Citrus Sinensis ID: 002443


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
cHHHHHHHHHHHHccccccHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccEEEEccccccccHHHHHHHccHHHHHcccccccccccccccEEEEcccccccccccccccccEEcccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHcccccEEcccccccccHHHHHHHHccccEEEccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHHHccccccccc
cHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHccccEEEEcccccccccccEEEEccccEEEEEEccccccccccEEEEEEccccccHHHHHcHHHHHHcccccEEEccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccHHHEEEccccccHHHHHHHHHHccEEcccccccccccHHHHHHccccEEEcccccHHHHHHHHHHHHccccHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccEcccccccccccccccccccccccccccccccccccccccc
mawvekdvsngrerdpvqdngflkgpqslpgtsgspvavgstlkgfegkdaLSYANILRSRNKFVDALALYEIVLEkdsgnveahIGKGICLqmqnmgrlafdsfseavkldpqnacahthcgilykdegrLVEAAESYHKalsadpsykpAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALkidphyapayynLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERClavspnfeiaKNNMAIALTDlgtkvklegdinQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLgviykdrdnLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQClkidpdsrnagqNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYtswdntkdperplvigyvspdyfthSVSYFIeaplvyhdyqnYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTghtannklgmmacqpapvqvtwigypnttglptidyritdsladppetkQKHVEELIrlpecflcytpspeagpvcptpaltngfitfgsfnnlakitPKVLQVWARILCavpnsrlvvkckpfccdsvrhRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDisldtfpyagttttceslymgvpcvtmagsvhahnVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDlmskspvcdgqnfalglESTYRNMWHryckgdvpslKRMEMLQQQVvseepskfseptkiifakegspgsvmpngfnqaspsmlnlsnieeNGVQLNQHY
mawvekdvsngrerdpvqdngflkgpqslpgtsgSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKAlsadpsykPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTswdntkdperPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKadaktirfrekvmkkggiwrdiygiDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCavpnsrlvvKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVvseepskfsepTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGkmdaaaemiekaiaaNPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYkvvvysavvkadakTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
******************************************LKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSL*********HVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVP******************************************************************
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPS*****************************************************************
*************RDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQ************EPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQV******************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEPSKFSEPTKIIFAKEGSPGSVMPNGFNQASPSMLNLSNIEENGVQLNQHY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query921 2.2.26 [Sep-21-2011]
O82039932 Probable UDP-N-acetylgluc N/A no 0.994 0.982 0.838 0.0
Q96301914 Probable UDP-N-acetylgluc yes no 0.965 0.972 0.837 0.0
Q8RVB2931 Probable UDP-N-acetylgluc N/A no 0.996 0.986 0.822 0.0
Q8LP10918 Probable UDP-N-acetylgluc N/A no 0.946 0.949 0.796 0.0
O82422944 Probable UDP-N-acetylgluc N/A no 0.891 0.869 0.840 0.0
Q6YZI0927 Probable UDP-N-acetylgluc yes no 0.921 0.915 0.806 0.0
Q9M8Y0977 Probable UDP-N-acetylgluc no no 0.800 0.754 0.285 2e-82
Q27HV01046 UDP-N-acetylglucosamine-- yes no 0.615 0.542 0.261 1e-55
Q8CGY81046 UDP-N-acetylglucosamine-- yes no 0.615 0.542 0.261 1e-55
P565581036 UDP-N-acetylglucosamine-- yes no 0.615 0.547 0.261 1e-55
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function desciption
 Score = 1634 bits (4232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 777/927 (83%), Positives = 840/927 (90%), Gaps = 11/927 (1%)

Query: 1   MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRS 60
           MAW EKDV NG+E D + +NGFLKG QS   + GSPV +    K FEGKDA++YANILRS
Sbjct: 1   MAWTEKDVENGKESDSLGNNGFLKGVQSSSDSKGSPVRISPVKKSFEGKDAITYANILRS 60

Query: 61  RNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHT 120
           RNKFVDALA+YE VL+KDSG++E+ IGKGICLQMQNMGRLAF+SF+EA+KLDPQNACA T
Sbjct: 61  RNKFVDALAIYESVLQKDSGSIESLIGKGICLQMQNMGRLAFESFAEAIKLDPQNACALT 120

Query: 121 HCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKY 180
           HCGILYKDEGRLVEAAESY KAL ADPSYKPAAECLAIVLTD+GTSLKLAGN+Q+GIQKY
Sbjct: 121 HCGILYKDEGRLVEAAESYQKALKADPSYKPAAECLAIVLTDIGTSLKLAGNSQEGIQKY 180

Query: 181 YEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGD 240
           YEA+KID HYAPAYYNLGVVYSE+MQYD AL CYEKAA+ERPMYAEAYCNMGVIYKNRGD
Sbjct: 181 YEAIKIDSHYAPAYYNLGVVYSEMMQYDMALNCYEKAAIERPMYAEAYCNMGVIYKNRGD 240

Query: 241 LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA 300
           LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA
Sbjct: 241 LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA 300

Query: 301 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA 360
           DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA
Sbjct: 301 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA 360

Query: 361 LSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISL 420
           L+IKPNFSQSLNNLGVVYTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG+ISL
Sbjct: 361 LTIKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGNISL 420

Query: 421 AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDN 480
           AI+AYEQCLKIDPDSRNAGQNRLLAMNYINEG DDKL+EAHRDWG RFMRLY QY SWDN
Sbjct: 421 AIEAYEQCLKIDPDSRNAGQNRLLAMNYINEGSDDKLYEAHRDWGWRFMRLYQQYNSWDN 480

Query: 481 TKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKV 540
           +KDPER LVIGYVSPDYFTHSVSYFIEAPL YHDY NYKVV+YSAVVKADAKT RFR+KV
Sbjct: 481 SKDPERQLVIGYVSPDYFTHSVSYFIEAPLAYHDYANYKVVIYSAVVKADAKTNRFRDKV 540

Query: 541 MKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYP 600
           +KKGG+WRDIYGIDEKKV++M+REDK+DI++ELTGHTANNKLGMMAC+PAPVQVTWIGYP
Sbjct: 541 LKKGGVWRDIYGIDEKKVSSMIREDKVDIMIELTGHTANNKLGMMACRPAPVQVTWIGYP 600

Query: 601 NTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFI 660
           NTTGLPTIDYRITDS+ADPP TKQKHVEEL+RLP+ FLCYTPSPEAGPV P PALTNGF+
Sbjct: 601 NTTGLPTIDYRITDSMADPPSTKQKHVEELVRLPDSFLCYTPSPEAGPVSPAPALTNGFV 660

Query: 661 TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLR 720
           TFGSFNNLAKITPKVLQVWARILCAVP+SRL+VKCKPF CDSVR RFLS LEQLGLE  R
Sbjct: 661 TFGSFNNLAKITPKVLQVWARILCAVPHSRLIVKCKPFGCDSVRQRFLSILEQLGLEPQR 720

Query: 721 VDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS 780
           VDL+PLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTM GSVHAHNVGVS
Sbjct: 721 VDLVPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMGGSVHAHNVGVS 780

Query: 781 LLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLES 840
           LL  VGL+ L+A+NEDEYV+LA+QLASDVT+L+NLRMSLR+LM+KSP+CDG  F   LES
Sbjct: 781 LLKTVGLRKLVARNEDEYVELAIQLASDVTSLSNLRMSLRELMAKSPLCDGAQFTQNLES 840

Query: 841 TYRNMWHRYCKGDVPSLKRME-------MLQQQVVSEE-PSKFSEPTKIIFAKEGSPGSV 892
           TYR+MW RYC GDVPSL+RME        L + VV EE P    E T+I  +K+   G +
Sbjct: 841 TYRSMWRRYCDGDVPSLRRMELLQQQQQTLAELVVPEESPVSPIEKTRISASKD---GPI 897

Query: 893 MPNGFNQASPSMLNLSNIEENGVQLNQ 919
             NGF  +   + N S IEENGVQLNQ
Sbjct: 898 KENGFTVSPALVYNSSTIEENGVQLNQ 924




Probable O-linked N-acetylglucosamine transferase (OGT) involved in various processes such as gibberellin (GA) signaling pathway. OGTs catalyze the addition of nucleotide-activated sugars directly onto the polypeptide through O-glycosidic linkage with the hydroxyl of serine or threonine. Probably acts by adding O-linked sugars to yet unknown proteins.
Petunia hybrida (taxid: 4102)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q8LP10|SPY_EUSER Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 Back     alignment and function description
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 Back     alignment and function description
>sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 Back     alignment and function description
>sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query921
255579381930 o-linked n-acetylglucosamine transferase 0.996 0.987 0.874 0.0
225440809914 PREDICTED: probable UDP-N-acetylglucosam 0.991 0.998 0.872 0.0
224088480934 predicted protein [Populus trichocarpa] 0.995 0.981 0.850 0.0
224140075917 predicted protein [Populus trichocarpa] 0.978 0.982 0.868 0.0
356500631928 PREDICTED: probable UDP-N-acetylglucosam 0.994 0.987 0.856 0.0
256772634916 putative SPINDLY protein [Rosa lucieae] 0.990 0.995 0.857 0.0
75318818932 RecName: Full=Probable UDP-N-acetylgluco 0.994 0.982 0.838 0.0
356534448929 PREDICTED: probable UDP-N-acetylglucosam 0.994 0.986 0.841 0.0
356505394919 PREDICTED: probable UDP-N-acetylglucosam 0.969 0.971 0.835 0.0
449526080925 PREDICTED: probable UDP-N-acetylglucosam 0.990 0.985 0.844 0.0
>gi|255579381|ref|XP_002530535.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223529939|gb|EEF31867.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1683 bits (4358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 807/923 (87%), Positives = 857/923 (92%), Gaps = 5/923 (0%)

