 763
A ADSQKLSV TKFKGQLF+LMQ+LE+TTPHFIRCIKPNN Q PG+YEQGLVLQQLRCC
Sbjct: 540 ASAADSQKLSVGTKFKGQLFKLMQQLENTTPHFIRCIKPNNKQLPGIYEQGLVLQQLRCC 599
Query: 764 GVLEVVRISRSGFPTRMSHQKFARRYGFLLLESVASQDPLSVSVAILHQFNILPEMYQVG 823
GVLEVVRISRSG+PTRM+HQ+FARRYGFLLLE++ASQDPLSVSVAIL QFNILPEMYQVG
Sbjct: 600 GVLEVVRISRSGYPTRMTHQEFARRYGFLLLENIASQDPLSVSVAILQQFNILPEMYQVG 659
Query: 824 YTKLFFRAGQIGMLEDTR 841
YTKLFFR GQIG LEDTR
Sbjct: 660 YTKLFFRTGQIGALEDTR 677
|
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 677 |
| >gnl|CDD|214580 smart00242, MYSc, Myosin | Back alignment and domain information |
|---|
| >gnl|CDD|238071 cd00124, MYSc, Myosin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) | Back alignment and domain information |
|---|
| >gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 928 | |||
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 100.0 | |
| PTZ00014 | 821 | myosin-A; Provisional | 100.0 | |
| cd01383 | 677 | MYSc_type_VIII Myosin motor domain, plant-specific | 100.0 | |
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 100.0 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 100.0 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 100.0 | |
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 100.0 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 100.0 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 100.0 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 100.0 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 100.0 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 100.0 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 100.0 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 100.0 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 100.0 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 100.0 | |
| cd01386 | 767 | MYSc_type_XVIII Myosin motor domain, type XVIII my | 100.0 | |
| KOG0162 | 1106 | consensus Myosin class I heavy chain [Cytoskeleton | 100.0 | |
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 100.0 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 100.0 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 100.0 | |
| KOG4229 | 1062 | consensus Myosin VII, myosin IXB and related myosi | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 98.77 | |
| KOG4229 | 1062 | consensus Myosin VII, myosin IXB and related myosi | 97.97 | |
| PF02736 | 42 | Myosin_N: Myosin N-terminal SH3-like domain; Inter | 97.9 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 97.23 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 96.85 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 96.45 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 96.34 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 95.99 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 95.8 | |
| PTZ00014 | 821 | myosin-A; Provisional | 95.69 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.34 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 94.94 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 94.54 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 94.32 | |
| KOG2128 | 1401 | consensus Ras GTPase-activating protein family - I | 94.3 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.2 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 94.08 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 94.03 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 93.74 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 93.7 | |
| PRK06696 | 223 | uridine kinase; Validated | 93.2 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 93.18 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 93.14 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 93.09 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 93.09 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 93.04 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 93.03 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 92.87 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 92.86 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 92.81 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 92.76 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 92.75 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 92.71 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 92.62 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 92.58 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 92.58 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 92.55 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 92.45 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 92.41 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 92.37 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 92.37 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 92.28 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 92.26 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 92.25 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 92.22 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 92.14 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 92.05 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 91.97 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 91.92 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 91.83 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 91.78 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 91.78 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 91.76 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 91.71 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 91.7 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 91.68 | |
| PF05729 | 166 | NACHT: NACHT domain | 91.61 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 91.36 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 91.35 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 91.33 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 91.21 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 91.14 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 91.11 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 91.11 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 91.04 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 91.0 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 90.95 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 90.92 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 90.9 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 90.83 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 90.77 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 90.72 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 90.67 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 90.54 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 90.48 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 90.42 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 90.41 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 90.35 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 90.34 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 90.33 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 90.3 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 90.23 | |
| COG1660 | 286 | Predicted P-loop-containing kinase [General functi | 90.06 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 90.04 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 90.02 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 90.01 | |
| PRK06217 | 183 | hypothetical protein; Validated | 89.98 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 89.92 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 89.89 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 89.83 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 89.65 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 89.64 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 89.63 | |
| PRK12377 | 248 | putative replication protein; Provisional | 89.41 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 89.39 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 89.38 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 89.24 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 89.21 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 89.16 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 89.12 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 88.96 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 88.74 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 88.71 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 88.68 | |
| PF07475 | 171 | Hpr_kinase_C: HPr Serine kinase C-terminal domain; | 88.68 | |
| PRK13764 | 602 | ATPase; Provisional | 88.56 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 88.47 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 88.47 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 88.45 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 88.45 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 88.39 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 88.33 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 88.3 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 88.23 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 88.1 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 87.97 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 87.97 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 87.93 | |
| PRK08727 | 233 | hypothetical protein; Validated | 87.85 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 87.85 | |
| PRK07667 | 193 | uridine kinase; Provisional | 87.81 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 87.78 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 87.77 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 87.73 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 87.64 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 87.54 | |
| COG0802 | 149 | Predicted ATPase or kinase [General function predi | 87.51 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 87.51 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 87.49 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 87.49 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 87.47 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 87.45 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 87.4 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 87.35 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 87.33 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 87.17 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 87.16 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 87.14 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 87.12 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 87.12 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 87.1 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 87.06 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 87.03 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 87.0 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 86.91 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 86.87 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 86.87 | |
| COG1493 | 308 | HprK Serine kinase of the HPr protein, regulates c | 86.85 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 86.83 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 86.78 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 86.75 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 86.68 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 86.63 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 86.62 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 86.6 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 86.58 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 86.56 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 86.54 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 86.49 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 86.47 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 86.44 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 86.42 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 86.4 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 86.35 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 86.3 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 86.3 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 86.29 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 86.26 | |
| PRK08116 | 268 | hypothetical protein; Validated | 86.26 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 86.22 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 86.21 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 86.17 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 86.16 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 86.16 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 86.1 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 86.07 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 85.95 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 85.94 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 85.92 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 85.92 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 85.89 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 85.88 | |
