Citrus Sinensis ID: 002418


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-----
MASKASPSASPNRSEPLKSSSLTKTENGTLTRKEILSVIDCLKNQVAADHFVSVQRRVEKNRQKLIGVTNHLYRLSLERRNNQTINTHGSVDLLTKRQREALGVQNGIDVSSGDRDSHISQEDGYASTAVYGSSNPTKNIIRPIKLNDNKRLPPYTTWIFLDRNQRMTEDQSVMSRRRIYYDQNGGEALICSDSEEEVIEEEEKKDFVDSEDYILRMTIKEVGLSDATLESLAQCFSRSPSEVKARYEILSKEESAVGGSNNGNDEHTMNNFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAEKQPLWYHLDEGNVPCGPHCYRSVLKSERNATACSPLNGDIKEKFISSSDGAGAQTSSRKKFSGPARRVKSHQSESASSNAKNLSESSDSEVGQRQDTAFTHHSSPSKSKLVGKVGICKRKSKRVAERALVCKQKKQKKMAAFDLDSVASGGVLPSDMKLRSTSRKENEDANSSSHKHAKSSSSGKTRKKEMQIQDSRNLMHVRVPLGSSQEIVSNPPAISTNDSLRKDEFVAENMCKQELSDEKSWKTIEKGLFDKGVEIFGRNSCLIARNLLNGLKTCWEVFQYMTCSENKLFCQAGDAATSLLEGYSKFDFNGTTGNNEVRRRSRYLRRRGRVRRLKYTWKSAAYHSIRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSKKEEGGPSSGRAKKLA
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccCCcccccccccccEEEEEcccccccccccccccccccccccccEEEccccccccccccccccccccccccHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHcccccccccccHHHccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccEEEEEECcccccccccccccccccEEEEcccccccHHHHHHHHHHHHccccCEEEECccccEEEccccccHHHHHccccccccEEEEEEEccEEEEEEEEccccccccEEEEccccccccccccccccccccccccccccccccccccc
******************************TRKEILSVIDCLKNQVAADHFVSVQRRVEKNRQKLIGVTNHLYRLSLERRNNQ******SVDLL*******************************************KNIIRPIKLNDNKRLPPYTTWIFLDRNQRMTEDQSVMSRRRIYYDQNGGEALICSDSEEEV**EEEKKDFVDSEDYILRMTIKEVGLSDATLESLAQCFSR********************************NFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAEKQPLWYHLDEGNVPCGPHCYRSVLKS**************************************************************************************************************************************************************************************************************************SWKTIEKGLFDKGVEIFGRNSCLIARNLLNGLKTCWEVFQYMTCSEN***********************************************KYTWKSAAYHSIRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARK**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKASPSASPNRSEPLKSSSLTKTENGTLTRKEILSVIDCLKNQVAADHFVSVQRRVEKNRQKLIGVTNHLYRLSLERRNNQTINTHGSVDLLTKRQREALGVQNGIDVSSGDRDSHISQEDGYASTAVYGSSNPTKNIIRPIKLNDNKRLPPYTTWIFLDRNQRMTEDQSVMSRRRIYYDQNGGEALICSDSEEEVIEEEEKKDFVDSEDYILRMTIKEVGLSDATLESLAQCFSRSPSEVKARYEILSKEESAVGGSNNGNDEHTMNNFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAEKQPLWYHLDEGNVPCGPHCYRSVLKSERNATACSPLNGDIKEKFISSSDGAGAQTSSRKKFSGPARRVKSHQSESASSNAKNLSESSDSEVGQRQDTAFTHHSSPSKSKLVGKVGICKRKSKRVAERALVCKQKKQKKMAAFDLDSVASGGVLPSDMKLRSTSRKENEDANSSSHKHAKSSSSGKTRKKEMQIQDSRNLMHVRVPLGSSQEIVSNPPAISTNDSLRKDEFVAENMCKQELSDEKSWKTIEKGLFDKGVEIFGRNSCLIARNLLNGLKTCWEVFQYMTCSENKLFCQAGDAATSLLEGYSKFDFNGTTGNNEVRRRSRYLRRRGRVRRLKYTWKSAAYHSIRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSKKEEGGPSSGRAKKLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone-lysine N-methyltransferase CLF Polycomb group (PcG) protein. Catalytic subunit of some PcG multiprotein complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target genes. Required to regulate floral development by repressing the AGAMOUS homeotic gene in leaves, influorescence stems and flowers. Regulates the antero-posterior organization of the endosperm, as well as the division and elongation rates of leaf cells. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development.probableP93831
Histone-lysine N-methyltransferase EZ1 Polycomb group (PcG) protein. Catalytic subunit of some PcG multiprotein complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target genes. PcG proteins are not required to initiate repression, but to maintain it during later stages of development.probableQ8S4P6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.43Histone-lysine N-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OOI, chain A
Confidence level:very confident
Coverage over the Query: 652-684,698-713,733-745,763-909
View the alignment between query and template
View the model in PyMOL
Template: 3BO5, chain A
Confidence level:very confident
Coverage over the Query: 709-752,764-910
View the alignment between query and template
View the model in PyMOL
Template: 2CQR, chain A
Confidence level:probable
Coverage over the Query: 201-253
View the alignment between query and template
View the model in PyMOL
Template: 2YQK, chain A
Confidence level:probable
Coverage over the Query: 554-599
View the alignment between query and template
View the model in PyMOL
Template: 2F83, chain A
Confidence level:probable
Coverage over the Query: 671-778
View the alignment between query and template
View the model in PyMOL