Query: 1   MAWVEKDVSNGRERDPVQDNGFLKGPQS-LPGTSGSPVAVGSTLKGFEGKDALSYANILR 59
           MAW EK+  NG+E  P++DNGFLKG Q   P  SGSPVAV + LKG E KD+LSYANILR
Sbjct: 1   MAWTEKNNGNGKEGGPIEDNGFLKGTQEPSPSASGSPVAVAAGLKGIEEKDSLSYANILR 60

Query: 60  SRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAH 119
           SRNKFVDALA+YE VLEKDSGNVEA+IGKGICLQMQNMGRLAFDSF+EA+KLDPQNACA 
Sbjct: 61  SRNKFVDALAIYESVLEKDSGNVEAYIGKGICLQMQNMGRLAFDSFAEAIKLDPQNACAL 120

Query: 120 THCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQK 179
           THCGILYK+EGRLVEAAESY KAL ADP YKPAAECL+IVLTDLGTSLKL+GNTQ+GIQK
Sbjct: 121 THCGILYKEEGRLVEAAESYQKALRADPLYKPAAECLSIVLTDLGTSLKLSGNTQEGIQK 180

Query: 180 YYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRG 239
           YYEALKIDPHYAPAYYNLGVVYSE+MQYDTAL CYEKAALERPMYAEAYCNMGVIYKNRG
Sbjct: 181 YYEALKIDPHYAPAYYNLGVVYSEMMQYDTALNCYEKAALERPMYAEAYCNMGVIYKNRG 240

Query: 240 DLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHY 299
           DLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQG+AYYKKALYYNWHY
Sbjct: 241 DLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGIAYYKKALYYNWHY 300

Query: 300 ADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQM 359
           ADAMYNLGVAYGEMLKFD AIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQ 
Sbjct: 301 ADAMYNLGVAYGEMLKFDNAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQT 360

Query: 360 ALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSIS 419
           ALSIKPNFSQSLNNLGVVYTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG+I 
Sbjct: 361 ALSIKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIMANPTYAEAYNNLGVLYRDAGNIP 420

Query: 420 LAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWD 479
           +AI+AYEQCLKIDPDSRNAGQNRLLAMNYINEGHD+KLFEAHRDWG+RFMRLY QYT WD
Sbjct: 421 MAINAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDEKLFEAHRDWGRRFMRLYPQYTMWD 480

Query: 480 NTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREK 539
           N KD +RPLVIGYVSPDYFTHSVSYFIEAPLVYHDY NYKVVVYSAVVKADAKTIRFREK
Sbjct: 481 NPKDLDRPLVIGYVSPDYFTHSVSYFIEAPLVYHDYANYKVVVYSAVVKADAKTIRFREK 540

Query: 540 VMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGY 599
           V+K+GGIWRDIYGIDEKKVA+MVRED +DILVELTGHTANNKLGMMAC+PAP+QVTWIGY
Sbjct: 541 VLKQGGIWRDIYGIDEKKVASMVREDNVDILVELTGHTANNKLGMMACRPAPIQVTWIGY 600

Query: 600 PNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGF 659
           PNTTGLPTIDYRITDSLADP +TKQKHVEEL+RLP+CFLCYTPSPEAGPVCPTPAL NGF
Sbjct: 601 PNTTGLPTIDYRITDSLADPRDTKQKHVEELVRLPDCFLCYTPSPEAGPVCPTPALANGF 660

Query: 660 ITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESL 719
           ITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVR RFL+ LE+LGLESL
Sbjct: 661 ITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRQRFLTMLEELGLESL 720

Query: 720 RVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGV 779
           RVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAG++HAHNVGV
Sbjct: 721 RVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGAIHAHNVGV 780

Query: 780 SLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLE 839
           SLL+KVGL HL+A+NED YVQLALQLASD+ AL+NLRMSLRDLMSKSPVCDG  F LGLE
Sbjct: 781 SLLSKVGLGHLVAQNEDNYVQLALQLASDIPALSNLRMSLRDLMSKSPVCDGSKFTLGLE 840

Query: 840 STYRNMWHRYCKGDVPSLKRMEMLQQQVVSEE-PSKFSEPTKIIFAKEGSPGSVMPNGFN 898
           S+YR+MWHRYCKGDVPSLKRME+L+QQ  SE  P++  EPT+  F  EG P SV  NG+N
Sbjct: 841 SSYRDMWHRYCKGDVPSLKRMELLKQQKGSEAVPNENFEPTRNAFPVEGPPESVKLNGYN 900

Query: 899 QASPSMLNLSNIEEN--GVQLNQ 919
             S S+LN S+ EEN    QLN 
Sbjct: 901 IVSSSILNRSS-EENVSQTQLNH 922




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225440809|ref|XP_002281883.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY [Vitis vinifera] gi|297740152|emb|CBI30334.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224088480|ref|XP_002308458.1| predicted protein [Populus trichocarpa] gi|222854434|gb|EEE91981.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140075|ref|XP_002323412.1| predicted protein [Populus trichocarpa] gi|222868042|gb|EEF05173.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356500631|ref|XP_003519135.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] gi|401721241|gb|AFP99901.1| putative UDP-N-acetylglucosamin [Glycine max] Back     alignment and taxonomy information
>gi|256772634|emb|CAX46402.1| putative SPINDLY protein [Rosa lucieae] Back     alignment and taxonomy information
>gi|75318818|sp|O82039.1|SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; AltName: Full=PhSPY gi|3319682|emb|CAA76834.1| SPINDLY protein [Petunia x hybrida] Back     alignment and taxonomy information
>gi|356534448|ref|XP_003535766.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|356505394|ref|XP_003521476.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|449526080|ref|XP_004170042.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query921
TAIR|locus:2080722914 SPY "SPINDLY" [Arabidopsis tha 0.973 0.981 0.802 0.0
UNIPROTKB|Q749Z1585 GSU2601 "TPR domain/SEC-C moti 0.595 0.936 0.382 4.2e-102
TIGR_CMR|GSU_2601585 GSU_2601 "TPR domain/SEC-C mot 0.595 0.936 0.382 4.2e-102
UNIPROTKB|Q608I2699 MCA1509 "TPR domain protein" [ 0.668 0.881 0.319 3e-78
TAIR|locus:2103025977 SEC "secret agent" [Arabidopsi 0.391 0.369 0.286 5.3e-73
WB|WBGene00003858 1151 ogt-1 [Caenorhabditis elegans 0.426 0.341 0.271 1.8e-67
UNIPROTKB|O18158 1151 ogt-1 "UDP-N-acetylglucosamine 0.426 0.341 0.271 1.8e-67
UNIPROTKB|A5D7G11036 OGT "OGT protein" [Bos taurus 0.563 0.500 0.263 1.4e-66
UNIPROTKB|F1RSV21046 OGT "UDP-N-acetylglucosamine-- 0.563 0.496 0.263 1.5e-66
UNIPROTKB|P814361046 OGT "UDP-N-acetylglucosamine-- 0.563 0.496 0.263 1.5e-66
TAIR|locus:2080722 SPY "SPINDLY" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3861 (1364.2 bits), Expect = 0., P = 0.
 Identities = 728/907 (80%), Positives = 793/907 (87%)

Query:     1 MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRS 60
             M  +E D    RER PV +NGF  G +S   ++G    +  + K  +G D LSYANILR+
Sbjct:     1 MVGLEDDTE--RERSPVVENGFSNGSRSSSSSAG---VLSPSRKVTQGNDTLSYANILRA 55

Query:    61 RNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHT 120
             RNKF DALALYE +LEKDS NVEAHIGKGICLQ QN G LAFD FSEA++LDP NACA T
Sbjct:    56 RNKFADALALYEAMLEKDSKNVEAHIGKGICLQTQNKGNLAFDCFSEAIRLDPHNACALT 115

Query:   121 HCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKY 180
             HCGIL+K+EGRLVEAAESY KAL AD SYKPAAECLAIVLTDLGTSLKLAGNTQ+GIQKY
Sbjct:   116 HCGILHKEEGRLVEAAESYQKALMADASYKPAAECLAIVLTDLGTSLKLAGNTQEGIQKY 175