| PRK03839 | 180 | putative kinase; Provisional | 85.87 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 85.86 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 85.85 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 85.83 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 85.8 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 85.78 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 85.77 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 85.72 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 85.68 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 85.68 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 85.65 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 85.62 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 85.57 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 85.56 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 85.41 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 85.4 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 85.38 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 85.36 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 85.35 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 85.35 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 85.32 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 85.28 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 85.28 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 85.27 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 85.25 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 85.21 | |
| PRK05428 | 308 | HPr kinase/phosphorylase; Provisional | 85.17 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 85.15 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 85.15 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 84.99 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 84.99 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 84.94 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 84.91 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 84.91 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 84.9 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 84.9 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 84.89 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 84.89 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 84.86 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 84.85 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 84.84 | |
| PRK13768 | 253 | GTPase; Provisional | 84.83 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 84.83 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 84.82 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 84.82 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 84.81 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 84.8 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 84.77 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 84.74 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 84.71 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 84.67 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 84.67 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 84.63 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 84.61 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 84.58 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 84.52 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 84.5 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 84.5 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 84.49 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 84.48 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 84.48 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 84.47 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 84.28 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 84.27 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 84.24 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 84.21 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 84.17 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 84.17 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 84.13 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 84.05 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 84.05 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 83.98 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 83.97 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 83.93 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 83.89 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 83.87 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 83.83 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 83.81 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 83.8 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 83.78 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 83.77 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 83.76 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 83.73 | |
| PRK13695 | 174 | putative NTPase; Provisional | 83.7 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 83.67 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 83.67 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 83.64 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 83.62 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 83.62 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 83.6 | |
| PF13173 | 128 | AAA_14: AAA domain | 83.57 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 83.55 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 83.54 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 83.52 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 83.52 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 83.52 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 83.48 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 83.45 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 83.4 | |
| TIGR00679 | 304 | hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene | 83.38 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 83.32 | |
| PRK09087 | 226 | hypothetical protein; Validated | 83.32 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 83.3 | |
| PRK06620 | 214 | hypothetical protein; Validated | 83.3 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 83.27 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 83.17 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 83.17 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 83.13 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 83.09 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 83.06 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 83.05 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 83.05 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 83.03 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 83.02 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 83.02 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 82.99 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 82.96 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 82.94 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 82.92 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 82.92 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 82.9 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 82.89 | |
| TIGR02746 | 797 | TraC-F-type type-IV secretion system protein TraC. | 82.89 | |
| PF13479 | 213 | AAA_24: AAA domain | 82.88 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 82.86 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 82.83 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 82.82 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 82.76 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 82.67 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 82.65 | |
| PLN02348 | 395 | phosphoribulokinase | 82.65 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 82.62 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 82.6 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 82.59 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 82.59 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 82.58 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 82.53 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 82.52 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 82.5 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 82.49 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 82.45 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 82.42 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 82.39 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 82.32 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 82.31 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 82.3 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 82.3 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 82.29 | |
| PRK06526 | 254 | transposase; Provisional | 82.29 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 82.28 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 82.28 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 82.26 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 82.25 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 82.25 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 82.23 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 82.2 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 82.19 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 82.13 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 82.13 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 82.11 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 82.11 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 82.06 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 82.04 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 82.04 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 82.0 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 81.98 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 81.96 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 81.96 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 81.95 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 81.94 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 81.93 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 81.92 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 81.91 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 81.9 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 81.89 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 81.87 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 81.82 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 81.8 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 81.79 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 81.77 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 81.76 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 81.7 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 81.66 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 81.65 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 81.64 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 81.63 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 81.62 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 81.6 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 81.6 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 81.58 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 81.56 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 81.47 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 81.46 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 81.45 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 81.44 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 81.44 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 81.44 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 81.38 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 81.35 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 81.32 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 81.31 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 81.3 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 81.28 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 81.28 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 81.27 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 81.23 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 81.22 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 81.22 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 81.17 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 81.16 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 81.14 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 81.14 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 81.14 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 81.09 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 81.08 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 81.07 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 81.06 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 81.05 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 81.04 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 81.03 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 80.99 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 80.95 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 80.94 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 80.9 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 80.89 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 80.83 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 80.78 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 80.78 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 80.74 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 80.73 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 80.73 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 80.69 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 80.68 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 80.66 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 80.66 | |