Query:   181 YEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGD 240
             YEALKIDPHYAPAYYNLGVVYSE+MQYD AL CYEKAALERPMYAEAYCNMGVIYKNRGD
Sbjct:   176 YEALKIDPHYAPAYYNLGVVYSEMMQYDNALSCYEKAALERPMYAEAYCNMGVIYKNRGD 235

Query:   241 LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA 300
             LE AI CYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGD+ QGVAYYKKALYYNWHYA
Sbjct:   236 LEMAITCYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDVTQGVAYYKKALYYNWHYA 295

Query:   301 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA 360
             DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGV+YKDRDNLDKAVECYQMA
Sbjct:   296 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVLYKDRDNLDKAVECYQMA 355

Query:   361 LSIKPNFSQSLNNLGVVYTVQGXXXXXXXXXXXXXXXNPTYAEAYNNLGVLYRDAGSISL 420
             LSIKPNF+QSLNNLGVVYTVQG               NPTYAEA+NNLGVLYRDAG+I++
Sbjct:   356 LSIKPNFAQSLNNLGVVYTVQGKMDAAASMIEKAILANPTYAEAFNNLGVLYRDAGNITM 415

Query:   421 AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDN 480
             AIDAYE+CLKIDPDSRNAGQNRLLAMNYINEG DDKLFEAHRDWG RF RL+ QYTSWDN
Sbjct:   416 AIDAYEECLKIDPDSRNAGQNRLLAMNYINEGLDDKLFEAHRDWGWRFTRLHPQYTSWDN 475

Query:   481 TKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYXXXXXXXXXXXXXXTIRFREKV 540
              KDPERP+ IGY+SPD+FTHSVSYFIEAPL +HDY  Y              T RFR+KV
Sbjct:   476 LKDPERPITIGYISPDFFTHSVSYFIEAPLTHHDYTKYKVVVYSAVVKADAKTYRFRDKV 535

Query:   541 MKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYP 600
             +KKGG+W+DIYGIDEKK+A+MVREDKIDILVELTGHTANNKLG MAC+PAPVQVTWIGYP
Sbjct:   536 LKKGGVWKDIYGIDEKKIASMVREDKIDILVELTGHTANNKLGTMACRPAPVQVTWIGYP 595

Query:   601 NTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFI 660
             NTTGLPT+DYRITDSLADPP+TKQK VEEL+RLP+CFLCYTPSPEAGPVCPTPAL+NGF+
Sbjct:   596 NTTGLPTVDYRITDSLADPPDTKQKQVEELVRLPDCFLCYTPSPEAGPVCPTPALSNGFV 655

Query:   661 TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLR 720
             TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDS+R RFL+TLEQLGLES R
Sbjct:   656 TFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSIRQRFLTTLEQLGLESKR 715

Query:   721 VDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS 780
             VDLLPLIL NHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS
Sbjct:   716 VDLLPLILFNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS 775

Query:   781 LLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLES 840
             LLTKVGL HL+AKNEDEYVQL++ LASDVTAL+ LRMSLRDLM+ SPVC+G +FA+GLES
Sbjct:   776 LLTKVGLGHLVAKNEDEYVQLSVDLASDVTALSKLRMSLRDLMAGSPVCNGPSFAVGLES 835

Query:   841 TYRNMWHRYCKGDVPSLKRMEMLQQQVVSEEP--SKFSEPTKIIFAKEGSPGSVMPNGFN 898
              YRNMW +YCKG+VPSL+RMEMLQ++V  ++P  SK   P+++    E +P S+  NG +
Sbjct:   836 AYRNMWKKYCKGEVPSLRRMEMLQKEV-HDDPLISKDLGPSRVSVTGEATP-SLKANG-S 892

Query:   899 QASPSML 905
                PS L
Sbjct:   893 APVPSSL 899




GO:0005634 "nucleus" evidence=ISM;IDA;TAS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0016262 "protein N-acetylglucosaminyltransferase activity" evidence=TAS
GO:0009938 "negative regulation of gibberellic acid mediated signaling pathway" evidence=IGI
GO:0005737 "cytoplasm" evidence=IDA
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0009736 "cytokinin mediated signaling pathway" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:2000377 "regulation of reactive oxygen species metabolic process" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
UNIPROTKB|Q749Z1 GSU2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2601 GSU_2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q608I2 MCA1509 "TPR domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TAIR|locus:2103025 SEC "secret agent" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00003858 ogt-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O18158 ogt-1 "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7G1 OGT "OGT protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSV2 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P81436 OGT "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O82422SPY_HORVU2, ., 4, ., 1, ., -0.84040.89140.8697N/Ano
O82039SPY_PETHY2, ., 4, ., 1, ., -0.83810.99450.9828N/Ano
Q8LP10SPY_EUSER2, ., 4, ., 1, ., -0.79670.94670.9498N/Ano
Q96301SPY_ARATH2, ., 4, ., 1, ., -0.83740.96520.9726yesno
Q6YZI0SPY_ORYSJ2, ., 4, ., 1, ., -0.80640.92180.9158yesno
Q8RVB2SPY_SOLLC2, ., 4, ., 1, ., -0.82280.99670.9860N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query921
COG3914620 COG3914, Spy, Predicted O-linked N-acetylglucosami 4e-94
pfam13844468 pfam13844, Glyco_transf_41, Glycosyl transferase f 1e-23
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-23
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-23
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-22
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-21
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-21
pfam13844468 pfam13844, Glyco_transf_41, Glycosyl transferase f 2e-20
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-20
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-20
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-18
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-18
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-17
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-16
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-14
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-14
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-14
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-11
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-10
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 2e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 3e-10
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-10
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-09
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-09
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-09
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 7e-09
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 1e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-08
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 5e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-07
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 2e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-07
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-07
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-07
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 5e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-07
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 9e-07
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-06
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 4e-06
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-06
PRK12370553 PRK12370, PRK12370, invasion protein regulator; Pr 5e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 9e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-05
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 1e-05
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-05
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 1e-05
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 1e-05
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 2e-05
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 3e-05
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 3e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-05
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 8e-05
COG4976287 COG4976, COG4976, Predicted methyltransferase (con 8e-05
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 9e-05
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 9e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 1e-04
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 1e-04
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 1e-04
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 2e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-04
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 2e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 2e-04
PRK11189296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 2e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 3e-04
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 3e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 3e-04
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 4e-04
pfam10373276 pfam10373, EST1_DNA_bind, Est1 DNA/RNA binding dom 4e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 5e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 5e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.001
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 0.001
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 0.001
PRK11447 1157 PRK11447, PRK11447, cellulose synthase subunit Bcs 0.001
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.002
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.002
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.002
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.003
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.004
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.004
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 0.004
>gnl|CDD|226428 COG3914, Spy, Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  309 bits (793), Expect = 4e-94
 Identities = 166/562 (29%), Positives = 248/562 (44%), Gaps = 56/562 (9%)

Query: 317 DMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECY-QMALSIKPNFSQSLNNLG 375
            +A +   +    NP    A  NL    +       A+    ++A  + P+ ++ L +L 
Sbjct: 84  TLAFLAKRIPLSVNPENCPAVQNLAAALELDGLQFLALADISEIAEWLSPDNAEFLGHLI 143

Query: 376 VVYTVQ------GKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISL--------- 420
             Y +       G+   A   +E+A+   P Y      L    ++  S            
Sbjct: 144 RFYQLGRYLKLLGRTAEAELALERAVDLLPKYPRVLGALMTARQEQCSWPEEAPTNLLSQ 203

Query: 421 ------AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQ 474
                         L  DP    A  N+LL +   N     +                  
Sbjct: 204 LALFLGIYGFSLAYLADDPLKNLAIANQLLKILSQNAPELVR------------------ 245

Query: 475 YTSWDNTKDPE-RPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYS-AVVKADAK 532
           +   D       + L +GY+S D  +H+V + +     YHD   ++V  YS      DA 
Sbjct: 246 FPIRDENIKRNGKRLRVGYLSSDLRSHAVGFLLRWVFEYHDRDKFEVFAYSLGPPHTDAL 305

Query: 533 TIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPV 592
             R    V K    W  I  +D+ ++A  +R D IDILV+L GHT + +  + A +PAP+
Sbjct: 306 QERISAAVEK----WYPIGRMDDAEIANAIRTDGIDILVDLDGHTVDTRCQVFAHRPAPI 361

Query: 593 QVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPT 652
           QV+W+GYP TTG P +DY I+D    PP  ++ + E+L RLP    CY P     PV P 
Sbjct: 362 QVSWLGYPATTGSPNMDYFISDPYTVPPTAEEYYSEKLWRLP---QCYQPVDGFEPVTPP 418

Query: 653 PA-----LTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCDSVRHRF 707
           P+     L    + F  FNN  KITP+V  +W +IL AVPNS L++K        +  R 
Sbjct: 419 PSRAQLGLPEDAVVFCCFNNYFKITPEVFALWMQILSAVPNSVLLLKAGG-DDAEINARL 477

Query: 708 LSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVT 767
               E+ G++S R+  LP    N DH   Y + D+ LDT+PY G TT  ++L+MGVP +T
Sbjct: 478 RDLAEREGVDSERLRFLP-PAPNEDHRARYGIADLVLDTYPYGGHTTASDALWMGVPVLT 536

Query: 768 MAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSP 827
             G   A   G S+ T  G+  L+A +  +YV+ A+   SD      +R  L+     SP
Sbjct: 537 RVGEQFASRNGASIATNAGIPELVADSRADYVEKAVAFGSDRALRQQVRAELKRSRQTSP 596

Query: 828 VCDGQNFALGLESTYRNMWHRY 849
           + D + FA  LE+ Y  MW  Y
Sbjct: 597 LFDPKAFARKLETLYWGMWSEY 618


Length = 620

>gnl|CDD|206015 pfam13844, Glyco_transf_41, Glycosyl transferase family 41 Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|206015 pfam13844, Glyco_transf_41, Glycosyl transferase family 41 Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|237080 PRK12370, PRK12370, invasion protein regulator; Provisional Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227310 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236875 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|220721 pfam10373, EST1_DNA_bind, Est1 DNA/RNA binding domain Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 921
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 100.0
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 100.0
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK114471157 cellulose synthase subunit BcsC; Provisional 100.0
PRK114471157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.98
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.98
KOG0547606 consensus Translocase of outer mitochondrial membr 99.97
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.97
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.97
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.96
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.96
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.96
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.94
KOG0547606 consensus Translocase of outer mitochondrial membr 99.94
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.94
KOG1126638 consensus DNA-binding cell division cycle control 99.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.93
PRK14574822 hmsH outer membrane protein; Provisional 99.93
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.93
KOG2076895 consensus RNA polymerase III transcription factor 99.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.93
KOG1126638 consensus DNA-binding cell division cycle control 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG2003840 consensus TPR repeat-containing protein [General f 99.91
KOG2003840 consensus TPR repeat-containing protein [General f 99.91
PRK14574822 hmsH outer membrane protein; Provisional 99.91
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.9
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.9
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.89
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.89
KOG2076895 consensus RNA polymerase III transcription factor 99.89
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.88
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.88
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.88
PLN032181060 maturation of RBCL 1; Provisional 99.85
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.84
KOG1129478 consensus TPR repeat-containing protein [General f 99.84
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.84
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.84
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.84
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.83
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.83
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.82
PLN032181060 maturation of RBCL 1; Provisional 99.82
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.82
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.82
PRK12370553 invasion protein regulator; Provisional 99.82
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.81
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
PLN03077857 Protein ECB2; Provisional 99.81
PRK12370553 invasion protein regulator; Provisional 99.81
KOG1125579 consensus TPR repeat-containing protein [General f 99.81
KOG1125579 consensus TPR repeat-containing protein [General f 99.81
KOG1129478 consensus TPR repeat-containing protein [General f 99.81
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.8
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.8
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
PRK11189296 lipoprotein NlpI; Provisional 99.77
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.77
PLN03077857 Protein ECB2; Provisional 99.77
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.76
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.76
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
KOG2376652 consensus Signal recognition particle, subunit Srp 99.76
PRK11189296 lipoprotein NlpI; Provisional 99.76
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.75
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.75
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.74
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.74
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.74
KOG1915677 consensus Cell cycle control protein (crooked neck 99.73
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 99.72
PLN02789320 farnesyltranstransferase 99.72
PLN02789320 farnesyltranstransferase 99.69
KOG1915677 consensus Cell cycle control protein (crooked neck 99.68
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.67
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.66
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.65
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.63
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.61
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.6
KOG2376652 consensus Signal recognition particle, subunit Srp 99.58
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.58
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.55
PLN02949463 transferase, transferring glycosyl groups 99.54
PRK04841903 transcriptional regulator MalT; Provisional 99.54
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.53
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.53
PRK15359144 type III secretion system chaperone protein SscB; 99.51
cd03796398 GT1_PIG-A_like This family is most closely related 99.51
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.51
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 99.49
PRK15359144 type III secretion system chaperone protein SscB; 99.48
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.48
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 99.48
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 99.47
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.46
PRK04841903 transcriptional regulator MalT; Provisional 99.45
PRK10370198 formate-dependent nitrite reductase complex subuni 99.45
cd03801374 GT1_YqgM_like This family is most closely related 99.43
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.43
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.43
cd03820348 GT1_amsD_like This family is most closely related 99.42
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 99.4
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.4
PRK10370198 formate-dependent nitrite reductase complex subuni 99.39
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 99.38
cd03822366 GT1_ecORF704_like This family is most closely rela 99.38
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.38
cd04962371 GT1_like_5 This family is most closely related to 99.37
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 99.37
KOG1128777 consensus Uncharacterized conserved protein, conta 99.36
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.36
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 99.35
cd03807365 GT1_WbnK_like This family is most closely related 99.35
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.35
cd03813475 GT1_like_3 This family is most closely related to 99.35
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.34
cd03811353 GT1_WabH_like This family is most closely related 99.33
cd03806419 GT1_ALG11_like This family is most closely related 99.33
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.32
KOG0553304 consensus TPR repeat-containing protein [General f 99.32
cd03818396 GT1_ExpC_like This family is most closely related 99.32
cd03821375 GT1_Bme6_like This family is most closely related 99.31
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.31
cd03812358 GT1_CapH_like This family is most closely related 99.3
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 99.3
KOG1128777 consensus Uncharacterized conserved protein, conta 99.29
KOG0553304 consensus TPR repeat-containing protein [General f 99.29
cd04951360 GT1_WbdM_like This family is most closely related 99.28
cd03798377 GT1_wlbH_like This family is most closely related 99.27
cd03817374 GT1_UGDG_like This family is most closely related 99.27
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.26
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.25
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.23
PRK10307412 putative glycosyl transferase; Provisional 99.22
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 99.22
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 99.2
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.2
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 99.2
cd03795357 GT1_like_4 This family is most closely related to 99.2
cd03805392 GT1_ALG2_like This family is most closely related 99.2
cd03808359 GT1_cap1E_like This family is most closely related 99.2
PLN02939977 transferase, transferring glycosyl groups 99.18
cd04949372 GT1_gtfA_like This family is most closely related 99.18
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.18
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.17
cd03825365 GT1_wcfI_like This family is most closely related 99.17
cd03823359 GT1_ExpE7_like This family is most closely related 99.16
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 99.15
cd03814364 GT1_like_2 This family is most closely related to 99.15
cd03802335 GT1_AviGT4_like This family is most closely relate 99.14
cd03819355 GT1_WavL_like This family is most closely related 99.14
PLN02846462 digalactosyldiacylglycerol synthase 99.14
cd04946407 GT1_AmsK_like This family is most closely related 99.13
TIGR02470784 sucr_synth sucrose synthase. This model represents 99.13
cd04955363 GT1_like_6 This family is most closely related to 99.13
PLN00142815 sucrose synthase 99.12
cd03809365 GT1_mtfB_like This family is most closely related 99.11
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.09
PLN023161036 synthase/transferase 99.09
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.09
cd03800398 GT1_Sucrose_synthase This family is most closely r 99.09
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 99.08
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.08
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 99.08
KOG1111426 consensus N-acetylglucosaminyltransferase complex, 99.08
PLN02501794 digalactosyldiacylglycerol synthase 99.07
KOG1941518 consensus Acetylcholine receptor-associated protei 99.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.06
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.06
KOG1941518 consensus Acetylcholine receptor-associated protei 99.05
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.04
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.03
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 99.03
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.02
cd03816415 GT1_ALG1_like This family is most closely related 98.99
PRK00654466 glgA glycogen synthase; Provisional 98.98
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.98
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.97
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.97
PRK14098489 glycogen synthase; Provisional 98.97
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.95
KOG2053932 consensus Mitochondrial inheritance and actin cyto 98.95
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.94
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 98.91
COG3898531 Uncharacterized membrane-bound protein [Function u 98.91
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 98.91
PRK14099485 glycogen synthase; Provisional 98.9
cd03804351 GT1_wbaZ_like This family is most closely related 98.9
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.9
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.89
PRK13609380 diacylglycerol glucosyltransferase; Provisional 98.89
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.88
cd03794394 GT1_wbuB_like This family is most closely related 98.88
PLN02605382 monogalactosyldiacylglycerol synthase 98.88
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.88
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.87
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.87
PHA01633335 putative glycosyl transferase group 1 98.86
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.86
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.85
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.85
PRK13608391 diacylglycerol glucosyltransferase; Provisional 98.85
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.85
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.83
PHA01630331 putative group 1 glycosyl transferase 98.83
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.82
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.81
PRK10125405 putative glycosyl transferase; Provisional 98.81
KOG4648536 consensus Uncharacterized conserved protein, conta 98.8
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.8
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.78
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 98.78
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.78
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.77
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.77
PRK10803263 tol-pal system protein YbgF; Provisional 98.77
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.76
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.76
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.75
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.74
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 98.73
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.72
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.71
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.7
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.7
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.69
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.69
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.69
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.69
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.69
COG3898531 Uncharacterized membrane-bound protein [Function u 98.68
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 98.67
PRK15331165 chaperone protein SicA; Provisional 98.67