| KOG0942 | 1001 | consensus E3 ubiquitin protein ligase [Posttransla | 80.64 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 80.64 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 80.63 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 80.63 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 80.6 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 80.6 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 80.49 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 80.48 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 80.45 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 80.44 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 80.41 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 80.36 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 80.34 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 80.32 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 80.31 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 80.29 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 80.28 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 80.24 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 80.19 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 80.18 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 80.14 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 80.13 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 80.1 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 80.09 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 80.08 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 80.08 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 80.04 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 80.03 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 80.02 |
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-210 Score=1872.12 Aligned_cols=791 Identities=44% Similarity=0.728 Sum_probs=727.4
Q ss_pred ccCcEEEEecCCCCeEEEEEEEEe--CCeeEEEc--CCCcEEEEeCCCcc--cCCCCcCCCccccccCcCCCchhHHHHH
Q 002395 117 KKKLQSWFQLPNGNWELGKILSIS--GTESVISL--PEGKVLKVKSENLV--SANPDILDGVDDLMQLSYLNEPSVLYNL 190 (928)
Q Consensus 117 ~~~~~vW~~~~~~~~~~~~v~~~~--~~~~~v~~--~~g~~~~v~~~~~~--~~n~~~~~~~~Dl~~L~~L~E~siL~~L 190 (928)
..|..||+|+.+..|..|.+.+.. ++.++... .+|....|+...+. ..+||.++++|||+.|++||||+|||||
T Consensus 7 ~~g~~~w~p~~e~~Wi~~~~~k~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~P~~~~vdDLt~LSyLNEpsVl~nL 86 (1463)
T COG5022 7 EVGSGCWIPDEEKGWIWAEIIKEAFNKGKVTEEGKKEDGESVSVKKKVLGNDRIKLPKFDGVDDLTELSYLNEPAVLHNL 86 (1463)
T ss_pred ccCceeeeeccccceeeeeechhhhhccccccchhhccCcccceeehhcccccccCccccCchhhhhhhccCcHHHHHHH
Confidence 467789999999999999999885 33332222 25555555555443 3447799999999999999999999999
Q ss_pred HHHhhcCccccccCCeEEEecCCCCCCCCCHHHHHHhhcCCCC--CCchhHHHHHHHHHHHHcCceeEEEEeCCCCCChh
Q 002395 191 HYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE--SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKT 268 (928)
Q Consensus 191 ~~Ry~~~~iYT~~G~iLiavNP~k~l~iY~~~~~~~Y~~~~~~--~PHifaiA~~Ay~~m~~~~~~QsIiisGESGAGKT 268 (928)
++||.+|+||||+|-+|||||||+.+|||++++++.|+++... +|||||||+.||++|+..++|||||||||||||||
T Consensus 87 ~kRY~n~~IYTYSGlvLIAvNPy~~L~iYt~d~i~~Y~~K~r~el~PHvfAIAe~aY~~lls~~eNQtIiISGESGAGKT 166 (1463)
T COG5022 87 EKRYNNGQIYTYSGLVLIAVNPYRDLGIYTDDIIQSYSGKNRLELEPHVFAIAEEAYRNLLSEKENQTIIISGESGAGKT 166 (1463)
T ss_pred HHHhhcCceeEEeeeEEEEecCcccCCCccHHHHHHhccCccccCCchHHHHHHHHHHHHHhcCCCceEEEecCCCCCch
Confidence 9999999999999999999999999999999999999998876 79999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhccCCC-----CchhhhhhhhHHHHhhcCcccCCCCCCCCcccEEEEEEcCCCCeeceeeeeeecCcee
Q 002395 269 ETAKIAMQYLAALGGGS-----GIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSR 343 (928)
Q Consensus 269 e~~K~il~yLa~~~~~~-----~i~~~il~snpiLEAFGNAkT~rN~NSSRFGK~i~l~F~~~g~i~Ga~i~~yLLEKsR 343 (928)
|+||.||+|||++++++ .||++||++||||||||||||+|||||||||||++|.||.+|.|+||+|++|||||||
T Consensus 167 e~aK~ImqYlasv~~s~~~~~~~iE~~ILaTNPILEAFGNAkTvRNdNSSRFGKyikI~Fd~~g~I~GA~I~~YLLEKSR 246 (1463)
T COG5022 167 ENAKRIMQYLASVTSSSTVEISSIEKQILATNPILEAFGNAKTVRNDNSSRFGKYIKIEFDENGEICGAKIETYLLEKSR 246 (1463)
T ss_pred HHHHHHHHHHHHhccCCcchHHHHHHHHHhcchHHHHhccccccccCCcccccceEEEEECCCCceechhhhhhhhhhhh
Confidence 99999999999998765 6899999999999999999999999999999999999999999999999999999999
Q ss_pred eeecCCCCCcchhhhHhhcCCChhhHhhccCCCcccCccccCCCccccCCcchHHHHHHHHHHhhhcccChhHHHHHHHH
Q 002395 344 VVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAM 423 (928)
Q Consensus 344 Vv~q~~gERNfHIFYqll~G~~~~~~~~l~L~~~~~y~yL~~~~~~~~~~~dD~~~f~~~~~al~~lG~~~~e~~~I~~i 423 (928)
||+|+.+|||||||||||+|+++..++.+++..+.+|.||++++|..++|+||+++|+.|+.||++|||+.++|..||+|
T Consensus 247 VV~Q~~~ERNYHIFYQll~G~~~~~k~~~~~~~~~dY~Yl~~~~~~~I~gIdD~kefk~t~~AlktiGi~~eeq~~IF~i 326 (1463)
T COG5022 247 VVHQNKNERNYHIFYQLLAGDPEELKKLLLLQNPKDYIYLSQGGCDKIDGIDDAKEFKITLDALKTIGIDEEEQDQIFKI 326 (1463)
T ss_pred hccCCCCccchhhhhhHhcCChHHHHHHhhccChHhhHhHhhcCCCcCCCcccHHHHHHHHHHHHHhCCChHHHHHHHHH
Confidence 99999999999999999999888888888889999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhcCeeeEEecCCCccccCChHHHHHHHHhhCCCHHHHHHhhcceeeeecCceEEecCChhhHHHHHHHHHHHHH
Q 002395 424 LAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIY 503 (928)
Q Consensus 424 lAaILhLGni~F~~~~~~~~~~~~~~~~l~~~a~LLgv~~~~L~~~L~~r~~~~~~e~~~~~l~~~qA~~~RDalak~LY 503 (928)
||||||||||+|.... ++.+.+.+.+.++.+|.|||||++.|.++|+.|.|++|+|.|.+++|.+||..+||||||+||
T Consensus 327 LAaILhiGNIef~~~r-~g~a~~~~~~~~~~~c~LLgId~~~f~k~lvk~~ikt~~E~i~~~~n~~QA~~irdslAK~lY 405 (1463)
T COG5022 327 LAAILHIGNIEFKEDR-NGAAIFSDNSVLDKACYLLGIDPSLFVKWLVKRQIKTGGEWIVVPLNLEQALAIRDSLAKALY 405 (1463)
T ss_pred HHHHHhhcceeeeecc-cchhhcCCchHHHHHHHHhCCCHHHHHHHHHHhHhhcCceEEEecCCHHHHHHHHHHHHHHHH
Confidence 9999999999998644 356678888999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhcccccCCCCCCCceeeeccCCCCcCCCCCCHHHHHHHHhhHHHHHHHHHhhhhHHHHHHHhcCCccccc
Q 002395 504 ACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKV 583 (928)
Q Consensus 504 ~~LF~wlV~~IN~~l~~~~~~~~~~IgILDifGFE~f~~NsfEQLcINyaNEkLQ~~f~~~~f~~Eq~ey~~EgI~~~~i 583 (928)
++||+|||++||.+|..+.. ..+|||||||||||+|+.|||||||||||||||||+||+|||++|||||.+|||+|++|
T Consensus 406 ~~lFdwiV~rIN~sL~~~~~-~~~fIGVLDIyGFEiFEkNSFEQlCINYtNEKLQQ~Fn~h~FklEQEeY~kE~IeW~~I 484 (1463)
T COG5022 406 SNLFDWIVDRINKSLDHSAA-ASNFIGVLDIYGFEIFEKNSFEQLCINYTNEKLQQFFNQHMFKLEQEEYVKEGIEWSFI 484 (1463)
T ss_pred HHHHHHHHHHHHhhccCccc-cccceeEEeecchhhhccCcHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHhcCccccc
Confidence 99999999999999987644 57899999999999999999999999999999999999999999999999999999999
Q ss_pred ccCChHhHHHHhhc-CCCccccccccccCCCCCChHHHHHHHHHHhC--CCCCCcCCC--CCCeEEEecccceeEeccch
Q 002395 584 DFEDNKDCLNLFEK-KPLGLLSLLDEESTFPNGTDLTFANKLKQHLN--SNPCFRGER--DKSFTVSHYAGEVIYDTTGF 658 (928)
Q Consensus 584 ~f~dN~~~ldli~~-kp~Gil~lLDEe~~~p~~tD~~fl~kl~~~~~--~~~~f~~~~--~~~F~I~HyaG~V~Y~~~gf 658 (928)
+|.|||+||||||+ .|.|||++|||||++|.|||++|..||.+.+. +++.|+++| ...|+|+||||+|+|+|+||
T Consensus 485 dy~DnQ~~IDLIE~~~p~GIlslLDEE~~~p~atd~s~~sKL~~~l~~~~~~~f~~~rf~~~~FvvkHYAgDVeY~veg~ 564 (1463)
T COG5022 485 DYFDNQPCIDLIEKKNPLGILSLLDEECVMPHATDESFTSKLAQRLNKNSNPKFKKSRFRDNKFVVKHYAGDVEYDVEGF 564 (1463)
T ss_pred ccccCcchhHHHhccCCCchHhhhcHHhcCCCCCchHHHHHHHHHhccccCccccccccCCCceEEEeecccceeeccch
Confidence 99999999999997 47999999999999999999999999999876 467788775 56899999999999999999
Q ss_pred hhhccccchHHHHHHHhhcCcch-hHHhhccccccCCCCccCCCccCCCCCCCCccHHHHHHHHHHHHHHHHhccCCeeE
Q 002395 659 LEKNRDLLHLDSIELLSSCSCHL-PQIFASNMLSQSNKPVVGPLYKAGGADSQKLSVATKFKGQLFQLMQRLESTTPHFI 737 (928)
Q Consensus 659 leKN~D~l~~d~~~ll~~S~~~l-~~lf~~~~~~~s~~~~~~~~~~~~~~~~~~~tv~~~fk~qL~~Lm~~L~~t~phfI 737 (928)
++||+|+++.++++||..|++++ ..+|....... .+.+++|+++.||+||.+||++|++|+||||
T Consensus 565 ldKNkD~l~~~ll~Ll~~StNe~vs~Lf~~~~~~~--------------~K~~~pT~gs~~K~sl~~Lm~tl~sTqphyI 630 (1463)
T COG5022 565 LDKNKDPLNDDLLELLKASTNEFVSTLFDDEENIE--------------SKGRFPTLGSRFKESLNSLMSTLNSTQPHYI 630 (1463)
T ss_pred hhhCcchhhHHHHHHHhhccchHHHHhhhhhhhcc--------------ccCCCCcHHHHHHHHHHHHHHHHHhcCCcee
Confidence 99999999999999999999985 57886332111 1245699999999999999999999999999
Q ss_pred EeccCCCCCCCCcccccchhhhhcccchhHHHHHhhcCCCcccCHHHHHHHHhcccccccCC------CChHHHHHHHHH
Q 002395 738 RCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVRISRSGFPTRMSHQKFARRYGFLLLESVAS------QDPLSVSVAILH 811 (928)
Q Consensus 738 RCIkPN~~k~p~~fd~~~V~~QLr~~gvle~vri~r~Gyp~R~~~~eF~~RY~~L~~~~~~~------~d~~~~~~~iL~ 811 (928)
||||||.+|+|+.||..+|++|||||||||+|||+|+|||.|++|+||+.||++|.|..... .|.+.+|..||.
T Consensus 631 RCIkPN~~K~p~~fD~~mVL~QLr~~GVlE~IRIsraGFP~R~~f~EFv~RY~IL~p~~~~~~~~~~~~~~~~~~~~IL~ 710 (1463)
T COG5022 631 RCIKPNEEKSPWTFDNQMVLSQLRCCGVLETIRISRAGFPSRWTFDEFVQRYRILSPSKSWTGEYTWKEDTKNAVKSILE 710 (1463)
T ss_pred EeeCCCcccCccccchHHHHHHHHhcchhhheeeccccCchhhhHHHHHHHHHHhcccccccccccchhHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999965332 256889999999
Q ss_pred HcCCCCcceEecceeeeeecccccccccccccccch-hHHHHHHHhhhhhhHhhhhhhhHHHHHHHHHHhHHHHHHHHHH
Q 002395 812 QFNILPEMYQVGYTKLFFRAGQIGMLEDTRNRTLHG-ILRVQSCFRGHQARLCLKELRRGIVALQSFIRGEKIRKEYALV 890 (928)
Q Consensus 812 ~~~~~~~~~~iGkTKVFlr~g~l~~LE~~R~~~l~a-av~IQ~~~Rg~laRk~y~~lr~aav~IQs~~Rg~~aRk~~~~~ 890 (928)
...++...||+|+||||||.++++.||.+|...+.. ++.||++|||+..|++|....+.+..+|...+|++.|+....-
T Consensus 711 ~~~id~~~YqiG~TKvFfKagvL~~LE~~Rd~~~~~~~~~iq~aiR~~~~rrr~~~~~k~i~~~~~~~~~~~~~~~~~~~ 790 (1463)
T COG5022 711 ELVIDSSKYQIGNTKVFFKAGVLAALEDMRDAKLDNIATRIQRAIRGRYLRRRYLQALKRIKKIQVIQHGFRLRRLVDYE 790 (1463)
T ss_pred hhcCChhheeccceeEEeeCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccchhhhcccc
Confidence 999999999999999999999999999999988865 5789999999999999999999999999999999988766533
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHhceeEEEe
Q 002395 891 LQRHRAAVVIQRQIKSRVARQKLKNIKYSSIMIQ 924 (928)
Q Consensus 891 ~~~~~AAi~IQs~~Rg~~~Rr~y~~~r~aai~IQ 924 (928)
. .-++++.+|..||....|+.|+.....++.+|
T Consensus 791 ~-~~~~~~~l~~~~~~~~~r~~~~~~~~~i~~lq 823 (1463)
T COG5022 791 L-KWRLFIKLQPLLSLLGSRKEYRSYLACIIKLQ 823 (1463)
T ss_pred h-HHHhHHHhhHHhHHHhhHHHHHHHHHHHHHHH
Confidence 2 34689999999999999999998877666555
|
|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >KOG0162 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4229 consensus Myosin VII, myosin IXB and related myosins [Cell motility] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG4229 consensus Myosin VII, myosin IXB and related myosins [Cell motility] | Back alignment and domain information |
|---|
| >PF02736 Myosin_N: Myosin N-terminal SH3-like domain; InterPro: IPR004009 This domain has an SH3-like fold | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >COG1660 Predicted P-loop-containing kinase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PF07475 Hpr_kinase_C: HPr Serine kinase C-terminal domain; InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >COG0802 Predicted ATPase or kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05428 HPr kinase/phosphorylase; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR02746 TraC-F-type type-IV secretion system protein TraC | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >KOG0942 consensus E3 ubiquitin protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 928 | ||||
| 2dfs_A | 1080 | 3-D Structure Of Myosin-V Inhibited State Length = | 1e-179 | ||
| 1w9j_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 1e-174 | ||
| 1w9i_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 1e-173 | ||