PRK11906458 transcriptional regulator; Provisional 98.67
KOG4648536 consensus Uncharacterized conserved protein, conta 98.67
PRK11906458 transcriptional regulator; Provisional 98.67
PRK15331165 chaperone protein SicA; Provisional 98.66
PRK10803263 tol-pal system protein YbgF; Provisional 98.66
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.65
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 98.64
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 98.64
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.63
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 98.63
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.62
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.6
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.6
KOG2471696 consensus TPR repeat-containing protein [General f 98.57
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.57
KOG2471696 consensus TPR repeat-containing protein [General f 98.57
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 98.56
KOG4234271 consensus TPR repeat-containing protein [General f 98.54
KOG1387465 consensus Glycosyltransferase [Cell wall/membrane/ 98.54
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 98.52
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.5
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 98.5
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 98.5
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.49
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 98.48
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.48
PF12688120 TPR_5: Tetratrico peptide repeat 98.46
PLN02275371 transferase, transferring glycosyl groups 98.46
PF13512142 TPR_18: Tetratricopeptide repeat 98.45
KOG4234271 consensus TPR repeat-containing protein [General f 98.45
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.45
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.43
PF12688120 TPR_5: Tetratrico peptide repeat 98.41
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 98.4
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.4
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 98.38
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.37
COG4700251 Uncharacterized protein conserved in bacteria cont 98.36
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.35
KOG1586288 consensus Protein required for fusion of vesicles 98.31
PF1337173 TPR_9: Tetratricopeptide repeat 98.31
KOG0853495 consensus Glycosyltransferase [Cell wall/membrane/ 98.3
PF1337173 TPR_9: Tetratricopeptide repeat 98.28
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.28
PF13512142 TPR_18: Tetratricopeptide repeat 98.27
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 98.27
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 98.25
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.23
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.21
KOG1586288 consensus Protein required for fusion of vesicles 98.2
KOG4555175 consensus TPR repeat-containing protein [Function 98.19
KOG1258577 consensus mRNA processing protein [RNA processing 98.19
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.19
KOG4507886 consensus Uncharacterized conserved protein, conta 98.17
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.14
KOG1585308 consensus Protein required for fusion of vesicles 98.12
COG4700251 Uncharacterized protein conserved in bacteria cont 98.09
KOG1585308 consensus Protein required for fusion of vesicles 98.08
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.04
KOG4555175 consensus TPR repeat-containing protein [Function 98.04
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.03
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.03
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.02
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.01
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 98.0
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.97
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.94
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.93
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.93
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.93
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.9
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.87
KOG1550552 consensus Extracellular protein SEL-1 and related 97.83
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.82
KOG1550552 consensus Extracellular protein SEL-1 and related 97.81
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 97.8
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.8
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 97.8
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.75
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.75
TIGR03492396 conserved hypothetical protein. This protein famil 97.75
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 97.74
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 97.73
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.73
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.72
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.71
PLN02670472 transferase, transferring glycosyl groups 97.71
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.69
KOG4507886 consensus Uncharacterized conserved protein, conta 97.69
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.67
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 97.65
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.63
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.62
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.57
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.55
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.54
KOG08902382 consensus Protein kinase of the PI-3 kinase family 97.54
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.52
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.52
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.51
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.49
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 97.49
PF1342844 TPR_14: Tetratricopeptide repeat 97.49
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.49
PLN03004451 UDP-glycosyltransferase 97.48
PLN02992481 coniferyl-alcohol glucosyltransferase 97.47
TIGR02398487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 97.47
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 97.46
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.46
KOG1258577 consensus mRNA processing protein [RNA processing 97.45
PF1342844 TPR_14: Tetratricopeptide repeat 97.42
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.4
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.39
PF1343134 TPR_17: Tetratricopeptide repeat 97.35
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 97.35
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.34
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.33
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.33
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.31
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.3
PF1343134 TPR_17: Tetratricopeptide repeat 97.3
PLN03007482 UDP-glucosyltransferase family protein 97.29
PLN02764453 glycosyltransferase family protein 97.27
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.27
PLN02167475 UDP-glycosyltransferase family protein 97.26
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.26
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 97.25
PLN02554481 UDP-glycosyltransferase family protein 97.25
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.25
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.24
PLN02210456 UDP-glucosyl transferase 97.22
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 97.21
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 97.19
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.18
PLN00414446 glycosyltransferase family protein 97.16
PLN02448459 UDP-glycosyltransferase family protein 97.11
PLN02562448 UDP-glycosyltransferase 97.06
PLN02207468 UDP-glycosyltransferase 97.06
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.04
PLN00164480 glucosyltransferase; Provisional 97.02
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 97.02
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 97.01
PLN02173449 UDP-glucosyl transferase family protein 96.97
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 96.96
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.96
PLN02208442 glycosyltransferase family protein 96.95
PLN02555480 limonoid glucosyltransferase 96.94
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.94
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.9
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.89
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.88
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.86
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.86
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.83
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and 96.82
PLN03015470 UDP-glucosyl transferase 96.8
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.79
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 96.74
PLN02152455 indole-3-acetate beta-glucosyltransferase 96.71
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.7
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 96.65
PLN02534491 UDP-glycosyltransferase 96.63
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 96.58
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.56
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 96.55
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.4
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.36
KOG1463411 consensus 26S proteasome regulatory complex, subun 96.33
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 96.31
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.24
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.2
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 96.18
TIGR00661321 MJ1255 conserved hypothetical protein. This model 96.17
KOG20411189 consensus WD40 repeat protein [General function pr 96.13
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 96.09
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.01
PRK02797322 4-alpha-L-fucosyltransferase; Provisional 95.99
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.99
KOG1463411 consensus 26S proteasome regulatory complex, subun 95.96
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.94
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 95.93
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.9
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.9
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 95.89
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.89
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.88
KOG20411189 consensus WD40 repeat protein [General function pr 95.81
TIGR02094601 more_P_ylases alpha-glucan phosphorylases. This fa 95.77
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 95.74
PRK11619644 lytic murein transglycosylase; Provisional 95.68
PF05693633 Glycogen_syn: Glycogen synthase; InterPro: IPR0086 95.65
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 95.65
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.56
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.55
COG5159421 RPN6 26S proteasome regulatory complex component [ 95.53
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 95.52
PRK11619644 lytic murein transglycosylase; Provisional 95.48
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.37
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.31
cd04299778 GT1_Glycogen_Phosphorylase_like This family is mos 95.11
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 95.11
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 95.04
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 95.03
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.01
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 94.97
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.83
KOG1192496 consensus UDP-glucuronosyl and UDP-glucosyl transf 94.8
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.71
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.7
PRK10941269 hypothetical protein; Provisional 94.67
KOG2941444 consensus Beta-1,4-mannosyltransferase [Posttransl 94.63
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.58
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.53
PRK10941269 hypothetical protein; Provisional 94.49
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.48
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.47
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.29
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.22
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.17
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 94.15
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.12
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.03
COG4370412 Uncharacterized protein conserved in bacteria [Fun 94.02
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.99
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.89
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.84
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide hep 93.8
PF07429360 Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc 93.69
COG5159421 RPN6 26S proteasome regulatory complex component [ 93.58
KOG3364149 consensus Membrane protein involved in organellar 93.42
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 93.32
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.17
KOG1310758 consensus WD40 repeat protein [General function pr 93.13
KOG3364149 consensus Membrane protein involved in organellar 93.12
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.1
KOG1310758 consensus WD40 repeat protein [General function pr 93.09
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 93.03
PF01075247 Glyco_transf_9: Glycosyltransferase family 9 (hept 92.9
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.89
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 92.7
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.69
KOG4814872 consensus Uncharacterized conserved protein [Funct 92.66
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.51
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.48
COG1747711 Uncharacterized N-terminal domain of the transcrip 92.43
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 91.9
KOG2422665 consensus Uncharacterized conserved protein [Funct 91.83
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.72
KOG2422665 consensus Uncharacterized conserved protein [Funct 91.67
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisiona 91.62
TIGR02201344 heptsyl_trn_III lipopolysaccharide heptosyltransfe 91.45
KOG0529421 consensus Protein geranylgeranyltransferase type I 91.18
COG4976287 Predicted methyltransferase (contains TPR repeat) 91.16
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 90.95
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=6.1e-161  Score=1262.67  Aligned_cols=835  Identities=40%  Similarity=0.591  Sum_probs=786.1

Q ss_pred             CCCCccccCcccCCCCCCCCCCCCCcccccccCCcchHHHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHH
Q 002443           12 RERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGIC   91 (921)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~s~s~~~~~~~~~~~~~~~~l~~a~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~   91 (921)
                      .++-.+.+..+..+.....+...+..  .....+.-++.+-.+|+++..+|++++|+..|+.++++.|+..++|.++|.+
T Consensus        82 ~~~llll~ai~~q~~r~d~s~a~~~~--a~r~~~q~ae~ysn~aN~~kerg~~~~al~~y~~aiel~p~fida~inla~a  159 (966)
T KOG4626|consen   82 TERLLLLSAIFFQGSRLDKSSAGSLL--AIRKNPQGAEAYSNLANILKERGQLQDALALYRAAIELKPKFIDAYINLAAA  159 (966)
T ss_pred             ccceeeehhhhhcccchhhhhhhhhh--hhhccchHHHHHHHHHHHHHHhchHHHHHHHHHHHHhcCchhhHHHhhHHHH
Confidence            45566667777776664444332222  2233444567777799999999999999999999999999999999999999


Q ss_pred             HHHhCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCChHhHHHHHHHHHHHHHHHHHcC
Q 002443           92 LQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAG  171 (921)
Q Consensus        92 ~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~lg~~~~~~g  171 (921)
                      +...|+.+.|.++|..+++++|....+...+|.++..+|+..+|..+|.++++..|..       +.+|.++|..+..+|
T Consensus       160 l~~~~~~~~a~~~~~~alqlnP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~f-------AiawsnLg~~f~~~G  232 (966)
T KOG4626|consen  160 LVTQGDLELAVQCFFEALQLNPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCF-------AIAWSNLGCVFNAQG  232 (966)
T ss_pred             HHhcCCCcccHHHHHHHHhcCcchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCce-------eeeehhcchHHhhcc
Confidence            9999999999999999999999999999999999999999999999999999999975       445888899999999


Q ss_pred             ChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q 002443          172 NTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERC  251 (921)
Q Consensus       172 ~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~a  251 (921)
                      +...|+.+|+++++++|+..++|++||.+|.+.+.+++|+.+|.+++...|++..++.++|.+|+++|..+-|+..|+++
T Consensus       233 ei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Ykra  312 (966)
T KOG4626|consen  233 EIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYKRA  312 (966)
T ss_pred             hHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhCCChHHHHHHHHHHHHhhhhhhhhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCC
Q 002443          252 LAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNP  331 (921)
Q Consensus       252 l~~~p~~~~~~~~la~~~~~lg~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p  331 (921)
                      +++.|.+++++.+++.++..+       |+..+|..+|.+++.+.|..+++.++||.+|.++|++++|..+|.++++..|
T Consensus       313 l~~~P~F~~Ay~NlanALkd~-------G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p  385 (966)
T KOG4626|consen  313 LELQPNFPDAYNNLANALKDK-------GSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFP  385 (966)
T ss_pred             HhcCCCchHHHhHHHHHHHhc-------cchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhCh
Confidence            999999999998888888775       6999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHH
Q 002443          332 HCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVL  411 (921)
Q Consensus       332 ~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la~~  411 (921)
                      ..+.+..+||.+|.++|++++|+.+|++++.+.|..++++.++|..|..+|+.+.|+.+|.+++..+|..++++.+||.+
T Consensus       386 ~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi  465 (966)
T KOG4626|consen  386 EFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASI  465 (966)
T ss_pred             hhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcCCHHHHHHHHHHHhhcCCCChhhHhhHHHHhhhccCCCh-----HHHHHHHHHHHH--HHHhh-------------
Q 002443          412 YRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHD-----DKLFEAHRDWGK--RFMRL-------------  471 (921)
Q Consensus       412 ~~~~g~~~~A~~~~~~al~l~P~~~~a~~~~l~a~~~~~~~~~-----~~~~~~~~~~~~--~~~~~-------------  471 (921)
                      |...|+..+|++.|+++|+++||.+++..|++.++.++.+|.+     +++.+.+++|..  ++...             
T Consensus       466 ~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D~d~~~~kl~sivrdql~~~rlpsvhP~hsm~ypl~~~  545 (966)
T KOG4626|consen  466 YKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTDYDKRMKKLVSIVRDQLEKNRLPSVHPHHSMLYPLSHI  545 (966)
T ss_pred             hhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccchHHHHHHHHHHHHHHHhhhcCCccCcccccccccchH
Confidence            9999999999999999999999999999999999999999987     788888998883  33222             


Q ss_pred             ---------------------ccCCCCCCCCCCCCCCceeeccCCCcccchhhhhhhcccccccCCceEEEEEecccCCC
Q 002443          472 ---------------------YSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKAD  530 (921)
Q Consensus       472 ---------------------~~~~~~~~~~~~~~~~lriGyvS~df~~H~v~~~~~~~l~~hd~~~fev~~Y~~~~~~d  530 (921)
                                           .+|+..|.+-+.+++||||||||+||.+||+++||++++.+|||++||||||+.++.++
T Consensus       546 ~~~aia~k~a~~c~~~~~~~~k~pyth~~~l~~~~~rlrIGYvSsDFgnHp~Shlmqsv~gmHdr~kveVfcYals~~d~  625 (966)
T KOG4626|consen  546 LRKAIAAKHANLCLDKVHVLGKPPYTHPDNLKVKEGRLRIGYVSSDFGNHPTSHLMQSVPGMHDRSKVEVFCYALSVNDG  625 (966)
T ss_pred             HHHHHHHHHhhhhHHHHHhccCCCCCChhhCCCCcCceEEEeecccccCCchHHHhccCcCcCCccceEEEEEEeecCCC
Confidence                                 13467788888889999999999999999999999999999999999999999988655


Q ss_pred             hhhHHHHHHHhhhCCeeEEccCCCHHHHHHHHHhCCccEEEecCCCCCCCchhhhhcCCCceEEeeccCCCCCCCCCccE
Q 002443          531 AKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDY  610 (921)
Q Consensus       531 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~i~~d~idiLvdl~g~t~~~r~~~~a~r~ApvQ~~~~G~p~ttG~~~~Dy  610 (921)
                      .   .||.++.++++||.|+++++...+|+.|++|+|||||+|+|||.|+|.++||+|||||||+|+|||+|||+++|||
T Consensus       626 t---~fR~kv~~e~ehf~Dls~i~~~kiA~~I~qD~I~ILvnlnGyTkgarneifAlrPAPIQv~wlGyPgTtGa~~mDY  702 (966)
T KOG4626|consen  626 T---NFRDKVMKEAEHFVDLSQIPCNKIADKIRQDKIHILVNLNGYTKGARNEIFALRPAPIQVMWLGYPGTTGATFMDY  702 (966)
T ss_pred             c---hHHHHHHhhccceeehhcCChHHHHHHHhhcCceEEEeccccccccccceeeccCCceeEEeecCCCCCCCceeeE
Confidence            3   2899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecCCCCCCCcccCcccceEEcCCCccccCCCC--------CCCCCCCCCCCCCCCeEEEecCCCCcCCHHHHHHHHHH
Q 002443          611 RITDSLADPPETKQKHVEELIRLPECFLCYTPSP--------EAGPVCPTPALTNGFITFGSFNNLAKITPKVLQVWARI  682 (921)
Q Consensus       611 ~i~d~~~~p~~~~~~~~e~~~~lp~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~K~~~~~~~~~~~i  682 (921)
                      +|||.++.|++....|+|||++||+||++++|.+        ...|+++.+++++|+|||||||+++||+|.++++|++|
T Consensus       703 iITDs~tsPl~~a~~ysEkLv~lPh~ffi~d~~qk~~~~~dpn~kP~r~~y~Lp~d~vvf~~FNqLyKidP~~l~~W~~I  782 (966)
T KOG4626|consen  703 IITDSVTSPLELAQQYSEKLVYLPHCFFIGDHKQKNQDVLDPNNKPTRSQYGLPEDAVVFCNFNQLYKIDPSTLQMWANI  782 (966)
T ss_pred             EeecccCChHHHHHHHHHHHhhCCceEEecCcccccccccCCCCCCCCCCCCCCCCeEEEeechhhhcCCHHHHHHHHHH
Confidence            9999999999999999999999999999999876        56689999999999999999999999999999999999


Q ss_pred             HhHcCCcEEEEecCCCCCHHHHHHHHHHHHHcCCCCCCEEEccCcCCcHHHHHhcccccEEecCCCCCCcccHHHHhhcC
Q 002443          683 LCAVPNSRLVVKCKPFCCDSVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMG  762 (921)
Q Consensus       683 l~~~p~~~l~~~~~~~~~~~~~~~~~~~~~~~gi~~~rv~~~~~~~~~~~~~~~~~~~Dv~Ld~~~~~g~~t~~eal~~G  762 (921)
                      |++||||+||+++.|+.++   ++++..++++|++++||+|.+... .++|++++.++||+|||++|+|+||++|.||||
T Consensus       783 Lk~VPnS~LwllrfPa~ge---~rf~ty~~~~Gl~p~riifs~va~-k~eHvrr~~LaDv~LDTplcnGhTTg~dvLw~G  858 (966)
T KOG4626|consen  783 LKRVPNSVLWLLRFPAVGE---QRFRTYAEQLGLEPDRIIFSPVAA-KEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAG  858 (966)
T ss_pred             HHhCCcceeEEEeccccch---HHHHHHHHHhCCCccceeeccccc-hHHHHHhhhhhhhcccCcCcCCcccchhhhccC
Confidence            9999999999999998765   899999999999999999999877 599999999999999999999999999999999