| 2aka_A | 776 | Structure Of The Nucleotide-Free Myosin Ii Motor Do | 1e-173 | ||
| 3mnq_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-173 | ||
| 2jhr_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-173 | ||
| 1jwy_A | 776 | Crystal Structure Of The Dynamin A Gtpase Domain Co | 1e-173 | ||
| 2xel_A | 776 | Molecular Mechanism Of Pentachloropseudilin Mediate | 1e-173 | ||
| 1d0x_A | 761 | Dictyostelium Myosin S1dc (Motor Domain Fragment) C | 1e-173 | ||
| 1yv3_A | 762 | The Structural Basis Of Blebbistatin Inhibition And | 1e-173 | ||
| 1w9l_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 1e-173 | ||
| 1fmv_A | 761 | Crystal Structure Of The Apo Motor Domain Of Dictyo | 1e-173 | ||
| 1mma_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-173 | ||
| 3myh_X | 762 | Insights Into The Importance Of Hydrogen Bonding In | 1e-172 | ||
| 1w9k_A | 770 | Dictyostelium Discoideum Myosin Ii Motor Domain S45 | 1e-172 | ||
| 2y0r_X | 758 | Structural Basis For The Allosteric Interference Of | 1e-172 | ||
| 1g8x_A | 1010 | Structure Of A Genetically Engineered Molecular Mot | 1e-172 | ||
| 2xo8_A | 776 | Crystal Structure Of Myosin-2 In Complex With Tribr | 1e-172 | ||
| 1mmd_A | 762 | Truncated Head Of Myosin From Dictyostelium Discoid | 1e-172 | ||
| 2y9e_X | 758 | Structural Basis For The Allosteric Interference Of | 1e-172 | ||
| 1mmg_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-170 | ||
| 1mmn_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-170 | ||
| 1oe9_A | 795 | Crystal Structure Of Myosin V Motor With Essential | 1e-170 | ||
| 1lvk_A | 762 | X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N | 1e-170 | ||
| 1w8j_A | 766 | Crystal Structure Of Myosin V Motor Domain - Nucleo | 1e-166 | ||
| 3mkd_A | 692 | Crystal Structure Of Myosin-2 Dictyostelium Discoid | 1e-160 | ||
| 2x9h_A | 695 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-158 | ||
| 1dfl_A | 831 | Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra | 1e-156 | ||
| 1kk7_A | 837 | Scallop Myosin In The Near Rigor Conformation Lengt | 1e-156 | ||
| 1b7t_A | 835 | Myosin Digested By Papain Length = 835 | 1e-156 | ||
| 1dfk_A | 830 | Nucleotide-Free Scallop Myosin S1-Near Rigor State | 1e-156 | ||
| 1qvi_A | 840 | Crystal Structure Of Scallop Myosin S1 In The Pre-P | 1e-156 | ||
| 2ec6_A | 838 | Placopecten Striated Muscle Myosin Ii Length = 838 | 1e-152 | ||
| 2w4g_M | 840 | Isometrically Contracting Insect Asynchronous Fligh | 1e-151 | ||
| 2os8_A | 840 | Rigor-Like Structures Of Muscle Myosins Reveal Key | 1e-150 | ||
| 3i5g_A | 839 | Crystal Structure Of Rigor-Like Squid Myosin S1 Len | 1e-147 | ||
| 4db1_A | 783 | Cardiac Human Myosin S1dc, Beta Isoform Complexed W | 1e-147 | ||
| 3dtp_B | 973 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 1e-145 | ||
| 3dtp_A | 971 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 1e-145 | ||
| 3j04_A | 909 | Em Structure Of The Heavy Meromyosin Subfragment Of | 1e-145 | ||
| 1i84_S | 1184 | Cryo-Em Structure Of The Heavy Meromyosin Subfragme | 1e-144 | ||
| 1br1_A | 820 | Smooth Muscle Myosin Motor Domain-Essential Light C | 1e-143 | ||
| 1br2_A | 791 | Smooth Muscle Myosin Motor Domain Complexed With Mg | 1e-142 | ||
| 2mys_A | 843 | Myosin Subfragment-1, Alpha Carbon Coordinates Only | 1e-141 | ||
| 1m8q_A | 840 | Molecular Models Of Averaged Rigor Crossbridges Fro | 1e-141 | ||
| 2ycu_A | 995 | Crystal Structure Of Human Non Muscle Myosin 2c In | 1e-135 | ||
| 2x51_A | 789 | M6 Delta Insert1 Length = 789 | 1e-130 | ||
| 2vas_A | 788 | Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo | 1e-130 | ||
| 4dbq_A | 788 | Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos | 1e-130 | ||
| 3l9i_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant | 1e-128 | ||
| 2bki_A | 858 | Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St | 1e-128 | ||
| 4e7z_A | 798 | Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F | 1e-128 | ||
| 2bkh_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc | 1e-128 | ||
| 2v26_A | 784 | Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L | 1e-128 | ||
| 4anj_A | 1052 | Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St | 1e-127 | ||
| 4dbr_A | 786 | Myosin Vi D179y (md) Pre-powerstroke State Length = | 1e-127 | ||
| 4a7f_C | 697 | Structure Of The Actin-Tropomyosin-Myosin Complex ( | 1e-127 | ||
| 4dbp_A | 814 | Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal | 1e-127 | ||
| 1lkx_A | 697 | Motor Domain Of Myoe, A Class-I Myosin Length = 697 | 1e-127 | ||
| 4e7s_A | 798 | Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat | 1e-127 |
| >pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 | Back alignment and structure |
|
| >pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 | Back alignment and structure |
| >pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 | Back alignment and structure |
| >pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 | Back alignment and structure |
| >pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 | Back alignment and structure |
| >pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 | Back alignment and structure |
| >pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 | Back alignment and structure |
| >pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 | Back alignment and structure |
| >pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 | Back alignment and structure |
| >pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 | Back alignment and structure |
| >pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 | Back alignment and structure |
| >pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 | Back alignment and structure |
| >pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 | Back alignment and structure |
| >pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 | Back alignment and structure |
| >pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 | Back alignment and structure |
| >pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 | Back alignment and structure |
| >pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 | Back alignment and structure |
| >pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 | Back alignment and structure |
| >pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 | Back alignment and structure |
| >pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 | Back alignment and structure |
| >pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 | Back alignment and structure |
| >pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 | Back alignment and structure |
| >pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 | Back alignment and structure |
| >pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 | Back alignment and structure |
| >pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 | Back alignment and structure |
| >pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 | Back alignment and structure |
| >pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 | Back alignment and structure |
| >pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 | Back alignment and structure |
| >pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 | Back alignment and structure |
| >pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 | Back alignment and structure |
| >pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 | Back alignment and structure |
| >pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 | Back alignment and structure |
| >pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 | Back alignment and structure |
| >pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 | Back alignment and structure |
| >pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 | Back alignment and structure |
| >pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 | Back alignment and structure |
| >pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 | Back alignment and structure |
| >pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 | Back alignment and structure |
| >pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 | Back alignment and structure |
| >pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 | Back alignment and structure |
| >pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 | Back alignment and structure |
| >pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 | Back alignment and structure |
| >pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 | Back alignment and structure |
| >pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 | Back alignment and structure |
| >pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 | Back alignment and structure |
| >pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 928 | |||
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 0.0 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 0.0 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 0.0 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 0.0 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 0.0 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-05 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 0.0 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 0.0 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 0.0 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 0.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 0.0 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-23 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 1e-08 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 5e-07 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 4e-05 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 3e-04 |
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
Score = 1141 bits (2954), Expect = 0.0
Identities = 295/838 (35%), Positives = 440/838 (52%), Gaps = 37/838 (4%)
Query: 112 TSYAGKKKLQSWFQLPNGNWELGKILSISGTESVISLPE-GKVLKVKSENLVSANPDILD 170
+ ++ + W +E + E+ + L E G+ L++ + + NP
Sbjct: 3 VEWTARRLV--WVPSELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFS 60
Query: 171 GVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSK 230
+D+ +L+ LNE SVL+NL RY +IYT +G V INP+K++P+Y +E Y+ K
Sbjct: 61 KAEDMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGK 120
Query: 231 SIE--SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSG-- 286
PHVYA+T+ A R M++D +QSI+ +GESGAGKTE K +QYLA +
Sbjct: 121 KRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGR 180
Query: 287 --------IEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFL 338
+E ++L+ NPILEAFGNAKT +NDNSSRFGK I I+F G I GANI+T+L
Sbjct: 181 KEPGVPGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYL 240
Query: 339 LEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAE 398
LEKSR ++ A+ E ++HIFYQL GA L+ L L Y++L + + E
Sbjct: 241 LEKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPS--SSPGQERE 298
Query: 399 QFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKL 458
F+ +E+L ++ S E+ S+ M++AVL GN++ N + + + +L
Sbjct: 299 LFQETLESLRVLGFSHEEIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRL 358
Query: 459 IGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSL 518
+G + + AL T +++VG D + + T QA +ALAK+ Y LF WLV ++N++L
Sbjct: 359 LGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRAL 418
Query: 519 AVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGI 578
R+ + ILDI GFE F NSFEQ CINY NE+LQQ FN +F LEQEEY ++GI
Sbjct: 419 DRSPRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGI 478
Query: 579 DWAKVDFE-DNKDCLNLFEK--KPLGLLSLLDEESTFPNGTDLTFANKLKQHLNSNPCFR 635
W +DF D + C++L E+ P GLL+LLDEE FP TD +F K+ Q +P F+
Sbjct: 479 PWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQ 538
Query: 636 GER----DKSFTVSHYAGEVIYDTTGFLEKNRDLLHLDSIELLSSCSC-HLPQIFASNML 690
R F+V HYAG+V Y +L KN D L+ + LL + +I+
Sbjct: 539 RPRHLRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEG 598
Query: 691 SQSNKPVVGPLYKAGGADSQKL---SVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQS 747
+ V G ++ +V +K L +LM L +T P F+RCI PN+ +
Sbjct: 599 IVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKR 658
Query: 748 PGLYEQGLVLQQLRCCGVLEVVRISRSGFPTRMSHQKFARRYGFLLLESVA--SQDPLSV 805
G E LVL QLRC GVLE +RI R GFP R+ Q+F +RY L ++ D
Sbjct: 659 AGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQA 718
Query: 806 SVAILHQFNILPEMYQVGYTKLFFRAGQIGMLEDTRNRTLH------GILRVQSCFRGHQ 859
++ + P +Y+VG +K+FFRAG + LE+ R + Q
Sbjct: 719 CEKMIQALELDPNLYRVGQSKIFFRAGVLAQLEEERASEQTKSDYLKRANELVQWINDKQ 778
Query: 860 ARLCLKELRRGIVALQSFIRGEKIRKEYALVLQRHRAAVVIQRQIKSRVARQKLKNIK 917
A L ++ I ++QSF+ K K+ + + ++ S + +L +
Sbjct: 779 ASLESRDFGDSIESVQSFMNAHKEYKKTEK-PPKGQEVSELEAIYNSLQTKLRLIKRE 835
|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 63 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 928 | |||
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 100.0 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 100.0 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 100.0 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 100.0 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 100.0 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 100.0 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 100.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 100.0 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 100.0 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 100.0 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 100.0 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 98.99 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.9 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.8 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.71 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.64 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 97.79 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 97.77 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 97.15 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 96.99 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 96.65 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 95.24 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 94.99 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 94.76 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.56 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 94.45 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 94.36 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.23 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 93.81 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 93.77 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 93.71 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 93.67 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 93.52 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 93.52 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 93.44 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 93.39 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 93.33 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 93.25 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.19 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 93.18 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 92.85 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 92.76 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 92.73 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 92.68 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 92.65 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 92.59 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 92.53 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 92.49 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 92.43 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 92.36 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 92.25 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 92.24 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 92.21 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 92.19 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 92.01 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 91.97 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 91.88 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 91.84 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 91.8 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 91.78 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 91.77 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.74 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 91.73 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 91.72 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 91.72 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 91.7 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 91.69 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 91.68 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 91.59 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.58 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 91.42 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 91.37 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 91.32 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 91.28 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 91.19 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 91.08 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 91.0 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 90.98 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 90.95 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 90.88 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 90.81 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 90.81 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 90.79 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 90.75 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 90.66 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 90.66 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 90.62 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 90.61 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 90.61 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 90.61 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 90.56 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 90.54 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 90.54 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 90.37 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 90.28 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 90.08 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 89.98 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 89.97 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 89.86 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 89.85 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 89.83 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 89.82 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 89.77 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 89.71 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 89.7 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 89.7 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 89.65 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 89.6 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 89.59 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 89.56 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 89.53 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 89.48 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 89.39 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 89.36 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 89.31 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 89.28 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 89.14 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 89.08 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 89.05 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 88.98 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 88.95 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 88.9 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 88.89 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 88.88 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 88.83 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 88.8 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 88.71 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 88.71 | |
| 2xk0_A | 69 | Polycomb protein PCL; transcription, aromatic CAGE | 88.69 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 88.67 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 88.59 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 88.53 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 88.51 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 88.5 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 88.48 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 88.45 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 88.44 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 88.43 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 88.42 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 88.35 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 88.34 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 88.3 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 88.25 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 88.16 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 87.98 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 87.97 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 87.92 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 87.91 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 87.73 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 87.71 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 87.7 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 87.51 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 87.48 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 87.45 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 87.42 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 87.38 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 87.36 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 87.26 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 87.24 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 87.22 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 87.17 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 87.11 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 87.02 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 86.96 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 86.94 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 86.93 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 86.8 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 86.78 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 86.77 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 86.75 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 86.71 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 86.7 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 86.68 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 86.65 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 86.61 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 86.59 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 86.59 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 86.57 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 86.54 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 86.53 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 86.53 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 86.5 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 86.45 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 86.34 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 86.1 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 86.09 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 86.09 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 86.08 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 86.08 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 86.04 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 85.91 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 85.89 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 85.87 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 85.79 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 85.77 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 85.68 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 85.67 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 85.65 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 85.61 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 85.57 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 85.55 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 85.55 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 85.5 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 85.22 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 85.21 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 85.17 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 85.16 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 85.09 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 85.01 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 84.86 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 84.82 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 84.82 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 84.8 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 84.8 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 84.78 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 84.76 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 84.76 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 84.75 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 84.7 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 84.7 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 84.65 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 84.59 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 84.47 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 84.37 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 84.32 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 84.24 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 84.18 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 84.15 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 84.13 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 84.13 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 84.12 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 83.93 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 83.91 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 83.88 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 83.88 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 83.43 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 83.37 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 83.21 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 83.16 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 83.14 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 83.12 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 83.03 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 83.02 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 82.95 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 82.9 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 82.83 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 82.68 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 82.66 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 82.66 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 82.47 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 82.39 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 82.37 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 82.35 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 82.3 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 82.27 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 82.22 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 82.2 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 82.08 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 81.76 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 81.7 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 81.68 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 81.63 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 81.62 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 81.54 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 81.19 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 81.07 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 80.96 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 80.92 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 80.58 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 80.54 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 80.5 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 80.45 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 80.44 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 80.24 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 80.19 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 80.14 |
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.7e-212 Score=1968.22 Aligned_cols=808 Identities=42% Similarity=0.708 Sum_probs=740.0
Q ss_pred cccCcEEEEecCCCCeEEEEEEEE---eCCeeEEEcCCCcEEEEeC----CCccc-CCCCcCCCccccccCcCCCchhHH
Q 002395 116 GKKKLQSWFQLPNGNWELGKILSI---SGTESVISLPEGKVLKVKS----ENLVS-ANPDILDGVDDLMQLSYLNEPSVL 187 (928)
Q Consensus 116 ~~~~~~vW~~~~~~~~~~~~v~~~---~~~~~~v~~~~g~~~~v~~----~~~~~-~n~~~~~~~~Dl~~L~~L~E~siL 187 (928)
..+|.+||+|+|+++|..|+|++. .++.++|.+++|++.+|+. +++.| +||+.++++|||+.|++|||++||
T Consensus 7 ~~~g~~vwv~~~~~~~~~~~v~~~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~~~~np~~~~~~~Dl~~L~~l~e~~vl 86 (1080)
T 2dfs_A 7 YTKYARVWIPDPEEVWKSAELLKDYKPGDKVLQLRLEEGKDLEYCLDPKTKELPPLRNPDILVGENDLTALSYLHEPAVL 86 (1080)
T ss_dssp CCTTCEEEEEETTTEEEEEECSSCCCTTCSEEECCCSSSSCCEEECCTTTCCCCCBCCCGGGSSCSBSTTCSSCSHHHHH
T ss_pred cccCCEEEEECCCCceEEEEEEeeecCCCceEEEEECCCCEEEEecCCcccccccccCcccccchhhhhhhhhcchHHHH
Confidence 345779999999999999999873 3446888888998888876 45777 599999999999999999999999
Q ss_pred HHHHHHh-hcCccccccCCeEEEecCCCCCCCCCHHHHHHhhcCCCC--CCchhHHHHHHHHHHHHcCceeEEEEeCCCC
Q 002395 188 YNLHYRY-KQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE--SPHVYAITDTAIREMIRDEVNQSIIISGESG 264 (928)
Q Consensus 188 ~~L~~Ry-~~~~iYT~~G~iLiavNP~k~l~iY~~~~~~~Y~~~~~~--~PHifaiA~~Ay~~m~~~~~~QsIiisGESG 264 (928)
|||+.|| ..+.||||+|++|||||||+++|+|+++++..|+++... ||||||||+.||++|+.+++|||||||||||
T Consensus 87 ~nL~~Ry~~~~~iYTy~G~iLiavNPyk~l~iy~~~~~~~Y~~~~~~~~pPHifaiA~~Ay~~m~~~~~~QsIiisGESG 166 (1080)
T 2dfs_A 87 HNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESG 166 (1080)
T ss_dssp HHHHHHHHTTCCCEEEETTEEEEECCSSCCSCSSHHHHHHHTTCCGGGSCCCHHHHHHHHHHHHHHHTCCEEEEEECSTT
T ss_pred HHHHHHHHhcCCchhccCceeEEecCCcccccCCHHHHHHhcCCCCCCCCCcHHHHHHHHHHHHHhcCCCcEEEEcCCCC
Confidence 9999999 999999999999999999999999999999999998765 8999999999999999999999999999999
Q ss_pred CChhHHHHHHHHHHHhccCCC---CchhhhhhhhHHHHhhcCcccCCCCCCCCcccEEEEEEcCCCCeeceeeeeeecCc
Q 002395 265 AGKTETAKIAMQYLAALGGGS---GIEYEILKTNPILEAFGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEK 341 (928)
Q Consensus 265 AGKTe~~K~il~yLa~~~~~~---~i~~~il~snpiLEAFGNAkT~rN~NSSRFGK~i~l~F~~~g~i~Ga~i~~yLLEK 341 (928)
|||||++|+||+||+++++++ .|+++|+++||||||||||||+||||||||||||+|+||.+|.|+||+|++|||||
T Consensus 167 AGKTe~~K~i~~yla~~~~~~~~~~ie~~il~snpiLEAFGNAkT~rN~NSSRFGK~i~i~F~~~g~i~Ga~i~~yLLEK 246 (1080)
T 2dfs_A 167 AGKTVSAKYAMRYFATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEK 246 (1080)
T ss_dssp SSHHHHHHHHHHHHHHTTTCCTTTCTHHHHHHHHHHHHHHHEEEETTEEEEECSEEEEEEEECTTCCEEEEEEEEECCCC
T ss_pred CCccchHHHHHHHHHhhccCCCccchHHHHHHHHHHHHHhcCCcCCCCCCccccceeEEEEECCCCCEeeecceeEeecC
Confidence 999999999999999998764 79999999999999999999999999999999999999999999999999999999
Q ss_pred eeeeecCCCCCcchhhhHhhcCCChhhHhhccCCCcccCccccCCCccccCCcchHHHHHHHHHHhhhcccChhHHHHHH
Q 002395 342 SRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVF 421 (928)
Q Consensus 342 sRVv~q~~gERNfHIFYqll~G~~~~~~~~l~L~~~~~y~yL~~~~~~~~~~~dD~~~f~~~~~al~~lG~~~~e~~~I~ 421 (928)
||||.|++||||||||||||+|+++++++.|+|.++.+|+||++++|..++++||+++|..++.||++|||+++++..||
T Consensus 247 sRVv~q~~~ERnfHIFYqllag~~~~~~~~l~L~~~~~y~yl~~~~~~~~~~~dD~~~f~~~~~A~~~lg~~~~e~~~i~ 326 (1080)
T 2dfs_A 247 SRVVFQAEEERNYHIFYQLCASAALPEFKTLRLGNANYFHYTKQGGSPVIDGIDDAKEMVNTRQACTLLGISDSYQMGIF 326 (1080)
T ss_dssp GGGTCCCTTCCSBHHHHHHHHTTTSSGGGGTCCCCTTTCTTTSTTSCCSCTTCCHHHHHHHHHHHHHHTTCCHHHHHHHH
T ss_pred ceeeccCCCCCcchhHHHHHcCCChHHHHHccCCCHHhcCcccCCCCCCCCCccHHHHHHHHHHHHHHcCCCHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhhcCeeeEEecCCCccccCChHHHHHHHHhhCCCHHHHHHhhcceeeeecCceEEecCChhhHHHHHHHHHHH
Q 002395 422 AMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKS 501 (928)
Q Consensus 422 ~ilAaILhLGni~F~~~~~~~~~~~~~~~~l~~~a~LLgv~~~~L~~~L~~r~~~~~~e~~~~~l~~~qA~~~RDalak~ 501 (928)
+|||||||||||+|...+++......+++.++.||.||||++++|.++|++|++.+++|.++++++++||.++||||||+
T Consensus 327 ~ilaaILhLGni~F~~~~~~~~~~~~~~~~l~~~a~LLgv~~~~L~~~l~~~~~~~~~e~i~~~~~~~qa~~~rdalak~ 406 (1080)
T 2dfs_A 327 RILAGILHLGNVEFASRDSDSCAIPPKHDPLTIFCDLMGVDYEEMAHWLCHRKLATATETYIKPISKLHAINARDALAKH 406 (1080)
T ss_dssp HHHHHHHHHTTCCCEEETTTEEECCSSCHHHHHHHHHHTCCHHHHHHHHHEEEECC----EEEECCHHHHHHHHHHHHHH
T ss_pred HHHHHHHhccCceEEecCCcceeecCChHHHHHHHHHhCCCHHHHHHHhcccEEEeCCceEEeCCCHHHHHHHHHHHHHH
Confidence 99999999999999876554333336789999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhcccccCCCCCCCceeeeccCCCCcCCCCCCHHHHHHHHhhHHHHHHHHHhhhhHHHHHHHhcCCccc
Q 002395 502 IYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWA 581 (928)
Q Consensus 502 LY~~LF~wlV~~IN~~l~~~~~~~~~~IgILDifGFE~f~~NsfEQLcINyaNEkLQ~~f~~~~f~~Eq~ey~~EgI~~~ 581 (928)
||++||+|||.+||.+|..+. ....+||||||||||+|+.|||||||||||||+|||+||+|+|+.||+||.+|||+|+
T Consensus 407 lY~~LF~wlV~~iN~~l~~~~-~~~~~IgvLDI~GFE~f~~NsFEQlcINy~NEkLQq~F~~~~f~~EqeeY~~EgI~w~ 485 (1080)
T 2dfs_A 407 IYANLFNWIVDHVNKALHSTV-KQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWT 485 (1080)
T ss_dssp HHHHHHHHHHHHHHHHHCCSS-CCCEEEEEEEECCCCCCSSBCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCTT
T ss_pred HHHHHHHHHHHHHHHhhcccc-ccCceEEeeccCCccccCcCCHHHHHHHhhhHHHHHHHHHHhhHHHHHHHhhcCCccc
Confidence 999999999999999998754 3468999999999999999999999999999999999999999999999999999999
Q ss_pred ccccCChHhHHHHhhcCCCccccccccccCCCCCChHHHHHHHHHHh-CCCCCCcCCC--CCCeEEEecccceeEeccch
Q 002395 582 KVDFEDNKDCLNLFEKKPLGLLSLLDEESTFPNGTDLTFANKLKQHL-NSNPCFRGER--DKSFTVSHYAGEVIYDTTGF 658 (928)
Q Consensus 582 ~i~f~dN~~~ldli~~kp~Gil~lLDEe~~~p~~tD~~fl~kl~~~~-~~~~~f~~~~--~~~F~I~HyaG~V~Y~~~gf 658 (928)
.|+|.||++|||||+++ .|||+||||||++|++||.+|++||++++ ++|++|.+++ ..+|+|+||||+|+|+++||
T Consensus 486 ~i~f~dn~~~idlie~~-~Gil~lLdee~~~p~~tD~~f~~kl~~~~~~~~~~f~~p~~~~~~F~I~HyAG~V~Y~~~gf 564 (1080)
T 2dfs_A 486 LIDFYDNQPCINLIEAK-MGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIKHFADKVEYQCEGF 564 (1080)
T ss_dssp CCCCCCCHHHHHHHHST-TSHHHHHHHHTTSTTCCHHHHHHHHHHHHBTTBSSEECCTTCSSEEEEECSSCEEEEECTTH
T ss_pred cccccccHHHHHHHhcC-CceeeeccccccCCCCChHHHHHHHHHHhhcCCCCccCCCCCCCceEEEecceEEEEehhhH
Confidence 99999999999999997 99999999999999999999999999988 9999998775 67999999999999999999
Q ss_pred hhhccccchHHHHHHHhhc-Ccch-hHHhhccccccC-C--C---------CccCCCc--cCCCCCCCCccHHHHHHHHH
Q 002395 659 LEKNRDLLHLDSIELLSSC-SCHL-PQIFASNMLSQS-N--K---------PVVGPLY--KAGGADSQKLSVATKFKGQL 722 (928)
Q Consensus 659 leKN~D~l~~d~~~ll~~S-~~~l-~~lf~~~~~~~s-~--~---------~~~~~~~--~~~~~~~~~~tv~~~fk~qL 722 (928)
|+||+|+|++|++++|++| ++++ ..+|.......+ . . ....+.. .+++...+++||+++|+.||
T Consensus 565 leKN~D~l~~~~~~ll~~S~~~~~v~~lf~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~tv~~~fk~sL 644 (1080)
T 2dfs_A 565 LEKNKDTVYEEQIKVLKSSKKFKLLPELFQDEEKAISPTSATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSL 644 (1080)
T ss_dssp HHHHBCCCCHHHHHHHHTCSSCSHHHHSCC-------------------------------------CCCBHHHHHHHHH
T ss_pred HHhccccccHHHHHHHHcccccHHHHHHhcccccccccccccccccccccccccccccccccccccCCCCcHHHHHHHHH
Confidence 9999999999999999999 8875 567754321100 0 0 0000000 00123445689999999999
Q ss_pred HHHHHHHhccCCeeEEeccCCCCCCCCcccccchhhhhcccchhHHHHHhhcCCCcccCHHHHHHHHhcccccccCCCCh
Q 002395 723 FQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVRISRSGFPTRMSHQKFARRYGFLLLESVASQDP 802 (928)
Q Consensus 723 ~~Lm~~L~~t~phfIRCIkPN~~k~p~~fd~~~V~~QLr~~gvle~vri~r~Gyp~R~~~~eF~~RY~~L~~~~~~~~d~ 802 (928)
+.||++|++|+||||||||||+.+.|+.||..+|++||||+||||+|||+|+|||+|++|.+|+.||++|+|...+..|+
T Consensus 645 ~~Lm~~L~~t~phfVRCIkPN~~k~p~~fd~~~V~~QLr~~GvlE~iri~r~Gyp~R~~~~eF~~RY~~L~~~~~~~~d~ 724 (1080)
T 2dfs_A 645 HLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLSDR 724 (1080)
T ss_dssp HHHHHHHHSSEEEEEEEECCCSSCCTTCCCHHHHHHHHHTTTHHHHHHHHTTSCCEEEEHHHHHHHHTTTSCGGGCCSSH
T ss_pred HHHHHHHHhcCCeeEEEecCCCCCCchhcCHHhhHHHHhhcccHHHHhHHhcCCCchhhHHHHHHHHHHHCCccCCCCCh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999986665589
Q ss_pred HHHHHHHHHHcCCCCcceEecceeeeeecccccccccccccccc-hhHHHHHHHhhhhhhHhhhhhhhHHHHHHHHHHhH
Q 002395 803 LSVSVAILHQFNILPEMYQVGYTKLFFRAGQIGMLEDTRNRTLH-GILRVQSCFRGHQARLCLKELRRGIVALQSFIRGE 881 (928)
Q Consensus 803 ~~~~~~iL~~~~~~~~~~~iGkTKVFlr~g~l~~LE~~R~~~l~-aav~IQ~~~Rg~laRk~y~~lr~aav~IQs~~Rg~ 881 (928)
++.|+.||..+++++++|++|+||||||.+.+..||..|...+. +++.||++||||++|++|++++.+++.||++|||+
T Consensus 725 k~~~~~il~~~~~~~~~~~~G~TKVF~r~g~l~~LE~~R~~~l~~aa~~IQa~~Rg~l~Rk~~~~~r~aai~IQ~~~Rg~ 804 (1080)
T 2dfs_A 725 KQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRAACIRIQKTIRGWLMRKKYMRMRRAAITIQRYVRGH 804 (1080)
T ss_dssp HHHHHHHHTTTSCCGGGEEECSSEEEECTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHhcCChhhheeccccchhccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999987764 67899999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhceeEEEecc
Q 002395 882 KIRKEYALVLQRHRAAVVIQRQIKSRVARQKLKNIKYSSIMIQSG 926 (928)
Q Consensus 882 ~aRk~~~~~~~~~~AAi~IQs~~Rg~~~Rr~y~~~r~aai~IQs~ 926 (928)
++|+++..+ ++.+||++||++||||++|+.|..++.+++.||++
T Consensus 805 ~aR~~~~~l-r~~~AAi~IQs~~Rg~~~Rk~y~~lr~aai~IQs~ 848 (1080)
T 2dfs_A 805 QARCYATFL-RRTRAAIIIQKFQRMYVVRKRYQCMRDATIALQAL 848 (1080)
T ss_dssp HHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHhhccccc-ccchhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHH
Confidence 999999765 46789999999999999999999999999999974
|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 928 | ||||
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 0.0 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 0.0 | |
| d1w7ja2 | 730 | c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick | 0.0 | |
| d1br2a2 | 710 | c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick | 0.0 | |
| d1d0xa2 | 712 | c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain | 0.0 | |
| d1lkxa_ | 684 | c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli | 0.0 |
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Bay scallop (Aequipecten irradians) [TaxId: 31199]
Score = 762 bits (1968), Expect = 0.0
Identities = 297/778 (38%), Positives = 441/778 (56%), Gaps = 42/778 (5%)
Query: 146 ISLPEGKVLKVKSENLVS------ANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMI 199
S P+ + L V + L+ NP + ++D+ ++YLNE SVLYNL RY +I
Sbjct: 5 FSDPDFQYLAVDRKKLMKEQTAAFMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLI 64
Query: 200 YTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIES--PHVYAITDTAIREMIRDEVNQSI 257
YT +G +A+NP++++P+Y + I Y+ K PH++++ D A + M+ D NQS
Sbjct: 65 YTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSC 124
Query: 258 IISGESGAGKTETAKIAMQYLAALGGGSG-------------IEYEILKTNPILEAFGNA 304
+I+GESGAGKTE K + YLA + +E +I++ NP+LEA+GNA
Sbjct: 125 LITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNA 184
Query: 305 KTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGA 364
KT+RN+NSSRFGK I IHF TGKI+GA+I+T+LLEKSRV ER YHIFYQ+C A
Sbjct: 185 KTTRNNNSSRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNA 244
Query: 365 PPALREKLNLMSAKEYKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAML 424
P L + + + C +++ +DD E+F++ EA DI+ +KE+++S+F
Sbjct: 245 IPELNDVMLVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCT 304
Query: 425 AAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLIGCDIGELKLALSTRKMRVGNDTIVQ 484
A++L +G + F E E VA L G + G+L AL K++VG + + +
Sbjct: 305 ASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTK 364
Query: 485 NLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFESFDRNS 544
++Q ++ ALAKS+Y +F WLV ++NK+L K + I +LDI GFE FD NS
Sbjct: 365 GQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDT-KAKRNYYIGVLDIAGFEIFDFNS 423
Query: 545 FEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKKPLGLLS 604
FEQ CINY NERLQQ FN H+F LEQEEY ++GI W +DF + +KP+G+LS
Sbjct: 424 FEQLCINYTNERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILS 483
Query: 605 LLDEESTFPNGTDLTFANKL-KQHLNSNPCF--------RGERDKSFTVSHYAGEVIYDT 655
+L+EE FP D +F +KL + H+ N F + F + HYAG V Y
Sbjct: 484 ILEEECMFPKADDKSFQDKLYQNHMGKNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSI 543
Query: 656 TGFLEKNRDLLHLDSIELLSSCSCHLPQIFASNMLSQSNKPVVGPLYKAGGADSQKLSVA 715
TG+LEKN+D ++ + + LL + + + +P G K G S +++
Sbjct: 544 TGWLEKNKDPINENVVALLGASKEP----LVAELFKAPEEP-AGGGKKKKGKSSAFQTIS 598
Query: 716 TKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVVRISRSG 775
+ L +LM+ L ST PHF+RCI PN + PGL + LVL QL+C GVLE +RI R G
Sbjct: 599 AVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKG 658
Query: 776 FPTRMSHQKFARRYGFLLLESVA--SQDPLSVSVAILHQFNILPEMYQVGYTKLFFRAGQ 833
FP+R+ + +F +RY L ++ D +VS IL + P Y++G TK+FF+AG
Sbjct: 659 FPSRLIYSEFKQRYSILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGV 718
Query: 834 IGMLEDTRNRTLHG-ILRVQSCFRGHQAR---LCLKELRRGIVALQSFIRGEKIRKEY 887
+G LE+ R+ L I Q+ RG+ R L++ R G+ +Q IR + + +
Sbjct: 719 LGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNW 776
|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 928 | |||
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 100.0 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 100.0 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 100.0 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 100.0 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 100.0 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 100.0 | |
| d1br2a1 | 46 | Myosin S1 fragment, N-terminal domain {Chicken (Ga | 98.12 | |
| d2mysa1 | 46 | Myosin S1 fragment, N-terminal domain {Chicken (Ga | 97.89 | |
| d1kk8a1 | 48 | Myosin S1 fragment, N-terminal domain {Bay scallop | 97.78 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 97.1 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 97.09 | |
| d1w7ja1 | 58 | Myosin S1 fragment, N-terminal domain {Chicken (Ga | 96.55 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.32 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 95.3 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 95.3 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.26 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.69 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.6 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 94.54 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.53 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 94.47 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.36 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.34 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 94.33 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 93.99 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 93.9 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 93.87 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.77 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 93.64 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 93.58 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 93.52 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 93.35 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 93.17 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 93.13 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 92.93 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 92.9 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.87 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 92.5 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 92.49 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 92.42 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 92.2 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 92.09 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 91.99 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 91.94 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 91.85 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 91.8 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 91.7 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.59 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 91.31 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 91.04 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 91.01 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 91.0 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 90.96 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 90.91 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 90.7 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 90.62 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 90.6 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 90.4 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 90.34 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 90.2 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 90.2 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 90.19 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 90.17 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 90.08 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 90.06 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 90.03 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 89.74 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 89.59 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 89.59 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 89.51 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 89.0 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 88.85 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 88.64 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 88.38 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 88.27 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 88.13 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 87.93 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 87.89 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 87.88 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 87.63 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 87.55 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 87.47 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 87.38 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 87.35 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 87.22 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 87.21 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 87.17 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 87.09 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 87.02 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 86.78 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 86.72 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 86.59 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 86.56 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 86.32 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 86.21 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 86.19 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 85.8 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 85.61 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 85.51 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 85.37 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 85.02 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 85.01 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 84.92 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 84.9 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 84.65 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 83.99 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 83.95 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 83.29 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 82.74 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 82.7 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 82.67 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 81.94 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 81.8 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 81.57 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 81.31 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 81.03 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 80.74 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 80.68 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 80.26 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 80.23 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 80.08 |
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Bay scallop (Aequipecten irradians) [TaxId: 31199]
Probab=100.00 E-value=1.1e-189 Score=1720.97 Aligned_cols=724 Identities=41% Similarity=0.701 Sum_probs=643.1
Q ss_pred EeCCCcccCCCCcCCCccccccCcCCCchhHHHHHHHHhhcCccccccCCeEEEecCCCCCCCCCHHHHHHhhcCCCC--
Q 002395 156 VKSENLVSANPDILDGVDDLMQLSYLNEPSVLYNLHYRYKQDMIYTKAGPVLVAINPFKKVPLYGNYYIEAYKSKSIE-- 233 (928)
Q Consensus 156 v~~~~~~~~n~~~~~~~~Dl~~L~~L~E~siL~~L~~Ry~~~~iYT~~G~iLiavNP~k~l~iY~~~~~~~Y~~~~~~-- 233 (928)
++++++.++||+.+++||||+.|++|||++||++|+.||.+|.||||+|++|||||||+++|+|++++++.|+++...
T Consensus 21 ~~~~~~~~~np~~~~~v~Dl~~L~~l~E~~vl~~L~~Ry~~~~iYT~~G~iLiavNP~k~l~iy~~~~~~~y~~~~~~~~ 100 (789)
T d1kk8a2 21 MKEQTAAFMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEI 100 (789)
T ss_dssp CC--CCCCCCCGGGTTCSBGGGSSCCSHHHHHHHHHHHHHTTCCEEEETTEEEEECCSSCCSTTSHHHHHHHTTCCGGGS
T ss_pred cccccccccCCccccCcchhccCCCCCHHHHHHHHHHHHcCCCceEeECCEEEEECCCCCCCCCCHHHHHHHcCCCCCCC
Confidence 445677789999999999999999999999999999999999999999999999999999999999999999987665
Q ss_pred CCchhHHHHHHHHHHHHcCceeEEEEeCCCCCChhHHHHHHHHHHHhccCCC-------------CchhhhhhhhHHHHh
Q 002395 234 SPHVYAITDTAIREMIRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGS-------------GIEYEILKTNPILEA 300 (928)
Q Consensus 234 ~PHifaiA~~Ay~~m~~~~~~QsIiisGESGAGKTe~~K~il~yLa~~~~~~-------------~i~~~il~snpiLEA 300 (928)
|||||+||++||++|+.+++||||||||||||||||++|+||+||+.++++. .|+++|+++||||||
T Consensus 101 ~PHiyavA~~Ay~~m~~~~~nQ~IiisGESGaGKTe~~K~il~yL~~~~~~~~~~~~~~~~~~~~~i~~~il~~npiLEA 180 (789)
T d1kk8a2 101 PPHLFSVADNAYQNMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEA 180 (789)
T ss_dssp CCCHHHHHHHHHHHHHHHTSEEEEEEECSTTSSHHHHHHHHHHHHHHHSCCCCCC--------CCCHHHHHHHHHHHHHH
T ss_pred CCcHHHHHHHHHHHHHHhCCCcEEEEEeCCCCCHHHHHHHHHHHHHHHhcccccccccccccccccHHHHHHHHhHHHHh
Confidence 8999999999999999999999999999999999999999999999987532 589999999999999
Q ss_pred hcCcccCCCCCCCCcccEEEEEEcCCCCeeceeeeeeecCceeeeecCCCCCcchhhhHhhcCCChhhHhhccCCC-ccc
Q 002395 301 FGNAKTSRNDNSSRFGKLIEIHFSETGKISGANIQTFLLEKSRVVQCAEGERAYHIFYQLCVGAPPALREKLNLMS-AKE 379 (928)
Q Consensus 301 FGNAkT~rN~NSSRFGK~i~l~F~~~g~i~Ga~i~~yLLEKsRVv~q~~gERNfHIFYqll~G~~~~~~~~l~L~~-~~~ 379 (928)
||||||++|+||||||||++|+||.+|.|+||+|.+||||||||+.|++||||||||||||+|+++++++.++|.+ +..
T Consensus 181 FGNAkT~~N~NSSRFGk~~~l~f~~~g~i~ga~i~~yLLEksRvv~~~~gErnfHIFY~ll~G~~~~~~~~~~l~~~~~~ 260 (789)
T d1kk8a2 181 YGNAKTTRNNNSSRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGL 260 (789)
T ss_dssp HHEECCSSCTTEESSEEEEEEEECTTSSEEEEEEEEECCCGGGGTCCCTTCCSBHHHHHHTSCSSGGGHHHHTCCSCGGG
T ss_pred ccccCCCCCCccCCcceeEEEEECCCCCCccceeEEecCCCceeeecccccchhHHHHHHHcCCCHHHHHHhCCCCchhh
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999964 778
Q ss_pred CccccCCCccccCCcchHHHHHHHHHHhhhcccChhHHHHHHHHHHHHHhhcCeeeEEecCCCccccCChHHHHHHHHhh
Q 002395 380 YKYLRQSSCYSINGVDDAEQFRIVVEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADEGLITVAKLI 459 (928)
Q Consensus 380 y~yL~~~~~~~~~~~dD~~~f~~~~~al~~lG~~~~e~~~I~~ilAaILhLGni~F~~~~~~~~~~~~~~~~l~~~a~LL 459 (928)
|.||+++ |..++++||+++|+.++.||+.|||+++|+..||+|||||||||||+|...++++.+.+.+.+.++.||.||
T Consensus 261 ~~~l~~~-~~~~~~~~d~~~f~~~~~al~~lg~~~~e~~~i~~ilaaILhLGni~F~~~~~~~~~~~~~~~~~~~~a~LL 339 (789)
T d1kk8a2 261 YSFINQG-CLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLC 339 (789)
T ss_dssp CTTTCSS-CSCBTTBCHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCCEEC----CCCEESCSHHHHHHHHHH
T ss_pred hHhhcCC-CcccCCcchHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHhccccceeeccCCccccccCChHHHHHHHHHh
Confidence 9999875 788999999999999999999999999999999999999999999999987777778889999999999999
Q ss_pred CCCHHHHHHhhcceeeeecCceEEecCChhhHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCCCceeeeccCCCCcC
Q 002395 460 GCDIGELKLALSTRKMRVGNDTIVQNLTLSQATDTRDALAKSIYACLFEWLVEQINKSLAVGKRRTGRSISILDIYGFES 539 (928)
Q Consensus 460 gv~~~~L~~~L~~r~~~~~~e~~~~~l~~~qA~~~RDalak~LY~~LF~wlV~~IN~~l~~~~~~~~~~IgILDifGFE~ 539 (928)
||++++|.++|+++++.+++|.+++++++++|.++||+|||+||++||+|||++||..|.+.. ....+||||||||||+
T Consensus 340 gi~~~~L~~~l~~~~~~~~~e~i~~~l~~~~a~~~rdalaK~lY~~LF~wIV~~IN~~L~~~~-~~~~~IgILDIfGFE~ 418 (789)
T d1kk8a2 340 GINAGDLLKALLKPKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKA-KRNYYIGVLDIAGFEI 418 (789)
T ss_dssp TSCHHHHHHHHHSCEEC----CEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCEEEEEEECCCCCC
T ss_pred CCCHHHhhcceeEEEEecccCceecCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCCC-CcceEEEEeeccccee
Confidence 999999999999999999999999999999999999999999999999999999999998753 4567999999999999
Q ss_pred CCCCCHHHHHHHHhhHHHHHHHHHhhhhHHHHHHHhcCCcccccccCChHhHHHHhhcCCCccccccccccCCCCCChHH
Q 002395 540 FDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNKDCLNLFEKKPLGLLSLLDEESTFPNGTDLT 619 (928)
Q Consensus 540 f~~NsfEQLcINyaNEkLQ~~f~~~~f~~Eq~ey~~EgI~~~~i~f~dN~~~ldli~~kp~Gil~lLDEe~~~p~~tD~~ 619 (928)
|+.|||||||||||||+||++|++++|+.||++|.+|||+|..|+|.||.+++++|.++|.|||++|||||.+|++||.+
T Consensus 419 f~~NsfEQLcINyaNEkLq~~f~~~~f~~eq~~Y~~EgI~~~~i~~~~n~~~~~~l~~~~~Gll~lLdee~~~~~~td~~ 498 (789)
T d1kk8a2 419 FDFNSFEQLCINYTNERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKS 498 (789)
T ss_dssp CSSBCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCSCCCCHHHHHHHHHHHSTTSHHHHHHHHTTCTTCCHHH
T ss_pred cCcCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCccCCCcCCCHHHHHHHHcCCccHHHHHHhhhcCCCCCHHH
Confidence 99999999999999999999999999999999999999999999999998888888888999999999999999999999
Q ss_pred HHHHHHHHhCC-CCCCcCC--------CCCCeEEEecccceeEeccchhhhccccchHHHHHHHhhcCcch-hHHhhccc
Q 002395 620 FANKLKQHLNS-NPCFRGE--------RDKSFTVSHYAGEVIYDTTGFLEKNRDLLHLDSIELLSSCSCHL-PQIFASNM 689 (928)
Q Consensus 620 fl~kl~~~~~~-~~~f~~~--------~~~~F~I~HyaG~V~Y~~~gfleKN~D~l~~d~~~ll~~S~~~l-~~lf~~~~ 689 (928)
|++|+++++.+ ++.|.++ .+..|+|+||||+|+|+++||++||+|.++++++++|++|++++ ..+|....
T Consensus 499 ~l~kl~~~~~~~~~~~~~~~~~~~~~~~~~~F~I~HyaG~V~Y~v~gfleKN~D~l~~~l~~ll~~S~n~~i~~lf~~~~ 578 (789)
T d1kk8a2 499 FQDKLYQNHMGKNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPE 578 (789)
T ss_dssp HHHHHHHHHTTTCSSEECCCSCSSTTCCCCSEEEEETTEEEEECCSSHHHHHSCCCCHHHHHHHHTCSSHHHHHHTCC--
T ss_pred HHHHHHHHhcCCCccccCCCcccccccCCCceeEeccCCccceeccChHHhhhhhhhHHHHHHHHhCccHHHHHHhcCcc
Confidence 99999987754 4444322 14679999999999999999999999999999999999999986 45775432
Q ss_pred cccCCCCccCCCccCCCCCCCCccHHHHHHHHHHHHHHHHhccCCeeEEeccCCCCCCCCcccccchhhhhcccchhHHH
Q 002395 690 LSQSNKPVVGPLYKAGGADSQKLSVATKFKGQLFQLMQRLESTTPHFIRCIKPNNFQSPGLYEQGLVLQQLRCCGVLEVV 769 (928)
Q Consensus 690 ~~~s~~~~~~~~~~~~~~~~~~~tv~~~fk~qL~~Lm~~L~~t~phfIRCIkPN~~k~p~~fd~~~V~~QLr~~gvle~v 769 (928)
...+ ...+..+......||+++|+.||++||++|++|+||||||||||+.+.|+.||...|++||||+||||++
T Consensus 579 ~~~~------~~~~~~~~~~~~~Tv~~~Fr~sL~~L~~~L~~t~~hFIRCIKPN~~k~p~~Fd~~~V~~QLr~~Gvle~v 652 (789)
T d1kk8a2 579 EPAG------GGKKKKGKSSAFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGI 652 (789)
T ss_dssp ----------------------CCHHHHHHHHHHHHHHHHTTEEEEEEEEECCCSSCCTTCCCHHHHHHHHTTSSSCC--
T ss_pred cccc------ccCCCCCCCCCcccHHHHHHHHHHHHHHHHhcCCCeEEEecCCccccCCcccCHHHHHHHHHhhchHHHH
Confidence 1110 0111122334457999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhcCCCcccCHHHHHHHHhcccccccCC--CChHHHHHHHHHHcCCCCcceEecceeeeeecccccccccccccccc-
Q 002395 770 RISRSGFPTRMSHQKFARRYGFLLLESVAS--QDPLSVSVAILHQFNILPEMYQVGYTKLFFRAGQIGMLEDTRNRTLH- 846 (928)
Q Consensus 770 ri~r~Gyp~R~~~~eF~~RY~~L~~~~~~~--~d~~~~~~~iL~~~~~~~~~~~iGkTKVFlr~g~l~~LE~~R~~~l~- 846 (928)
||+++|||+|++|++|++||++|++...+. .|+++.|+.||..+++++.+|++|+||||||.+.+..||..|.+.+.
T Consensus 653 rirr~Gyp~R~~f~eF~~ry~~L~~~~~~~~~~~~k~~~~~il~~~~~~~~~~qiGkTkVFlr~~~~~~LE~~r~~~l~~ 732 (789)
T d1kk8a2 653 RICRKGFPSRLIYSEFKQRYSILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSK 732 (789)
T ss_dssp ---CCCSCEEEEHHHHHHHHGGGSGGGCCC---CHHHHHHHHHHHHTCCGGGEEECSSEEEECTTHHHHHHHHHHHHHHH
T ss_pred HHHHcCCCccccHHHHHHHHHHhCcccccccCCCHHHHHHHHHHhcCCChhhEEecCCEEEEChhHHHHHHHHHHHHHHH
Confidence 999999999999999999999999887653 57899999999999999999999999999999999999999877664
Q ss_pred hhHHHHHHHhhhhhhHhhhhhhh---HHHHHHHHHHhHHHHHHH
Q 002395 847 GILRVQSCFRGHQARLCLKELRR---GIVALQSFIRGEKIRKEY 887 (928)
Q Consensus 847 aav~IQ~~~Rg~laRk~y~~lr~---aav~IQs~~Rg~~aRk~~ 887 (928)
+++.||++||||++|++|+++|. ++++||+.|||+++||+|
T Consensus 733 ~~~~IQ~~~R~~~~Rk~y~k~r~~~~ai~~iQ~~~R~~~~rr~~ 776 (789)
T d1kk8a2 733 IISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNW 776 (789)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
Confidence 45678888888888888877664 556666666666666655
|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1br2a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1w7ja1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|