Q ss_pred             CcEEecCCCcccccchhHHHhhcCCcccccCCHHHHHHHHHHHhcCHHHHHHHHHHHHHHhhcCCCCChHHHHHHHHHHH
Q 002443          763 VPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRDLMSKSPVCDGQNFALGLESTY  842 (921)
Q Consensus       763 vPvvt~~g~~~~~r~~~~~l~~~gl~~~i~~~~~~y~~~a~~l~~d~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~e~~~  842 (921)
                      ||+|||||+++++||++|+|..+|++++|+++.+||+++||+|++|.+.|+.+|.++|..+..|||||..+|+..||++|
T Consensus       859 vPmVTmpge~lAsrVa~Sll~~~Gl~hliak~~eEY~~iaV~Latd~~~L~~lr~~l~~~r~~splfd~~q~~~~LE~~y  938 (966)
T KOG4626|consen  859 VPMVTMPGETLASRVAASLLTALGLGHLIAKNREEYVQIAVRLATDKEYLKKLRAKLRKARASSPLFDTKQYAKGLERLY  938 (966)
T ss_pred             CceeecccHHHHHHHHHHHHHHcccHHHHhhhHHHHHHHHHHhhcCHHHHHHHHHHHHHHhcCCCccCchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCCCchhhhhhhhcccc
Q 002443          843 RNMWHRYCKGDVPSLKRMEMLQQQVVS  869 (921)
Q Consensus       843 ~~~~~~~~~~~~p~~~~~~~~~~~~~~  869 (921)
                      .+||.+||.|.+|.++|++.+|+...+
T Consensus       939 ~~MW~~y~~G~~p~h~~me~~~e~~hd  965 (966)
T KOG4626|consen  939 LQMWKKYCSGEVPDHRRMENLQEEPHD  965 (966)
T ss_pred             HHHHHHhccCCCCchHHHhccccCcCC
Confidence            999999999999999999998876543



>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism] Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>PF01075 Glyco_transf_9: Glycosyltransferase family 9 (heptosyltransferase); InterPro: IPR002201 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query921
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-32
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-14
2vsn_A568 Structure And Topological Arrangement Of An O-Glcna 2e-28
2vsy_A568 Xanthomonas Campestris Putative Ogt (Xcc0866), Apos 2e-28
3pe3_A723 Structure Of Human O-Glcnac Transferase And Its Com 4e-28
3pe3_A723 Structure Of Human O-Glcnac Transferase And Its Com 4e-23
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 7e-19
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-18
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-11
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-16
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 1e-13
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-12
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 1e-14
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 7e-11
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 8e-13
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 6e-10
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-11
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 4e-10
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 1e-09
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 5e-04
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-08
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 4e-08
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 3e-06
4eqf_A365 Trip8b-1a#206-567 Interacting With The Carboxy-Term 7e-08
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 1e-07
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 2e-06
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 1e-07
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 2e-06
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 1e-07
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 3e-06
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 2e-07
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 4e-06
3cv0_A327 Structure Of Peroxisomal Targeting Signal 1 (Pts1) 2e-06
3cvq_A327 Structure Of Peroxisomal Targeting Signal 1 (pts1) 2e-06
3q3e_A631 Crystal Structure Of The Actinobacillus Pleuropneum 2e-05
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 5e-05
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 6e-04
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 7e-05
2xpi_A597 Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 2e-04
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure

Iteration: 1

Score = 137 bits (346), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 101/353 (28%), Positives = 168/353 (47%), Gaps = 15/353 (4%) Query: 89 GICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPS 148 I Q + + R A S + A+K +P A A+++ G +YK+ G+L EA E Y AL P Sbjct: 41 SIHFQCRRLDRSAHFS-TLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD 99 Query: 149 YKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYD 208 + +L +L AG+ + +Q Y AL+ +P +LG + L + + Sbjct: 100 FIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLE 152 Query: 209 TALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIA 268 A CY KA +P +A A+ N+G ++ +G++ AI +E+ + + PNF A Sbjct: 153 EAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF-------LDA 205 Query: 269 LTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFH 328 +LG +K ++ VA Y +AL + ++A NL Y E D+AI Y A Sbjct: 206 YINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE 265 Query: 329 FNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGXXXXXX 388 PH +A NL K++ ++ +A +CY AL + P + SLNNL + QG Sbjct: 266 LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAV 325 Query: 389 XXXXXXXXXNPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQN 441 P +A A++NL + + G + A+ Y++ ++I P +A N Sbjct: 326 RLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSN 378
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2VSN|A Chain A, Structure And Topological Arrangement Of An O-Glcnac Transferase Homolog: Insight Into Molecular Control Of Intracellular Glycosylation Length = 568 Back     alignment and structure
>pdb|2VSY|A Chain A, Xanthomonas Campestris Putative Ogt (Xcc0866), Apostructure Length = 568 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|4EQF|A Chain A, Trip8b-1a#206-567 Interacting With The Carboxy-Terminal Seven Residues Of Hcn2 Length = 365 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure
>pdb|3CV0|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (Pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (Tbpex5)complexed To T. Brucei Phosphoglucoisomerase (Pgi) Pts1 Peptide Length = 327 Back     alignment and structure
>pdb|3CVQ|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (tbpex5)complexed To Pts1 Peptide (7- Skl) Length = 327 Back     alignment and structure
>pdb|3Q3E|A Chain A, Crystal Structure Of The Actinobacillus Pleuropneumoniae Hmw1c Glycosyltransferase Length = 631 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2XPI|A Chain A, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 Length = 597 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query921
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 0.0
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-31
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-28
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-26
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-20
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-15
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-05
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-136
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-91
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-21
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-134
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-102
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-84
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-72
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-67
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 1e-122
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-85
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-76
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-74
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-68
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-29
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-84
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-81
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-80
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-74
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-65
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-61
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-40
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-76
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-60
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-47
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-42
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-63
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-28
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-26
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-69
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-66
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-32
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-73
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-73
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-72
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-62
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-27
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-25
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-72
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-70
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-47
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-26
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-18
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-72
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-70
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-60
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-54
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-51
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-45
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-71
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-62
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-52
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-49
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-49
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-36
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-28
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-70
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-69
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-68
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-65
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-60
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-54
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-26
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-67
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-65
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-60
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-39
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-28
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-65
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-57
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-45
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-41
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-60
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-49
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-44
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-38
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-58
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-49
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-44
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-31
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-15
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-64
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-62
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-62
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-62
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-61
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-58
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-54
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-50
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-49
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-46
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-38
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-36
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-63
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-60
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-57
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-54
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-41
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-23
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-62
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-55
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-54
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-46
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-51
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-39
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-29
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-18
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 8e-59
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-20
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-40
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-38
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-54
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-52
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-43
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-43
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-50
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-40
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-35
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 6e-51
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 8e-30
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-49
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-42
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-35
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-35
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 6e-22
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-18
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-49
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-46
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-43
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-44
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-38
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 9e-33
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-30
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-40
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-35
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-31
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-40
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-36
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-25
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-20
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-16
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 7e-35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-28
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-34
3q15_A378 PSP28, response regulator aspartate phosphatase H; 7e-34
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-32
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-33
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-30
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-28
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-23
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-22
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-29
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-28
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-26
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-21
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 5e-21
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-28
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 5e-21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-14
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-25
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-19
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-27
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-23
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-20
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 8e-17
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-23
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-21
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-20
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-15
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-26
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-16
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-14
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-12
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-11
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-26
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-20
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 9e-26
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-25
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-23
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-23
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-15
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-24
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-23
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-21
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-18
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-18
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-12
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 4e-23
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-21
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-18
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 8e-13
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-08
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 1e-22
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 6e-21
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 5e-13
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-22
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-21
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-19
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-19
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 8e-17
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-16
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-10
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-21
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-21
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-20
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-12
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-04
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 2e-21
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 4e-20
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 3e-14
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 2e-10
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-16
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-15
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-10
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-21
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-17
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-10
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-20
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 9e-20
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-17
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-12
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-19
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-18
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-16
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-15
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-12
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-09
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-08
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-18
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 6e-13
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-09
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-18
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 4e-14
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 2e-13
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-18
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 9e-13
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 8e-08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 6e-07
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 3e-17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 8e-17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 2e-12
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 4e-07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 7e-17
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-12
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-16
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 3e-13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 4e-11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 9e-16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-12
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 9e-16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-10
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 7e-07
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 7e-06
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 7e-04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 6e-14
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-08
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-08
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-07
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-13
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 5e-11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 9e-07
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-06
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 6e-13
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-12
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 8e-08
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 4e-07
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 5e-06
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 7e-13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 6e-07
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 4e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 8e-04
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-11
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-10
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 6e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 8e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-04
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 3e-11
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 8e-09
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 3e-08
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 2e-06
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 5e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-10
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 8e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 6e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 9e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 8e-07
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-08
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-08
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-06
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-05
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-05
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 1e-09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 3e-09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 2e-08
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 3e-08
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-09
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 5e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 9e-05
1klx_A138 Cysteine rich protein B; structural genomics, heli 3e-08
1klx_A138 Cysteine rich protein B; structural genomics, heli 2e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 4e-08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 5e-08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 4e-05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 5e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 3e-07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 9e-05
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 7e-07
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 5e-05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 9e-06
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 3e-05
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 9e-06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-04
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 1e-05
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-05
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 2e-05
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 8e-04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-04
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 2e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 6e-04
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
 Score =  558 bits (1439), Expect = 0.0
 Identities = 125/571 (21%), Positives = 207/571 (36%), Gaps = 43/571 (7%)

Query: 316 FDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLG 375
               ++    A    P    A   L        +        Q  L++ P   +++  LG
Sbjct: 5   GPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLG 64

Query: 376 VVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDS 435
            V   Q +   AA ++++A  A P +      LG    DAG    A  AY +  ++ P+ 
Sbjct: 65  RVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEE 124

Query: 436 RNAGQNRLLAMNYINEGH-------------------------------DDKLFEAHRDW 464
                  L     + +                                   +     R  
Sbjct: 125 PYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTR 184

Query: 465 GKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYS 524
            +      S           + PL +G+VS  +  H       A       +   + ++ 
Sbjct: 185 AQAIAA--SVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHL 242

Query: 525 -AVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLG 583
            A    D  T+R R   + +     D+  +     A  +R   ID+L +L G     +  
Sbjct: 243 FATSGDDGSTLRTR---LAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPE 299

Query: 584 MMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPS 643
           + A +PAPVQV W+ YP T+G P +DY + D+ A PP  +  + E ++RL   F     S
Sbjct: 300 VFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTS 359

Query: 644 PEAG--PVCPTPALTNGFITFGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFCCD 701
                 P      L    +    FNN  K+ P+ +     +L  VP+S L +   P    
Sbjct: 360 RVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGP---G 416

Query: 702 SVRHRFLSTLEQLGLESLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYM 761
               R  +     G+++ R+  +P  L +  ++  Y   D+ LDT PY   TT  ++L+ 
Sbjct: 417 EADARLRAFAHAQGVDAQRLVFMP-KLPHPQYLARYRHADLFLDTHPYNAHTTASDALWT 475

Query: 762 GVPCVTMAGSVHAHNVGVSLLTKVGLKHLIAKNEDEYVQLALQLASDVTALANLRMSLRD 821
           G P +T  G   A  V  SL   +GL  +   ++  +V  A+ LASD  AL  L   +  
Sbjct: 476 GCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDV 535

Query: 822 LMSKSPVCDGQNFALGLESTYRNMWHRYCKG 852
           L   S V     FA    +  + +  R+   
Sbjct: 536 LRRASGVFHMDGFADDFGALLQALARRHGWL 566


>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Length = 631 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 921
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-54
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-37
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-36
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-29
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-11
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 4e-39
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-36
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-35
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-29
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-29
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-26
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 9e-07
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 7e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 6e-27
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 5e-18
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 6e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-26
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 7e-25
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-19
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-17
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-10
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-26
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 6e-25
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-12
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-11
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-08
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-21
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-19
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-15
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-14
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 8e-19
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-15
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-10
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-18
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 7e-09
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-08
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-17
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 6e-17
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 5e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-15
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 7e-15
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 7e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-14
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-12
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-10
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-08
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-13
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 6e-11
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 8e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 4e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 6e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-12
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-11
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-10
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 9e-10
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 6e-09
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 4e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 7e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 3e-11
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 4e-07
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-05
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 0.003
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 6e-11
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 5e-10
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 9e-09
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 0.002
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 8e-11
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 4e-09
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 7e-09
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 4e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-04
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-10
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-09
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 4e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 5e-05
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-04
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 4e-10
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 5e-10
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 7e-09
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 2e-07
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-05
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 9e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-10
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-09
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-05
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-05
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 3e-08
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 1e-04
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 7e-07
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 2e-06
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 9e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 9e-07
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 3e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.001
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 3e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 6e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.001
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.002
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.004
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 0.001
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  190 bits (483), Expect = 6e-54
 Identities = 98/392 (25%), Positives = 166/392 (42%), Gaps = 34/392 (8%)

Query: 52  LSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKL 111
           +  A+       F  A      +  ++  N    +              +    + A+K 
Sbjct: 3   MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ 62

Query: 112 DPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAG 171
           +P  A A+++ G +YK+ G+L EA E Y  AL   P +      LA  L   G       
Sbjct: 63  NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQ 122

Query: 172 NTQDG---------------------------IQKYYEALKIDPHYAPAYYNLGVVYSEL 204
                                              Y +A++  P++A A+ NLG V++  
Sbjct: 123 AYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQ 182

Query: 205 MQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNN 264
            +   A+  +EKA    P + +AY N+G + K     + A+A Y R L++SPN  +   N
Sbjct: 183 GEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGN 242

Query: 265 MAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYE 324
           +A    + G        I+  +  Y++A+    H+ DA  NL  A  E      A   Y 
Sbjct: 243 LACVYYEQG-------LIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYN 295

Query: 325 LAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKM 384
            A    P  A++ NNL  I +++ N+++AV  Y+ AL + P F+ + +NL  V   QGK+
Sbjct: 296 TALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKL 355

Query: 385 DAAAEMIEKAIAANPTYAEAYNNLGVLYRDAG 416
             A    ++AI  +PT+A+AY+N+G   ++  
Sbjct: 356 QEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query921
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.97
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.97
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.91
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.91
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.9
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.85
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.85
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.7
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.7
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.69
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.68
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.56
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.55
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.53
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.53
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 99.52
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.5
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.5
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 99.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.49
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.37
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.36
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.35
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.32
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.29
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.29
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.21
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.16
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.15
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 99.15
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.1
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 98.96
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.95
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 98.92
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.9
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.88
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.87
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.67
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.61
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.55
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 98.12
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 97.97
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.94
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.86
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 97.83
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 97.83
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 97.74
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.7
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.66
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 97.5
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 97.27
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 97.24
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.61
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.83
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 95.73
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.71
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.25
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 93.23
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.2e-41  Score=292.93  Aligned_cols=381  Identities=27%  Similarity=0.372  Sum_probs=356.9

Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC
Q ss_conf             99999999968999999999999998099988999998999998179999999999999809997889999999999839
Q 002443           51 ALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEG  130 (921)
Q Consensus        51 ~l~~a~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g  130 (921)
                      ++.+|..+++.|+|++|+..|+++++.+|+++.++..+|.++...|++++|+..|+++++.+|+++.++..+|.++...|
T Consensus         2 ll~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           2 PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             CCTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHC
T ss_conf             69999999986999999999999998689989999999999998699999999999999859998999999999964200


Q ss_pred             CHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHH
Q ss_conf             97999999999996399995768899999998899999709929999999999941999999999999999981999999
Q 002443          131 RLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTA  210 (921)
Q Consensus       131 ~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A  210 (921)
                      ++++|+..+.++....+.....       ................+...........+.........+......+....+
T Consensus        82 ~~~~A~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  154 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEA  154 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHH-------HHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             0222222222121122222222-------222222222222222222221112222222222222222222110001356


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             99999999839997999999999999879999999999999972999099999899999963356641499999999999
Q 002443          211 LGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYK  290 (921)
Q Consensus       211 ~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~lg~~~~~~~~~~~A~~~~~  290 (921)
                      ...+.+.+...|.....+..+|..+...+++++|...++++++.+|++...+..++.+       +...+++++|+..++
T Consensus       155 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~-------~~~~~~~~~A~~~~~  227 (388)
T d1w3ba_         155 KACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNV-------LKEARIFDRAVAAYL  227 (388)
T ss_dssp             HHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH-------HHTTTCTTHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH-------HHCCCCHHHHHHHHH
T ss_conf             7888874025861068998636301024719999999999998494649999997155-------220052999999999


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             99985899999999999999973996999999999986099999999999999998699899999999999609999999
Q 002443          291 KALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQS  370 (921)
Q Consensus       291 ~al~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~  370 (921)
                      ++....+.....+..+|.++...|++++|+..++++++.+|++..++..+|.++...|++++|+..+++++...|.....
T Consensus       228 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~  307 (388)
T d1w3ba_         228 RALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADS  307 (388)
T ss_dssp             HHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHH
T ss_conf             85777554799999999999987899999999999998499989999999999997487999999998654048730010


Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             999999999919999999999999992999799999999999990999999999999862099982057659999
Q 002443          371 LNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLA  445 (921)
Q Consensus       371 ~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~~~~a  445 (921)
                      +..++.++...|++++|+..++++++.+|+++.++..+|.+|..+|++++|+.+|+++++++|++..++.++..+
T Consensus       308 ~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~  382 (388)
T d1w3ba_         308 LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNT  382 (388)
T ss_dssp             HHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             157999999878999999999999986889899999999999985999999999999997099989999999999



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure