Citrus Sinensis ID: 002454

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920

MNRFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFAFQRGSPIALDISRAILDLSEDGRLKTLEEEWFKPSSECSADERYSTRPENLTLHSFWGLYIVYGATSIFCFLLFVIRLLNNSWSHQETYQGNIAAWNIAARLARYIHNRKGTINNPARVSALGLAPPALELSSSRWEYKLSPTHPPENLQVELQMHE

ccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHccccccEEEEcccccccccccccccEEEEEEccHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHccccccccccccHHHHHHHHccHHHHHHHHHHccccccccHHHHHHHHHccEEEcccccEEEccccccccccEEEEEEEccEEEEEEEEEcccccccccccccccccccccccccccccEEccccccccccccccccccccccEEEcccccccccEEEEEccccccccccccccEEEEEHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHcccccEEccEEEEccEEEEEEcccccccccEEEEEEccccccccEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHccccccccccHHHHHHcccEEEEEcccHHHHHHHHHHcccccccccccccHHHHHHHHcccccEEEEEcccHHHHHHHccccEEEcccccccccEEEEEcccccccHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccc

ccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHcccccEEEEcccccccccccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHcHccEEEEEEccccccccccHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHccccccEEEEEEccccHHcccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHcHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccEccccEEEEEcccccEccccEEEEEEccccEEEEEEEEccccEEEEccccccccccccccccccccEEEEcccccEEcccccEEcccccccEEEEEEEEEcccEEEEEccccccccccccccEcEHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHcccccEEEEEEEEEEEcEEEEEccccHHHccEEEEEEcccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccEEEEEEEHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccEEccccHHHHHHHHHHcccccccccccccHHHHHHHHHccccEEEEEccHHHHHHHHccccEEEEcccccccccEEEcccccccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEcccc

MNRFFFLVLIIASELvfvspgvesastnvnieeVTKIGAIVDANSQMGKQAITAMKIAVQNFnsdsrnhklslqirdhnrdpfQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRvqvpilsfaapavtplsmsrrwpYLIRMASNDSEQMKCIADLARKYNWRRVAAIyednvyggdsgKLALLAEALQNVssseiqsrlvlppissisdpkeAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEAnrmglvgkdSVWIVTNTVANALDSLNTTVIssmegtlgiksyysddsspykeFSALFRrnftseypeedhfhpsihalraHDSIKIITEAIGrlnynissPEMLLRQMLSsdfsglsgkirfkdgellnadTLRIVNVVGKKykeldfwlpnfgfsktsskhnvgdissniaaegftgpviwpgnlinrnpkgwampsnqepmrigvptrtFFEKFVVikddplngnsndknlrydgFSIELFRLVVDHlnydlpyefvphdgvyddlingvydktydaavgdltilgnrteyveftqpyaesgfsmivpakqeestwmftkpftWEMWMVTAASFIYTMFIVWLLEhqsnpefrgtLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTvrrlepnvtdiqslksgnlkvgcvdDSFVKKYLEEVLgfrsgnivpfgnteANYIQKFEnntidslflerpyekvFLDKYCKKYtaintyrfgglgfafqrgspiaLDISRAILDlsedgrlktleeewfkpssecsaderystrpenltlhSFWGLYIVYGATSIFCFLLFVIRLLNNSWSHQETYQGNIAAWNIAARLARYIHNrkgtinnparvsalglappalelsssrweyklspthppenlQVELQMHE

MNRFFFLVLIIASELVFVSPGvesastnvnieeVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILsfaapavtplsmsrRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSseiqsrlvlppissisdpkEAVRGElkkvqdkqsrVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIrfkdgellnadtLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVikddplngnsndkNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPnvtdiqslksgnlkvgcvDDSFVKKYLEEVLGfrsgnivpfgnTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFAFQRGSPIALDISRAILDLSEDGRLKtleeewfkpssecsaderystrpeNLTLHSFWGLYIVYGATSIFCFLLFVIRLLNNSWSHQETYQGNIAAWNIAARLARYIHNRKGTINNPARVSALGLAPPALELSSSRWEYKlspthppenlqveLQMHE

MNRFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKsyysddssPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRvvvvlwlfvvfIltssytaslsslltVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFAFQRGSPIALDISRAILDLSEDGRLKTLEEEWFKPSSECSADERYSTRPENLTLHSFWGLYIVYGATSIFCFLLFVIRLLNNSWSHQETYQGNIAAWNIAARLARYIHNRKGTINNPARVSALGLAPPALELSSSRWEYKLSPTHPPENLQVELQMHE

**RFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNF************************TAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQ*************************************SRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAM******MRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFAFQRGSPIALDISRAILDLSEDGRLKTLEEEWF*****************NLTLHSFWGLYIVYGATSIFCFLLFVIRLLNNSWSHQETYQGNIAAWNIAARLARYIHNRKGTINNPARVSALGL*********************************

*NRFFFLVLIIASELVFVSPGVESA***VNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAP*********RWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKH*************FTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRL*P*VTDIQSLKSGNLKVGCVDDSFVKKYLEEVL*************EAN***KFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFAFQRGSPIALDISRAILDLSEDGRLKTLEEEWF**********************SFWGLYIVYGATSIFCFLLFVIRLLNNSWS*************************************************************************

MNRFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFAFQRGSPIALDISRAILDLSEDGRLKTLEEEWF**************RPENLTLHSFWGLYIVYGATSIFCFLLFVIRLLNNSWSHQETYQGNIAAWNIAARLARYIHNRKGTINNPARVSALGLAPPALELSSSRWEYKLSPTHPPENLQVELQMHE

*NRFFFLVLIIASELVFVSPGVESASTNVNIEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHN*******IA*EGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTAINTYRFGGLGFAFQRGSPIALDISRAILDLSEDGRLKTLEEEWFKPSSECS********PENLTLHSFWGLYIVYGATSIFCFLLFVIRLLNNSWSHQ*******A*************N*************************************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		920	2.2.26 [Sep-21-2011]
Q8LGN0		952	Glutamate receptor 2.7 OS	yes	no	0.846	0.818	0.339	1e-130
O81078		940	Glutamate receptor 2.9 OS	no	no	0.841	0.823	0.342	1e-124
Q9LFN5		918	Glutamate receptor 2.5 OS	no	no	0.843	0.845	0.329	1e-123
Q9LFN8		967	Glutamate receptor 2.6 OS	no	no	0.867	0.825	0.326	1e-123
Q9C5V5		947	Glutamate receptor 2.8 OS	no	no	0.841	0.817	0.341	1e-122
O04660		901	Glutamate receptor 2.1 OS	no	no	0.85	0.867	0.334	1e-120
Q93YT1		912	Glutamate receptor 3.2 OS	no	no	0.888	0.895	0.315	1e-117
Q7XJL2		921	Glutamate receptor 3.1 OS	no	no	0.851	0.850	0.322	1e-116
Q8GXJ4		959	Glutamate receptor 3.4 OS	no	no	0.883	0.847	0.312	1e-114
O81776		896	Glutamate receptor 2.4 OS	no	no	0.825	0.847	0.340	1e-114

>sp\|Q8LGN0\|GLR27_ARATH Glutamate receptor 2.7 OS=Arabidopsis thaliana GN=GLR2.7 PE=2 SV=3	Back alignment and function desciption

 Score =  466 bits (1199), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 288/849 (33%), Positives = 465/849 (54%), Gaps = 70/849 (8%)

Query: 36  KIGAIVDANSQMGKQAITAMKIAVQNFNSDSRNH--KLSLQIRDHNRDPFQAATAAQELI 93
           K+G ++D ++   K  +T++ I++ +F     ++  +L++ IRD   D  QA++AA +LI
Sbjct: 40  KVGVVLDLHTSFSKLCLTSINISLSDFYKYHSDYTTRLAIHIRDSMEDVVQASSAALDLI 99

Query: 94  NKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSE 153
             E+V  I G  T  +   +  +A + QVP ++F+A    PL  S   PY +R   +DS 
Sbjct: 100 KNEQVSAIIGPRTSMQAEFMIRLADKSQVPTITFSA--TCPLLTSINSPYFVRATLDDSS 157

Query: 154 QMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSI 213
           Q+K IA + + + WR V AIY DN +G   G L LL +ALQ+V +  +   L+       
Sbjct: 158 QVKAIAAIVKSFGWRNVVAIYVDNEFG--EGILPLLTDALQDVQAFVVNRCLI------- 208

Query: 214 SDPKEA----VRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNT 269
             P+EA    +  EL K+   Q+RVF+V      +    F +A  +G++ +  VW++T+ 
Sbjct: 209 --PQEANDDQILKELYKLMTMQTRVFVV-HMPPTLGFRFFQKAREIGMMEEGYVWLLTDG 265

Query: 270 VANALDS-LNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIH 328
           V N L S    + + +M+G LG++S+    S   K F   + + F  +  +E+    +I 
Sbjct: 266 VMNLLKSNERGSSLENMQGVLGVRSHIPK-SKKLKNFRLRWEKMFPKKGNDEEM---NIF 321

Query: 329 ALRAHDSIKIITEAIGRLN-------YNISSPE---------------MLLRQMLSSDFS 366
           ALRA+DSI  +  A+ + N       + I+S                  LL+ + +  F+
Sbjct: 322 ALRAYDSITALAMAVEKTNIKSLRYDHPIASGNNKTNLGTLGVSRYGPSLLKALSNVRFN 381

Query: 367 GLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAE 426
           GL+G+    +G+L  +    ++N++G + + +  W P+ G     SK+    +   +   
Sbjct: 382 GLAGEFELINGQL-ESSVFDVINIIGSEERIIGLWRPSNGIVNAKSKNTTSVLGERL--- 437

Query: 427 GFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLR 486
              GPVIWPG   +  PKGW +P+N + +R+G+P +  F +FV  K DP++       + 
Sbjct: 438 ---GPVIWPGKSKDV-PKGWQIPTNGKMLRVGIPVKKGFLEFVDAKIDPISNA-----MT 488

Query: 487 YDGFSIELFRLVVDHLNYD-LP--YEFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRT 543
             G+ IE+F  V+  L Y  +P    F+  D  YD+++  VY   YDA VGD+TI+ NR+
Sbjct: 489 PTGYCIEIFEAVLKKLPYSVIPKYIAFLSPDENYDEMVYQVYTGAYDAVVGDVTIVANRS 548

Query: 544 EYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSN 603
            YV+FT PY ESG SM+VP K  ++TW+F +P++ ++W+ TA  F++  FIVW+LEH+ N
Sbjct: 549 LYVDFTLPYTESGVSMMVPLKDNKNTWVFLRPWSLDLWVTTACFFVFIGFIVWILEHRVN 608

Query: 604 PEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTSSYTASLSSL 663
            +FRG    QI    WFAFST+ F+HR  + SNL R VV++W FVV +L  SYTA+L+S 
Sbjct: 609 TDFRGPPHHQIGTSFWFAFSTMNFAHREKVVSNLARFVVLVWCFVVLVLIQSYTANLTSF 668

Query: 664 LTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKF 723
            TV+ L+P VT+ + L   N  +G    +FV++ L+   GF    + PFG +     + F
Sbjct: 669 FTVKLLQPTVTNWKDLIKFNKNIGYQRGTFVRELLKS-QGFDESQLKPFG-SAVECDELF 726

Query: 724 ENNTIDSLFLERPYEKVFLDKYCKKYTAIN-TYRFGGLGFAFQRGSPIALDISRAILDLS 782
            N TI + F E  Y KV L +   KYT +  +++  G GF F + SP+  D+SRAIL+++
Sbjct: 727 SNGTITASFDEVAYIKVILSQNSSKYTMVEPSFKTAGFGFVFPKKSPLTDDVSRAILNVT 786

Query: 783 EDGRLKTLEEEWFKPSSECSADERYSTRPENLTLHSFWGLYIVYGATSIFCFLLFVIRLL 842
           +   ++ +E +WFK  + C  D   S    +L+L SFWGL+++ G  S    L+FV   L
Sbjct: 787 QGEEMQHIENKWFKKPNNC-PDLNTSLSSNHLSLSSFWGLFLIAGIASFLALLIFVANFL 845

Query: 843 NNSWSHQET 851
              + H+ T
Sbjct: 846 ---YEHKHT 851

Glutamate-gated receptor that probably acts as non-selective cation channel. May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells.
Arabidopsis thaliana (taxid: 3702)

>sp\|O81078\|GLR29_ARATH Glutamate receptor 2.9 OS=Arabidopsis thaliana GN=GLR2.9 PE=2 SV=1	Back alignment and function description

>sp\|Q9LFN5\|GLR25_ARATH Glutamate receptor 2.5 OS=Arabidopsis thaliana GN=GLR2.5 PE=1 SV=2	Back alignment and function description

>sp\|Q9LFN8\|GLR26_ARATH Glutamate receptor 2.6 OS=Arabidopsis thaliana GN=GLR2.6 PE=2 SV=2	Back alignment and function description

>sp\|Q9C5V5\|GLR28_ARATH Glutamate receptor 2.8 OS=Arabidopsis thaliana GN=GLR2.8 PE=2 SV=2	Back alignment and function description

>sp\|O04660\|GLR21_ARATH Glutamate receptor 2.1 OS=Arabidopsis thaliana GN=GLR2.1 PE=2 SV=2	Back alignment and function description

>sp\|Q93YT1\|GLR32_ARATH Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=GLR3.2 PE=1 SV=2	Back alignment and function description

>sp\|Q7XJL2\|GLR31_ARATH Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=GLR3.1 PE=2 SV=2	Back alignment and function description

>sp\|Q8GXJ4\|GLR34_ARATH Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=GLR3.4 PE=2 SV=2	Back alignment and function description

>sp\|O81776\|GLR24_ARATH Glutamate receptor 2.4 OS=Arabidopsis thaliana GN=GLR2.4 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		920
255563044		843	glutamate receptor 2 plant, putative [Ri	0.852	0.930	0.591	0.0
224077012		942	glutamate-gated kainate-type ion channel	0.963	0.940	0.551	0.0
224077014		931	glutamate-gated kainate-type ion channel	0.940	0.929	0.543	0.0
224114740		867	glutamate-gated kainate-type ion channel	0.903	0.958	0.558	0.0
225443524		916	PREDICTED: glutamate receptor 2.7-like [	0.925	0.929	0.518	0.0
147838919		916	hypothetical protein VITISV_034689 [Viti	0.925	0.929	0.514	0.0
224114736		836	glutamate-gated kainate-type ion channel	0.885	0.974	0.538	0.0
357446857		1083	Glutamate receptor 2.7 [Medicago truncat	0.921	0.783	0.478	0.0
356546605		910	PREDICTED: glutamate receptor 2.7-like [	0.921	0.931	0.495	0.0
356519637		1033	PREDICTED: glutamate receptor 2.7-like [	0.901	0.802	0.490	0.0

>gi\|255563044\|ref\|XP_002522526.1\| glutamate receptor 2 plant, putative [Ricinus communis] gi\|223538217\|gb\|EEF39826.1\| glutamate receptor 2 plant, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/800 (59%), Positives = 595/800 (74%), Gaps = 16/800 (2%)

Query: 55  MKIAVQNFNSDSRNHKLSLQIRDHNRDPFQAATAAQELINKEKVKVIAGMETWEETAVVA 114
           M IAV+NFN+ SR HKLSL  +DH R P QAA AA+ LI K+ VK I GM+ WEE A+VA
Sbjct: 1   MDIAVRNFNNASRKHKLSLHFQDHQRQPLQAAQAAERLIKKKAVKAIIGMDIWEEAALVA 60

Query: 115 EIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIY 174
           +I S+ QVP+ SF+APA TP     RWP+L+RM  N+SEQM+CIA+LAR YNWRRV  ++
Sbjct: 61  DIGSQSQVPVFSFSAPATTPPLAQSRWPFLVRMVYNNSEQMRCIAELARLYNWRRVVTVH 120

Query: 175 EDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRV 234
           EDN  GGD G+L LL++ALQ V S +I+  LVLPP S   DPKE ++ EL K+Q+ +SRV
Sbjct: 121 EDNTNGGDFGELILLSQALQEVGS-QIEHSLVLPPFSLPFDPKEIIKEELTKLQEVKSRV 179

Query: 235 FIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVANALDSLNTTVISSMEGTLGIKSY 294
           FIVLQ SL + IHL  EA  MG+VGKDSVWI+T+TV + LDS++T+VI +MEG LGIK+ 
Sbjct: 180 FIVLQTSLPLAIHLLREAKEMGMVGKDSVWILTDTVTSFLDSVDTSVILTMEGALGIKTN 239

Query: 295 YSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEAIGRLNYNISSPE 354
           YSD SS YK F + FRRNF+S YPEED+F P  +ALRA+DSI  I +A+ R++ NIS+ +
Sbjct: 240 YSDSSSEYKSFYSQFRRNFSSTYPEEDNFDPGFYALRAYDSITTIIKAMERMSSNISNSK 299

Query: 355 MLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKH 414
           + L  +LSS+F+GLSG+I F+ GELL++  LRIVNVVGKKYKE+DFWLP FGFSK     
Sbjct: 300 VFLNDILSSNFTGLSGQIHFRSGELLHSPKLRIVNVVGKKYKEIDFWLPKFGFSKGRKDD 359

Query: 415 NVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDD 474
              +  +   + G  GPV WPG+L  R PKGWAMPSN +PM IGVP RT FEKFV +   
Sbjct: 360 ---EDENGGGSMGLEGPVNWPGDL-KRIPKGWAMPSNAKPMIIGVPGRTSFEKFVKV--- 412

Query: 475 PLNGNSNDKNLRYDGFSIELFRLVVDHLNYDLPYEFVPHDGVYDDLINGVYDKTYDAAVG 534
            +N + N    RYDG+ IELFR V + L Y L + FVP++G+YDDL+N +Y+KTYDA VG
Sbjct: 413 -VNASEN----RYDGYCIELFRKVTEVLGYSLYHRFVPYNGIYDDLVNHLYNKTYDAIVG 467

Query: 535 DLTILGNRTEYVEFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFI 594
           D+TIL  R++ VEFTQPYAESG SM+V  K EES WMF KPFTWEMW VT A  IYTMFI
Sbjct: 468 DITILAERSDKVEFTQPYAESGLSMVVTVKSEESAWMFMKPFTWEMWAVTGAILIYTMFI 527

Query: 595 VWLLEHQSNPEFRGTLKDQISNILWFAFSTIFFSHRANIQSNLTRVVVVLWLFVVFILTS 654
           VW LEHQ+NPEFRG  K+Q+   + F FS++FF+HR  + SNLTR+VVV+WLFVV IL S
Sbjct: 528 VWFLEHQTNPEFRGPWKNQMGTAVLFTFSSLFFAHREKVYSNLTRLVVVVWLFVVLILNS 587

Query: 655 SYTASLSSLLTVRRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGN 714
           SYTA+L+S+LT++RL+PNVTDI+ LK  NL VGC  DSFV+KYLE VL FR  NI    +
Sbjct: 588 SYTANLTSMLTIQRLQPNVTDIEWLKRNNLPVGCDGDSFVRKYLENVLQFRPENIKNV-S 646

Query: 715 TEANYIQKFENNTIDSLFLERPYEKVFLDKYCKKYTA-INTYRFGGLGFAFQRGSPIALD 773
           +E +Y  +F+  TI + FLE PY+KVF++ YCK Y A   T+RFGGLGFAFQ+GSPIA D
Sbjct: 647 SEYSYPGEFQKKTIYAAFLELPYQKVFMNHYCKNYIANTPTHRFGGLGFAFQKGSPIAAD 706

Query: 774 ISRAILDLSEDGRLKTLEEEWFKPSSECSADERYSTRPENLTLHSFWGLYIVYGATSIFC 833
           +S+AIL LSEDG LK LE++WF PSS+C+++     R E+L+L +FWGLY++ GATS  C
Sbjct: 707 VSKAILKLSEDGSLKKLEDKWFTPSSQCASNAN-DNRNESLSLQNFWGLYLISGATSTIC 765

Query: 834 FLLFVIRLLNNSWSHQETYQ 853
           FLLF+I LL   W  Q   Q
Sbjct: 766 FLLFLIHLLKKYWHDQNVEQ 785

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224077012\|ref\|XP_002305092.1\| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi\|222848056\|gb\|EEE85603.1\| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224077014\|ref\|XP_002305093.1\| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi\|222848057\|gb\|EEE85604.1\| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224114740\|ref\|XP_002316843.1\| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi\|222859908\|gb\|EEE97455.1\| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225443524\|ref\|XP_002272216.1\| PREDICTED: glutamate receptor 2.7-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147838919\|emb\|CAN63664.1\| hypothetical protein VITISV_034689 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224114736\|ref\|XP_002316842.1\| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi\|222859907\|gb\|EEE97454.1\| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357446857\|ref\|XP_003593704.1\| Glutamate receptor 2.7 [Medicago truncatula] gi\|355482752\|gb\|AES63955.1\| Glutamate receptor 2.7 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356546605\|ref\|XP_003541715.1\| PREDICTED: glutamate receptor 2.7-like [Glycine max]	Back alignment and taxonomy information

>gi\|356519637\|ref\|XP_003528477.1\| PREDICTED: glutamate receptor 2.7-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		920
TAIR\|locus:2066107		952	GLR2.7 "glutamate receptor 2.7	0.85	0.821	0.326	3.1e-115
TAIR\|locus:2066148		940	GLR2.9 "glutamate receptor 2.9	0.913	0.893	0.316	6.6e-113
TAIR\|locus:2066086		947	GLR2.8 "glutamate receptor 2.8	0.916	0.890	0.312	7.6e-112
TAIR\|locus:2122128		912	GLUR2 "glutamate receptor 2" [	0.522	0.527	0.324	5.1e-104
TAIR\|locus:2181196		901	GLR2.1 "glutamate receptor 2.1	0.884	0.903	0.314	6.9e-102
TAIR\|locus:2047256		920	GLR2.2 "glutamate receptor 2.2	0.870	0.870	0.310	1.1e-96
TAIR\|locus:2207165		959	GLR3.4 "AT1G05200" [Arabidopsi	0.846	0.812	0.302	9.7e-96
TAIR\|locus:2081805		903	GLR3.6 "glutamate receptor 3.6	0.879	0.895	0.297	1.8e-94
TAIR\|locus:2047251		895	GLR2.3 "glutamate receptor 2.3	0.864	0.888	0.301	6.1e-94
TAIR\|locus:2062586		921	GLR5 "glutamate receptor 5" [A	0.854	0.853	0.286	4.5e-91

TAIR\|locus:2066107 GLR2.7 "glutamate receptor 2.7" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1136 (405.0 bits), Expect = 3.1e-115, P = 3.1e-115
 Identities = 276/846 (32%), Positives = 451/846 (53%)

Query:    36 KIGAIVDANSQMGKQAITAMKIAVQNF---NSDSRNHKLSLQIRDHNRDPFQAATAAQEL 92
             K+G ++D ++   K  +T++ I++ +F   +SD    +L++ IRD   D  QA++AA +L
Sbjct:    40 KVGVVLDLHTSFSKLCLTSINISLSDFYKYHSDYTT-RLAIHIRDSMEDVVQASSAALDL 98

Query:    93 INKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDS 152
             I  E+V  I G  T  +   +  +A + QVP ++F+A    PL  S   PY +R   +DS
Sbjct:    99 IKNEQVSAIIGPRTSMQAEFMIRLADKSQVPTITFSATC--PLLTSINSPYFVRATLDDS 156

Query:   153 EQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPISS 212
              Q+K IA + + + WR V AIY DN +G   G L LL +ALQ+V +  + +R ++P    
Sbjct:   157 SQVKAIAAIVKSFGWRNVVAIYVDNEFG--EGILPLLTDALQDVQAFVV-NRCLIP--QE 211

Query:   213 ISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVAN 272
              +D  + +  EL K+   Q+RVF+V      +    F +A  +G++ +  VW++T+ V N
Sbjct:   212 AND--DQILKELYKLMTMQTRVFVVHMPPT-LGFRFFQKAREIGMMEEGYVWLLTDGVMN 268

Query:   273 ALDSLNT-TVISSMEGTLGIKXXXXXXXXPYKEFSALFRRNFTSEYPEEDHFHPSIHALR 331
              L S    + + +M+G LG++          K F   + + F  +  +E+    +I ALR
Sbjct:   269 LLKSNERGSSLENMQGVLGVRSHIPKSKK-LKNFRLRWEKMFPKKGNDEEM---NIFALR 324

Query:   332 AHDSIKIITEAIGRLN-----YN--ISSPE---------------MLLRQMLSSDFSGLS 369
             A+DSI  +  A+ + N     Y+  I+S                  LL+ + +  F+GL+
Sbjct:   325 AYDSITALAMAVEKTNIKSLRYDHPIASGNNKTNLGTLGVSRYGPSLLKALSNVRFNGLA 384

Query:   370 GKIRFKDGELLNADTLRIVNVVGKKYKELDFWLPNFGFSKTSSKHNVGDISSNIAAEGFT 429
             G+    +G+L  +    ++N++G + + +  W P+ G     SK+    +   +      
Sbjct:   385 GEFELINGQL-ESSVFDVINIIGSEERIIGLWRPSNGIVNAKSKNTTSVLGERL------ 437

Query:   430 GPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSNDKNLRYDG 489
             GPVIWPG   +  PKGW +P+N + +R+G+P +  F +FV  K DP++ N+    +   G
Sbjct:   438 GPVIWPGKSKDV-PKGWQIPTNGKMLRVGIPVKKGFLEFVDAKIDPIS-NA----MTPTG 491

Query:   490 FSIELFRLVVDHLNYD-LP-Y-EFVPHDGVYDDLINGVYDKTYDAAVGDLTILGNRTEYV 546
             + IE+F  V+  L Y  +P Y  F+  D  YD+++  VY   YDA VGD+TI+ NR+ YV
Sbjct:   492 YCIEIFEAVLKKLPYSVIPKYIAFLSPDENYDEMVYQVYTGAYDAVVGDVTIVANRSLYV 551

Query:   547 EFTQPYAESGFSMIVPAKQEESTWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEF 606
             +FT PY ESG SM+VP K  ++TW+F +P++ ++W+ TA  F++  FIVW+LEH+ N +F
Sbjct:   552 DFTLPYTESGVSMMVPLKDNKNTWVFLRPWSLDLWVTTACFFVFIGFIVWILEHRVNTDF 611

Query:   607 RGTLKDQISNILWFAFSTIFFSHRANIQSNLTRXXXXXXXXXXXIXXXXXXXXXXXXXXV 666
             RG    QI    WFAFST+ F+HR  + SNL R           +              V
Sbjct:   612 RGPPHHQIGTSFWFAFSTMNFAHREKVVSNLARFVVLVWCFVVLVLIQSYTANLTSFFTV 671

Query:   667 RRLEPNVTDIQSLKSGNLKVGCVDDSFVKKYLEEVLGFRSGNIVPFGNTEANYIQKFENN 726
             + L+P VT+ + L   N  +G    +FV++ L+   GF    + PFG+      + F N 
Sbjct:   672 KLLQPTVTNWKDLIKFNKNIGYQRGTFVRELLKSQ-GFDESQLKPFGSA-VECDELFSNG 729

Query:   727 TIDSLFLERPYEKVFLDKYCKKYTAIN-TYRFGGLGFAFQRGSPIALDISRAILDLSEDG 785
             TI + F E  Y KV L +   KYT +  +++  G GF F + SP+  D+SRAIL++++  
Sbjct:   730 TITASFDEVAYIKVILSQNSSKYTMVEPSFKTAGFGFVFPKKSPLTDDVSRAILNVTQGE 789

Query:   786 RLKTLEEEWFKPSSECSADERYSTRPENLTLHSFWGLYIVYGATSIFCFLLFVIRLLNNS 845
              ++ +E +WFK  + C  D   S    +L+L SFWGL+++ G  S    L+FV   L   
Sbjct:   790 EMQHIENKWFKKPNNCP-DLNTSLSSNHLSLSSFWGLFLIAGIASFLALLIFVANFL--- 845

Query:   846 WSHQET 851
             + H+ T
Sbjct:   846 YEHKHT 851

GO:0004970 "ionotropic glutamate receptor activity" evidence=IEA

GO:0005215 "transporter activity" evidence=IEA

GO:0005217 "intracellular ligand-gated ion channel activity" evidence=ISS

GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0006810 "transport" evidence=IEA

GO:0016020 "membrane" evidence=IEA

GO:0006874 "cellular calcium ion homeostasis" evidence=NAS

GO:0009416 "response to light stimulus" evidence=NAS

GO:0005773 "vacuole" evidence=IDA

GO:0009627 "systemic acquired resistance" evidence=RCA

GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA

TAIR\|locus:2066148 GLR2.9 "glutamate receptor 2.9" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2066086 GLR2.8 "glutamate receptor 2.8" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2122128 GLUR2 "glutamate receptor 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2181196 GLR2.1 "glutamate receptor 2.1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2047256 GLR2.2 "glutamate receptor 2.2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2207165 GLR3.4 "AT1G05200" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2081805 GLR3.6 "glutamate receptor 3.6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2047251 GLR2.3 "glutamate receptor 2.3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2062586 GLR5 "glutamate receptor 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8LGN0	GLR27_ARATH	No assigned EC number	0.3392	0.8467	0.8182	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		920
cd06366		350	cd06366, PBP1_GABAb_receptor, Ligand-binding domai	1e-92
pfam00060		268	pfam00060, Lig_chan, Ligand-gated ion channel	6e-52
pfam01094		343	pfam01094, ANF_receptor, Receptor family ligand bi	2e-41
cd06350		348	cd06350, PBP1_GPCR_family_C_like, Ligand-binding d	3e-41
cd06269		298	cd06269, PBP1_glutamate_receptors_like, Family C G	5e-36
cd04509		299	cd04509, PBP1_ABC_transporter_GCPR_C_like, Family	4e-34
cd06268		298	cd06268, PBP1_ABC_transporter_LIVBP_like, Periplas	2e-24
pfam13458		343	pfam13458, Peripla_BP_6, Periplasmic binding prote	3e-22
COG0683		366	COG0683, LivK, ABC-type branched-chain amino acid	8e-20
cd01391		269	cd01391, Periplasmic_Binding_Protein_Type_1, Type	8e-19
cd06351		328	cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci	4e-18
cd06333		312	cd06333, PBP1_ABC-type_HAAT_like, Type I periplasm	8e-17
smart00079		133	smart00079, PBPe, Eukaryotic homologues of bacteri	1e-16
cd06345		344	cd06345, PBP1_ABC_ligand_binding_like_10, Type I p	1e-12
cd06352		389	cd06352, PBP1_NPR_GC_like, Ligand-binding domain o	2e-12
cd06367		362	cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isole	3e-12
pfam00497		220	pfam00497, SBP_bac_3, Bacterial extracellular solu	2e-10
cd06363		410	cd06363, PBP1_Taste_receptor, Ligand-binding domai	4e-10
cd06330		346	cd06330, PBP1_Arsenic_SBP_like, Periplasmic solute	3e-09
cd06340		347	cd06340, PBP1_ABC_ligand_binding_like_6, Type I pe	8e-09
cd06342		334	cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic l	1e-08
cd06346		312	cd06346, PBP1_ABC_ligand_binding_like_11, Type I p	1e-08
COG0834		275	COG0834, HisJ, ABC-type amino acid transport/signa	4e-08
cd06347		334	cd06347, PBP1_ABC_ligand_binding_like_12, Type I p	4e-08
cd06327		334	cd06327, PBP1_SBP_like_1, Periplasmic solute-bindi	1e-07
cd06368		324	cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc	1e-07
cd06338		345	cd06338, PBP1_ABC_ligand_binding_like_5, Type I pe	2e-07
cd06348		344	cd06348, PBP1_ABC_ligand_binding_like_13, Type I p	3e-07
cd00134		218	cd00134, PBPb, Bacterial periplasmic transport sys	5e-07
cd06335		347	cd06335, PBP1_ABC_ligand_binding_like_2, Type I pe	7e-07
cd06332		333	cd06332, PBP1_aromatic_compounds_like, Type I peri	7e-07
pfam00497		220	pfam00497, SBP_bac_3, Bacterial extracellular solu	2e-06
smart00062		219	smart00062, PBPb, Bacterial periplasmic substrate-	4e-06
cd06374		472	cd06374, PBP1_mGluR_groupI, Ligand binding domain	5e-06
cd06361		403	cd06361, PBP1_GPC6A_like, Ligand-binding domain of	8e-06
cd06326		336	cd06326, PBP1_STKc_like, Type I periplasmic bindin	1e-05
cd06376		463	cd06376, PBP1_mGluR_groupIII, Ligand-binding domai	5e-05
cd06339		336	cd06339, PBP1_YraM_LppC_lipoprotein_like, Periplas	6e-05
cd06337		357	cd06337, PBP1_ABC_ligand_binding_like_4, Type I pe	6e-05
PRK09495		247	PRK09495, glnH, glutamine ABC transporter periplas	1e-04
cd06375		458	cd06375, PBP1_mGluR_groupII, Ligand binding domain	1e-04
cd06336		347	cd06336, PBP1_ABC_ligand_binding_like_3, Type I pe	1e-04
COG0834		275	COG0834, HisJ, ABC-type amino acid transport/signa	2e-04
cd06373		396	cd06373, PBP1_NPR_like, Ligand binding domain of n	2e-04
cd06362		452	cd06362, PBP1_mGluR, Ligand binding domain of the	3e-04
cd06328		333	cd06328, PBP1_SBP_like_2, Periplasmic solute-bindi	0.001
smart00918		62	smart00918, Lig_chan-Glu_bd, Ligated ion channel L	0.001
cd06379		377	cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/i	0.002
cd06382		327	cd06382, PBP1_iGluR_Kainate, N-terminal leucine/is	0.003
TIGR01096		250	TIGR01096, 3A0103s03R, lysine-arginine-ornithine-b	0.003
cd06342		334	cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic l	0.004

>gnl\|CDD\|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA)	Back alignment and domain information

 Score =  296 bits (760), Expect = 1e-92
 Identities = 134/382 (35%), Positives = 214/382 (56%), Gaps = 42/382 (10%)

Query: 36  KIGAIVDAN-SQMGKQAITAMKIAVQNFNSDSRNH---KLSLQIRDHNRDPFQAATAAQE 91
           +IGAI D + S +GK A+ A+++A+++ N+D+      +L L +RD   DP QAA+AA +
Sbjct: 1   RIGAIFDLSGSWIGKAALPAIEMALEDVNADNSILPGYRLVLHVRDSKCDPVQAASAALD 60

Query: 92  LINKEKVKVIAGMETWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASND 151
           L+  + V  I G +       VAE+A+   VP+LSFAA + + LS   ++PY  R   +D
Sbjct: 61  LLENKPVVAIIGPQCSSVAEFVAEVANEWNVPVLSFAATSPS-LSSRLQYPYFFRTTPSD 119

Query: 152 SEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGKLALLAEALQNVSSSEIQSRLVLPPIS 211
           S Q   IA L +K+ WRRVA IYED+ YG  SG L  L +ALQ     EI  R   PP +
Sbjct: 120 SSQNPAIAALLKKFGWRRVATIYEDDDYG--SGGLPDLVDALQEA-GIEISYRAAFPPSA 176

Query: 212 SISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWIVTNTVA 271
           +  D  +     LKK+++K SRV +V   S D+   +F EA ++G++GK  VWI+T+ ++
Sbjct: 177 NDDDITD----ALKKLKEKDSRVIVVH-FSPDLARRVFCEAYKLGMMGKGYVWILTDWLS 231

Query: 272 NAL----DSLNTTVISSMEGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSI 327
           +      D  +  ++ +M+G +G++SY  + S   +EF++ +R+ F +E PE     PSI
Sbjct: 232 SNWWSSSDCTDEEMLEAMQGVIGVRSYVPNSSMTLQEFTSRWRKRFGNENPELT--EPSI 289

Query: 328 HALRAHDSIKIITEAIGRLNYNISSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRI 387
           +AL A+D++                         S++F+GLSG ++F  G  L +    I
Sbjct: 290 YALYAYDAV-----------------------WASTNFNGLSGPVQFDGGRRLASPAFEI 326

Query: 388 VNVVGKKYKELDFWLPNFGFSK 409
           +N++GK Y+++ FW    G S 
Sbjct: 327 INIIGKGYRKIGFWSSESGLSV 348

Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA). GABA is the major inhibitory neurotransmitter in the mammalian CNS and, like glutamate and other transmitters, acts via both ligand gated ion channels (GABAa receptors) and G-protein coupled receptors (GABAb). GABAa receptors are members of the ionotropic receptor superfamily which includes alpha-adrenergic and glycine receptors. The GABAb receptor is a member of a receptor superfamily which includes the mGlu receptors. The GABAb receptor is coupled to G alpha_i proteins, and activation causes a decrease in calcium, an increase in potassium membrane conductance, and inhibition of cAMP formation. The response is thus inhibitory and leads to hyperpolarization and decreased neurotransmitter release, for example. Length = 350

>gnl\|CDD\|215685 pfam00060, Lig_chan, Ligand-gated ion channel	Back alignment and domain information

>gnl\|CDD\|216296 pfam01094, ANF_receptor, Receptor family ligand binding region	Back alignment and domain information

>gnl\|CDD\|153138 cd06350, PBP1_GPCR_family_C_like, Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs)	Back alignment and domain information

>gnl\|CDD\|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors	Back alignment and domain information

>gnl\|CDD\|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems	Back alignment and domain information

>gnl\|CDD\|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily	Back alignment and domain information

>gnl\|CDD\|222144 pfam13458, Peripla_BP_6, Periplasmic binding protein	Back alignment and domain information

>gnl\|CDD\|223755 COG0683, LivK, ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily	Back alignment and domain information

>gnl\|CDD\|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs)	Back alignment and domain information

>gnl\|CDD\|107328 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids	Back alignment and domain information

>gnl\|CDD\|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins	Back alignment and domain information

>gnl\|CDD\|107340 cd06345, PBP1_ABC_ligand_binding_like_10, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>gnl\|CDD\|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors	Back alignment and domain information

>gnl\|CDD\|107362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors	Back alignment and domain information

>gnl\|CDD\|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3	Back alignment and domain information

>gnl\|CDD\|107358 cd06363, PBP1_Taste_receptor, Ligand-binding domain of the T1R taste receptor	Back alignment and domain information

>gnl\|CDD\|107325 cd06330, PBP1_Arsenic_SBP_like, Periplasmic solute-binding domain of active transport proteins	Back alignment and domain information

>gnl\|CDD\|107335 cd06340, PBP1_ABC_ligand_binding_like_6, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>gnl\|CDD\|107337 cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine)	Back alignment and domain information

>gnl\|CDD\|107341 cd06346, PBP1_ABC_ligand_binding_like_11, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>gnl\|CDD\|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|107342 cd06347, PBP1_ABC_ligand_binding_like_12, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>gnl\|CDD\|107322 cd06327, PBP1_SBP_like_1, Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family	Back alignment and domain information

>gnl\|CDD\|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors	Back alignment and domain information

>gnl\|CDD\|107333 cd06338, PBP1_ABC_ligand_binding_like_5, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>gnl\|CDD\|107343 cd06348, PBP1_ABC_ligand_binding_like_13, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>gnl\|CDD\|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions	Back alignment and domain information

>gnl\|CDD\|107330 cd06335, PBP1_ABC_ligand_binding_like_2, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>gnl\|CDD\|107327 cd06332, PBP1_aromatic_compounds_like, Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes	Back alignment and domain information

>gnl\|CDD\|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3	Back alignment and domain information

>gnl\|CDD\|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins	Back alignment and domain information

>gnl\|CDD\|107369 cd06374, PBP1_mGluR_groupI, Ligand binding domain of the group I metabotropic glutamate receptor	Back alignment and domain information

>gnl\|CDD\|107356 cd06361, PBP1_GPC6A_like, Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor	Back alignment and domain information

>gnl\|CDD\|107321 cd06326, PBP1_STKc_like, Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins	Back alignment and domain information

>gnl\|CDD\|107371 cd06376, PBP1_mGluR_groupIII, Ligand-binding domain of the group III metabotropic glutamate receptor	Back alignment and domain information

>gnl\|CDD\|107334 cd06339, PBP1_YraM_LppC_lipoprotein_like, Periplasmic binding component of lipoprotein LppC, an immunodominant antigen	Back alignment and domain information

>gnl\|CDD\|107332 cd06337, PBP1_ABC_ligand_binding_like_4, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>gnl\|CDD\|236540 PRK09495, glnH, glutamine ABC transporter periplasmic protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|107370 cd06375, PBP1_mGluR_groupII, Ligand binding domain of the group II metabotropic glutamate receptor	Back alignment and domain information

>gnl\|CDD\|107331 cd06336, PBP1_ABC_ligand_binding_like_3, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>gnl\|CDD\|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|107368 cd06373, PBP1_NPR_like, Ligand binding domain of natriuretic peptide receptor (NPR) family	Back alignment and domain information

>gnl\|CDD\|107357 cd06362, PBP1_mGluR, Ligand binding domain of the metabotropic glutamate receptors (mGluR)	Back alignment and domain information

>gnl\|CDD\|107323 cd06328, PBP1_SBP_like_2, Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria	Back alignment and domain information

>gnl\|CDD\|214911 smart00918, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site	Back alignment and domain information

>gnl\|CDD\|107374 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor	Back alignment and domain information

>gnl\|CDD\|107377 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors	Back alignment and domain information

>gnl\|CDD\|233269 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-binding periplasmic protein	Back alignment and domain information

>gnl\|CDD\|107337 cd06342, PBP1_ABC_LIVBP_like, Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		920
KOG1054		897	consensus Glutamate-gated AMPA-type ion channel re	100.0
KOG4440		993	consensus NMDA selective glutamate-gated ion chann	100.0
KOG1053		1258	consensus Glutamate-gated NMDA-type ion channel re	100.0
KOG1052		656	consensus Glutamate-gated kainate-type ion channel	100.0
cd06390		364	PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin	100.0
cd06392		400	PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v	100.0
cd06366		350	PBP1_GABAb_receptor Ligand-binding domain of GABAb	100.0
cd06361		403	PBP1_GPC6A_like Ligand-binding domain of the promi	100.0
cd06387		372	PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin	100.0
cd06393		384	PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol	100.0
cd06362		452	PBP1_mGluR Ligand binding domain of the metabotrop	100.0
cd06386		387	PBP1_NPR_C_like Ligand-binding domain of type C na	100.0
cd06380		382	PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali	100.0
cd06379		377	PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/	100.0
cd06388		371	PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin	100.0
cd06374		472	PBP1_mGluR_groupI Ligand binding domain of the gro	100.0
cd06389		370	PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin	100.0
cd06394		333	PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu	100.0
cd06364		510	PBP1_CaSR Ligand-binding domain of the CaSR calciu	100.0
cd06391		400	PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v	100.0
cd06376		463	PBP1_mGluR_groupIII Ligand-binding domain of the g	100.0
cd06367		362	PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali	100.0
cd06365		469	PBP1_Pheromone_receptor Ligand-binding domain of t	100.0
cd06363		410	PBP1_Taste_receptor Ligand-binding domain of the T	100.0
cd06375		458	PBP1_mGluR_groupII Ligand binding domain of the gr	100.0
cd06370		404	PBP1_Speract_GC_like Ligand-binding domain of memb	100.0
cd06372		391	PBP1_GC_G_like Ligand-binding domain of membrane g	100.0
cd06352		389	PBP1_NPR_GC_like Ligand-binding domain of membrane	100.0
cd06373		396	PBP1_NPR_like Ligand binding domain of natriuretic	100.0
cd06385		405	PBP1_NPR_A Ligand-binding domain of type A natriur	100.0
cd06382		327	PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v	100.0
cd06371		382	PBP1_sensory_GC_DEF_like Ligand-binding domain of	100.0
cd06384		399	PBP1_NPR_B Ligand-binding domain of type B natriur	100.0
PRK15404		369	leucine ABC transporter subunit substrate-binding	100.0
cd06381		363	PBP1_iGluR_delta_like N-terminal leucine/isoleucin	100.0
cd06342		334	PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind	100.0
cd06338		345	PBP1_ABC_ligand_binding_like_5 Type I periplasmic	100.0
cd06345		344	PBP1_ABC_ligand_binding_like_10 Type I periplasmic	100.0
cd06355		348	PBP1_FmdD_like Periplasmic component (FmdD) of an	100.0
cd06368		324	PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu	100.0
cd06346		312	PBP1_ABC_ligand_binding_like_11 Type I periplasmic	100.0
TIGR03669		374	urea_ABC_arch urea ABC transporter, substrate-bind	100.0
COG0683		366	LivK ABC-type branched-chain amino acid transport	100.0
cd06348		344	PBP1_ABC_ligand_binding_like_13 Type I periplasmic	100.0
cd06340		347	PBP1_ABC_ligand_binding_like_6 Type I periplasmic	100.0
cd06343		362	PBP1_ABC_ligand_binding_like_8 Type I periplasmic	100.0
TIGR03407		359	urea_ABC_UrtA urea ABC transporter, urea binding p	100.0
cd06331		333	PBP1_AmiC_like Type I periplasmic components of am	100.0
PF01094		348	ANF_receptor: Receptor family ligand binding regio	100.0
cd06344		332	PBP1_ABC_ligand_binding_like_9 Type I periplasmic	100.0
cd06329		342	PBP1_SBP_like_3 Periplasmic solute-binding domain	100.0
cd06378		362	PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/	100.0
PF13458		343	Peripla_BP_6: Periplasmic binding protein; PDB: 4E	100.0
cd06349		340	PBP1_ABC_ligand_binding_like_14 Type I periplasmic	100.0
cd06327		334	PBP1_SBP_like_1 Periplasmic solute-binding domain	100.0
KOG1056		878	consensus Glutamate-gated metabotropic ion channel	100.0
cd06359		333	PBP1_Nba_like Type I periplasmic binding component	100.0
cd06357		360	PBP1_AmiC Periplasmic binding domain of amidase (A	100.0
cd06347		334	PBP1_ABC_ligand_binding_like_12 Type I periplasmic	100.0
cd06350		348	PBP1_GPCR_family_C_like Ligand-binding domain of m	100.0
cd06330		346	PBP1_Arsenic_SBP_like Periplasmic solute-binding d	100.0
cd06328		333	PBP1_SBP_like_2 Periplasmic solute-binding domain	100.0
cd06356		334	PBP1_Amide_Urea_BP_like Periplasmic component (Fmd	100.0
cd06360		336	PBP1_alkylbenzenes_like Type I periplasmic binding	100.0
cd06358		333	PBP1_NHase Type I periplasmic-binding protein of t	100.0
cd06336		347	PBP1_ABC_ligand_binding_like_3 Type I periplasmic	100.0
cd06335		347	PBP1_ABC_ligand_binding_like_2 Type I periplasmic	100.0
cd06334		351	PBP1_ABC_ligand_binding_like_1 Type I periplasmic	99.98
cd06377		382	PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/	99.97
cd06332		333	PBP1_aromatic_compounds_like Type I periplasmic bi	99.97
cd06383		368	PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine	99.97
PF13433		363	Peripla_BP_5: Periplasmic binding protein domain;	99.97
cd06351		328	PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc	99.97
cd06337		357	PBP1_ABC_ligand_binding_like_4 Type I periplasmic	99.97
cd06326		336	PBP1_STKc_like Type I periplasmic binding domain o	99.97
cd06339		336	PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin	99.96
cd06341		341	PBP1_ABC_ligand_binding_like_7 Type I periplasmic	99.95
TIGR03863		347	PQQ_ABC_bind ABC transporter, substrate binding pr	99.95
cd06269		298	PBP1_glutamate_receptors_like Family C G-protein c	99.95
KOG1055		865	consensus GABA-B ion channel receptor subunit GABA	99.94
cd04509		299	PBP1_ABC_transporter_GCPR_C_like Family C of G-pro	99.94
cd06333		312	PBP1_ABC-type_HAAT_like Type I periplasmic binding	99.93
cd06268		298	PBP1_ABC_transporter_LIVBP_like Periplasmic bindin	99.91
cd06369		380	PBP1_GC_C_enterotoxin_receptor Ligand-binding doma	99.89
PRK09495		247	glnH glutamine ABC transporter periplasmic protein	99.87
PRK10797		302	glutamate and aspartate transporter subunit; Provi	99.86
PRK11260		266	cystine transporter subunit; Provisional	99.86
PF00497		225	SBP_bac_3: Bacterial extracellular solute-binding	99.85
PRK15010		260	ABC transporter lysine/arginine/ornithine binding	99.84
PRK15007		243	putative ABC transporter arginine-biding protein;	99.83
PRK11917		259	bifunctional adhesin/ABC transporter aspartate/glu	99.83
TIGR01096		250	3A0103s03R lysine-arginine-ornithine-binding perip	99.82
PRK15437		259	histidine ABC transporter substrate-binding protei	99.82
TIGR02995		275	ectoine_ehuB ectoine/hydroxyectoine ABC transporte	99.82
PRK09959		1197	hybrid sensory histidine kinase in two-component r	99.77
PRK10859		482	membrane-bound lytic transglycosylase F; Provision	99.77
PF00060		148	Lig_chan: Ligand-gated ion channel; InterPro: IPR0	99.73
TIGR03870		246	ABC_MoxJ methanol oxidation system protein MoxJ. T	99.73
TIGR02285		268	conserved hypothetical protein. Members of this fa	99.69
COG0834		275	HisJ ABC-type amino acid transport/signal transduc	99.67
PRK09959		1197	hybrid sensory histidine kinase in two-component r	99.65
cd00134		218	PBPb Bacterial periplasmic transport systems use m	99.65
smart00062		219	PBPb Bacterial periplasmic substrate-binding prote	99.64
TIGR03871		232	ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa	99.63
cd01391		269	Periplasmic_Binding_Protein_Type_1 Type 1 periplas	99.58
COG4623		473	Predicted soluble lytic transglycosylase fused to	99.48
PF04348		536	LppC: LppC putative lipoprotein; InterPro: IPR0074	99.34
smart00079		134	PBPe Eukaryotic homologues of bacterial periplasmi	99.31
TIGR01098		254	3A0109s03R phosphate/phosphite/phosphonate ABC tra	98.81
cd01537		264	PBP1_Repressors_Sugar_Binding_like Ligand-binding	98.75
PF10613		65	Lig_chan-Glu_bd: Ligated ion channel L-glutamate-	98.74
PRK00489		287	hisG ATP phosphoribosyltransferase; Reviewed	98.73
cd01536		267	PBP1_ABC_sugar_binding_like Periplasmic sugar-bind	98.7
cd06267		264	PBP1_LacI_sugar_binding_like Ligand binding domain	98.67
cd06300		272	PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi	98.56
cd06325		281	PBP1_ABC_uncharacterized_transporter Type I peripl	98.55
cd06320		275	PBP1_allose_binding Periplasmic allose-binding dom	98.51
COG3107		604	LppC Putative lipoprotein [General function predic	98.45
COG2984		322	ABC-type uncharacterized transport system, peripla	98.44
cd06282		266	PBP1_GntR_like_2 Ligand-binding domain of putative	98.41
PRK10653		295	D-ribose transporter subunit RbsB; Provisional	98.4
PF13407		257	Peripla_BP_4: Periplasmic binding protein domain;	98.26
cd06323		268	PBP1_ribose_binding Periplasmic sugar-binding doma	98.26
cd06319		277	PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b	98.22
cd06310		273	PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi	98.13
cd01545		270	PBP1_SalR Ligand-binding domain of DNA transcripti	98.13
cd06309		273	PBP1_YtfQ_like Periplasmic binding domain of ABC-t	98.12
PRK10936		343	TMAO reductase system periplasmic protein TorT; Pr	98.11
cd06273		268	PBP1_GntR_like_1 This group includes the ligand-bi	98.1
cd06317		275	PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi	98.1
COG1879		322	RbsB ABC-type sugar transport system, periplasmic	98.08
cd06312		271	PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi	98.08
cd06289		268	PBP1_MalI_like Ligand-binding domain of MalI, a tr	98.05
cd06301		272	PBP1_rhizopine_binding_like Periplasmic binding pr	98.03
cd06305		273	PBP1_methylthioribose_binding_like Methylthioribos	98.02
TIGR03431		288	PhnD phosphonate ABC transporter, periplasmic phos	97.98
cd06311		274	PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi	97.96
PRK09701		311	D-allose transporter subunit; Provisional	97.95
PF00532		279	Peripla_BP_1: Periplasmic binding proteins and sug	97.93
cd06298		268	PBP1_CcpA_like Ligand-binding domain of the catabo	97.93
cd06284		267	PBP1_LacI_like_6 Ligand-binding domain of an uncha	97.9
PRK15395		330	methyl-galactoside ABC transporter galactose-bindi	97.84
cd06271		268	PBP1_AglR_RafR_like Ligand-binding domain of DNA t	97.83
cd01539		303	PBP1_GGBP Periplasmic glucose/galactose-binding pr	97.83
cd06275		269	PBP1_PurR Ligand-binding domain of purine represso	97.82
cd06308		270	PBP1_sensor_kinase_like Periplasmic binding domain	97.82
cd06283		267	PBP1_RegR_EndR_KdgR_like Ligand-binding domain of	97.79
cd06270		268	PBP1_GalS_like Ligand binding domain of DNA transc	97.79
cd06321		271	PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b	97.76
cd06288		269	PBP1_sucrose_transcription_regulator Ligand-bindin	97.74
PRK10355		330	xylF D-xylose transporter subunit XylF; Provisiona	97.74
cd01542		259	PBP1_TreR_like Ligand-binding domain of DNA transc	97.73
cd06303		280	PBP1_LuxPQ_Quorum_Sensing Periplasmic binding prot	97.73
cd01575		268	PBP1_GntR Ligand-binding domain of DNA transcripti	97.72
cd06295		275	PBP1_CelR Ligand binding domain of a transcription	97.72
cd06322		267	PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b	97.71
cd01574		264	PBP1_LacI Ligand-binding domain of DNA transcripti	97.71
TIGR01481		329	ccpA catabolite control protein A. Catabolite cont	97.71
cd06296		270	PBP1_CatR_like Ligand-binding domain of a LacI-lik	97.7
cd06274		264	PBP1_FruR Ligand binding domain of DNA transcripti	97.69
cd06294		270	PBP1_ycjW_transcription_regulator_like Ligand-bind	97.69
cd06299		265	PBP1_LacI_like_13 Ligand-binding domain of DNA-bin	97.68
cd06306		268	PBP1_TorT-like TorT-like proteins, a periplasmic b	97.63
cd06278		266	PBP1_LacI_like_2 Ligand-binding domain of uncharac	97.62
cd01538		288	PBP1_ABC_xylose_binding Periplasmic xylose-binding	97.62
cd01540		289	PBP1_arabinose_binding Periplasmic L-arabinose-bin	97.61
cd06281		269	PBP1_LacI_like_5 Ligand-binding domain of uncharac	97.6
PRK15408		336	autoinducer 2-binding protein lsrB; Provisional	97.59
cd06293		269	PBP1_LacI_like_11 Ligand-binding domain of unchara	97.59
PRK10014		342	DNA-binding transcriptional repressor MalI; Provis	97.58
PRK11303		328	DNA-binding transcriptional regulator FruR; Provis	97.57
cd06316		294	PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-bi	97.57
cd06324		305	PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b	97.55
PRK10703		341	DNA-binding transcriptional repressor PurR; Provis	97.55
cd06285		265	PBP1_LacI_like_7 Ligand-binding domain of uncharac	97.54
cd06292		273	PBP1_LacI_like_10 Ligand-binding domain of unchara	97.54
cd06277		268	PBP1_LacI_like_1 Ligand-binding domain of uncharac	97.5
COG1609		333	PurR Transcriptional regulators [Transcription]	97.48
cd06313		272	PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi	97.48
TIGR02417		327	fruct_sucro_rep D-fructose-responsive transcriptio	97.46
cd06291		265	PBP1_Qymf_like Ligand binding domain of the lacI-l	97.44
cd06314		271	PBP1_tmGBP Periplasmic sugar-binding domain of The	97.39
cd06318		282	PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi	97.36
cd06290		265	PBP1_LacI_like_9 Ligand-binding domain of uncharac	97.35
cd06286		260	PBP1_CcpB_like Ligand-binding domain of a novel tr	97.35
PRK10423		327	transcriptional repressor RbsR; Provisional	97.3
cd06302		298	PBP1_LsrB_Quorum_Sensing Periplasmic binding domai	97.28
TIGR02955		295	TMAO_TorT TMAO reductase system periplasmic protei	97.28
cd06272		261	PBP1_hexuronate_repressor_like Ligand-binding doma	97.25
cd06279		283	PBP1_LacI_like_3 Ligand-binding domain of uncharac	97.2
PRK11553		314	alkanesulfonate transporter substrate-binding subu	97.19
cd01541		273	PBP1_AraR Ligand-binding domain of DNA transcripti	97.17
PRK10727		343	DNA-binding transcriptional regulator GalR; Provis	97.17
cd06307		275	PBP1_uncharacterized_sugar_binding Periplasmic sug	97.16
PF12974		243	Phosphonate-bd: ABC transporter, phosphonate, peri	97.12
TIGR01729		300	taurine_ABC_bnd taurine ABC transporter, periplasm	97.04
PRK10401		346	DNA-binding transcriptional regulator GalS; Provis	97.03
PRK09526		342	lacI lac repressor; Reviewed	97.02
cd01543		265	PBP1_XylR Ligand-binding domain of DNA transcripti	97.02
cd06304		260	PBP1_BmpA_like Periplasmic binding component of a	97.01
cd06280		263	PBP1_LacI_like_4 Ligand-binding domain of uncharac	96.99
TIGR02634		302	xylF D-xylose ABC transporter, substrate-binding p	96.98
PRK09492		315	treR trehalose repressor; Provisional	96.96
PF04392		294	ABC_sub_bind: ABC transporter substrate binding pr	96.95
cd06297		269	PBP1_LacI_like_12 Ligand-binding domain of unchara	96.91
PRK11041		309	DNA-binding transcriptional regulator CytR; Provis	96.9
PRK14987		331	gluconate operon transcriptional regulator; Provis	96.83
TIGR02637		302	RhaS rhamnose ABC transporter, rhamnose-binding pr	96.62
cd06354		265	PBP1_BmpA_PnrA_like Periplasmic binding domain of	96.62
cd06315		280	PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-bi	96.44
TIGR03427		328	ABC_peri_uca ABC transporter periplasmic binding p	96.38
cd01544		270	PBP1_GalR Ligand-binding domain of DNA transcripti	96.36
TIGR02405		311	trehalos_R_Ecol trehalose operon repressor, proteo	96.31
PF13379		252	NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_	96.22
COG4213		341	XylF ABC-type xylose transport system, periplasmic	95.81
COG1744		345	Med Uncharacterized ABC-type transport system, per	95.41
cd06287		269	PBP1_LacI_like_8 Ligand-binding domain of uncharac	95.31
PF14503		232	YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B.	95.28
PF09084		216	NMT1: NMT1/THI5 like; InterPro: IPR015168 This ent	95.1
cd06353		258	PBP1_BmpA_Med_like Periplasmic binding domain of t	95.0
COG3221		299	PhnD ABC-type phosphate/phosphonate transport syst	94.62
TIGR01728		288	SsuA_fam ABC transporter, substrate-binding protei	94.17
TIGR02122		320	TRAP_TAXI TRAP transporter solute receptor, TAXI f	93.79
PRK11480		320	tauA taurine transporter substrate binding subunit	93.78
PF03466		209	LysR_substrate: LysR substrate binding domain; Int	93.52
PRK10339		327	DNA-binding transcriptional repressor EbgR; Provis	92.6
PF07885		79	Ion_trans_2: Ion channel; InterPro: IPR013099 This	92.46
PF12727		193	PBP_like: PBP superfamily domain; InterPro: IPR024	92.27
TIGR00363		258	lipoprotein, YaeC family. This family of putative	91.86
cd05466		197	PBP2_LTTR_substrate The substrate binding domain o	91.69
PRK11151		305	DNA-binding transcriptional regulator OxyR; Provis	91.46
cd08440		197	PBP2_LTTR_like_4 TThe C-terminal substrate binding	90.81
PF12683		275	DUF3798: Protein of unknown function (DUF3798); In	90.76
cd06276		247	PBP1_FucR_like Ligand-binding domain of a transcri	90.75
TIGR02990		239	ectoine_eutA ectoine utilization protein EutA. Mem	90.51
PRK12684		313	transcriptional regulator CysB-like protein; Revie	90.45
PRK11063		271	metQ DL-methionine transporter substrate-binding s	90.41
CHL00180		305	rbcR LysR transcriptional regulator; Provisional	90.06
COG1910		223	Periplasmic molybdate-binding protein/domain [Inor	90.0
cd08459		201	PBP2_DntR_NahR_LinR_like The C-terminal substrate	89.37
PRK09791		302	putative DNA-binding transcriptional regulator; Pr	89.27
cd08418		201	PBP2_TdcA The C-terminal substrate binding domain	89.13
PRK10837		290	putative DNA-binding transcriptional regulator; Pr	89.11
cd08466		200	PBP2_LeuO The C-terminal substrate binding domain	89.06
PRK12679		316	cbl transcriptional regulator Cbl; Reviewed	88.89
cd08421		198	PBP2_LTTR_like_1 The C-terminal substrate binding	88.84
cd08468		202	PBP2_Pa0477 The C-terminal substrate biniding doma	88.81
cd06353		258	PBP1_BmpA_Med_like Periplasmic binding domain of t	88.53
cd08412		198	PBP2_PAO1_like The C-terminal substrate-binding do	88.45
PF13377		160	Peripla_BP_3: Periplasmic binding protein-like dom	88.37
PF02608		306	Bmp: Basic membrane protein; InterPro: IPR003760 T	88.25
TIGR00035		229	asp_race aspartate racemase.	88.23
cd08462		200	PBP2_NodD The C-terminal substsrate binding domain	88.23
cd08426		199	PBP2_LTTR_like_5 The C-terminal substrate binding	87.83
TIGR00787		257	dctP tripartite ATP-independent periplasmic transp	87.62
PRK12681		324	cysB transcriptional regulator CysB; Reviewed	87.52
PF13531		230	SBP_bac_11: Bacterial extracellular solute-binding	87.43
cd08442		193	PBP2_YofA_SoxR_like The C-terminal substrate bindi	87.33
cd08463		203	PBP2_DntR_like_4 The C-terminal substrate binding	87.3
cd08433		198	PBP2_Nac The C-teminal substrate binding domain of	86.63
PRK11233		305	nitrogen assimilation transcriptional regulator; P	86.61
cd08419		197	PBP2_CbbR_RubisCO_like The C-terminal substrate bi	86.41
PRK10200		230	putative racemase; Provisional	86.2
cd08420		201	PBP2_CysL_like C-terminal substrate binding domain	86.09
PF03480		286	SBP_bac_7: Bacterial extracellular solute-binding	86.02
cd08415		196	PBP2_LysR_opines_like The C-terminal substrate-dom	85.6
cd08438		197	PBP2_CidR The C-terminal substrate binding domain	85.58
PRK10341		312	DNA-binding transcriptional activator TdcA; Provis	85.38
cd08417		200	PBP2_Nitroaromatics_like The C-terminal substrate	85.22
PRK11242		296	DNA-binding transcriptional regulator CynR; Provis	85.2
PF03401		274	TctC: Tripartite tricarboxylate transporter family	84.66
cd08461		198	PBP2_DntR_like_3 The C-terminal substrate binding	84.61
COG2358		321	Imp TRAP-type uncharacterized transport system, pe	84.4
COG0725		258	ModA ABC-type molybdate transport system, periplas	84.36
TIGR01256		216	modA molybdenum ABC transporter, periplasmic molyb	84.2
TIGR02424		300	TF_pcaQ pca operon transcription factor PcaQ. Memb	83.98
cd08425		197	PBP2_CynR The C-terminal substrate-binding domain	83.43
cd08435		201	PBP2_GbpR The C-terminal substrate binding domain	82.99
COG0715		335	TauA ABC-type nitrate/sulfonate/bicarbonate transp	82.7
cd08444		198	PBP2_Cbl The C-terminal substrate binding domain o	82.11
cd08411		200	PBP2_OxyR The C-terminal substrate-binding domain	82.07
cd08413		198	PBP2_CysB_like The C-terminal substrate domain of	82.05
cd08434		195	PBP2_GltC_like The substrate binding domain of Lys	81.72
PRK12680		327	transcriptional regulator CysB-like protein; Revie	81.31
cd08467		200	PBP2_SyrM The C-terminal substrate binding of LysR	81.07
PRK12682		309	transcriptional regulator CysB-like protein; Revie	80.81
cd08460		200	PBP2_DntR_like_1 The C-terminal substrate binding	80.6

>KOG1054 consensus Glutamate-gated AMPA-type ion channel receptor subunit GluR2 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=7.8e-91  Score=714.30  Aligned_cols=756  Identities=19%  Similarity=0.329  Sum_probs=612.5

Q ss_pred             CCccEEEEEEEeCCCcccHHHHHHHHHHHHHHhcCCC--C--ceEEEEEec-CCCCHHHHHHHHHHHhhcCCeEEEEcCC
Q 002454           31 IEEVTKIGAIVDANSQMGKQAITAMKIAVQNFNSDSR--N--HKLSLQIRD-HNRDPFQAATAAQELINKEKVKVIAGME  105 (920)
Q Consensus        31 ~~~~i~IG~i~p~s~~~g~~~~~a~~~Av~~iN~~~~--g--~~l~~~~~D-~~~d~~~a~~~a~~li~~~~v~aiiGp~  105 (920)
                      .+.+|.||.++|.+.   .+...|++.|+...|....  .  .+|.+++.. ...+++....+.|+..+ +||.||+|-+
T Consensus        23 f~~tiqigglF~~n~---~qe~~Afr~~~~~~~~~~~~~~~pf~L~~~~d~~e~a~Sf~~tnafCsq~s-~Gv~Aifg~y   98 (897)
T KOG1054|consen   23 FPNTIQIGGLFPRNT---DQEHSAFRFAVQLYNTNQNTTEKPFKLNPHVDNLESANSFAVTNAFCSQFS-RGVYAIFGFY   98 (897)
T ss_pred             CCCceeeccccCCcc---hHHHHHHHHHHHHhhcCCCCCCCCcccccccchhhhhhhHHHHHHHHHHHh-hhHhhheecc
Confidence            346799999999883   5677899999999988652  2  344444432 23688888999999987 5999999999


Q ss_pred             chHHHHHHHHhhccCCccEEeecCCCCCCCccCCCCceeEEeccCchHHHHHHHHHHHHcCCeEEEEEEEeCCCCCCcch
Q 002454          106 TWEETAVVAEIASRVQVPILSFAAPAVTPLSMSRRWPYLIRMASNDSEQMKCIADLARKYNWRRVAAIYEDNVYGGDSGK  185 (920)
Q Consensus       106 ~s~~~~~va~~~~~~~iP~is~~~~~~~~~~~~~~~~~~~r~~p~~~~~~~aia~~l~~~~w~~v~ii~~~~~~g~~~~~  185 (920)
                      .......+..+|...++|+|+++.+      .....+|.+++.|+-   ..++++++.|++|.+++++|+.+. |  ...
T Consensus        99 d~ks~~~ltsfc~aLh~~~vtpsfp------~~~~~~Fviq~RP~l---~~al~s~i~hy~W~~fv~lyD~~r-g--~s~  166 (897)
T KOG1054|consen   99 DKKSVNTLTSFCGALHVSFVTPSFP------TDGDNQFVIQMRPAL---KGALLSLIDHYKWEKFVYLYDTDR-G--LSI  166 (897)
T ss_pred             cccchhhhhhhccceeeeeecccCC------cCCCceEEEEeCchH---HHHHHHHHHhcccceEEEEEcccc-h--HHH
Confidence            9999999999999999999988765      245568999999985   589999999999999999999886 6  677


Q ss_pred             HHHHHHHHhccCCceEeEEeecCCCCCCCCChHHHHHHHHhhccCCceEEEEEecCHhHHHHHHHHHHHcCCCCCCeEEE
Q 002454          186 LALLAEALQNVSSSEIQSRLVLPPISSISDPKEAVRGELKKVQDKQSRVFIVLQASLDMTIHLFTEANRMGLVGKDSVWI  265 (920)
Q Consensus       186 ~~~l~~~l~~~g~~~i~~~~~~~~~~~~~~~~~d~~~~l~~l~~~~~~vii~~~~~~~~~~~~l~~a~~~g~~~~~~~~i  265 (920)
                      ++++-+.+.+++ ++|.+...-...     +...++.+++.|...+.+-|++ +|..+....++.++-+.+-..++|+|+
T Consensus       167 Lqai~~~a~~~n-w~VtA~~v~~~~-----d~~~yr~~f~~l~~r~e~rv~i-Dce~~~~~~il~q~i~~~k~~~~YHYv  239 (897)
T KOG1054|consen  167 LQAIMEAAAQNN-WQVTAINVGNIN-----DVKEYRMLFEMLDRRQENRVLI-DCESERRNRILLQVIELGKHVKGYHYV  239 (897)
T ss_pred             HHHHHHHHHhcC-ceEEEEEcCCcc-----cHHHHHHHHHHHhccccceEEE-EcccHHHHHHHHHHHHHhhhccceEEE
Confidence            888888888888 998776543332     3355888999998888888888 999999999999999999888999999


Q ss_pred             EecccccccccCChhhhccc---ceEEEEEeeccCCCchhHHHHHHHHHhccccCCCCCCCCCcchhhhHhhHHHHHHHH
Q 002454          266 VTNTVANALDSLNTTVISSM---EGTLGIKSYYSDDSSPYKEFSALFRRNFTSEYPEEDHFHPSIHALRAHDSIKIITEA  342 (920)
Q Consensus       266 ~t~~~~~~~~~~~~~~~~~~---~g~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~a~~~YDav~~~a~A  342 (920)
                      +.+......     +.....   .++.++... +.++|..++|.++|++.-..+++...+..+.+.++++|||+.++++|
T Consensus       240 laNl~f~d~-----dl~~f~~g~aNitgFqiv-n~~~~~~~k~~~~~~~l~~~~~~g~~~~~~k~tsAlthDailV~~ea  313 (897)
T KOG1054|consen  240 LANLGFTDI-----DLERFQHGGANITGFQIV-NKNNPMVKKFIQRWKELDEREYPGASNDPIKYTSALTHDAILVMAEA  313 (897)
T ss_pred             EeeCCCchh-----hHHHHhcCCcceeEEEEe-cCCChHHHHHHHHHhhhcccccCCCCCCCcchhhhhhhhHHHHHHHH
Confidence            998743322     222222   234454432 44568899999999887766776665667788899999999999999


Q ss_pred             HHhhccCC--------------------CChHHHHHHHHhCccccccccEEEeCCCccCCCcEEEEeccCCeeEEEEEec
Q 002454          343 IGRLNYNI--------------------SSPEMLLRQMLSSDFSGLSGKIRFKDGELLNADTLRIVNVVGKKYKELDFWL  402 (920)
Q Consensus       343 l~~~~~~~--------------------~~~~~l~~~l~~~~f~g~sG~i~F~~~g~~~~~~~~i~~~~~~~~~~vg~w~  402 (920)
                      ++.+....                    ..|..+.++|+++.++|+||+|+||..|.|.+.+.+|++++.++.+++|+|+
T Consensus       314 f~~~~~q~~~~~rRG~~GD~~an~~~p~~qG~~I~ralk~v~~eGLTGniqFd~~G~R~Nyt~~i~elk~~~~rk~~~W~  393 (897)
T KOG1054|consen  314 FRSLRRQRIDISRRGNAGDCLANPAVPWEQGIDIERALKQVQVEGLTGNIQFDKYGRRTNYTIDIVELKSNGSRKVGYWN  393 (897)
T ss_pred             HHHHHHhhhchhccCCCccccCCCCCchhcchhHHHHHHheeecccccceeecccCccccceEEEEEeccCCcceeeeec
Confidence            99886421                    3577899999999999999999999999999999999999999999999999


Q ss_pred             CCCCCccccCCCccccccccccccCCCCceecCCCCCCCCCCccccCCCCCCeEEEeecCCcccceEEeecCCCCCCCCC
Q 002454          403 PNFGFSKTSSKHNVGDISSNIAAEGFTGPVIWPGNLINRNPKGWAMPSNQEPMRIGVPTRTFFEKFVVIKDDPLNGNSND  482 (920)
Q Consensus       403 ~~~g~~~~~~~~~~~~~~~~~~~~~~~~~i~Wpg~~~~~~p~~~~~~~~~~~l~v~~~~~~~~~p~~~~~~~~~~~~~g~  482 (920)
                      ...||-...+....                   ++.+ .      -..++..++.++.+    .||++.+.+.+ ...| 
T Consensus       394 e~~~fv~~~t~a~~-------------------~~d~-~------~~~n~tvvvttiL~----spyvm~kkn~~-~~eg-  441 (897)
T KOG1054|consen  394 EGEGFVPGSTVAQS-------------------RNDQ-A------SKENRTVVVTTILE----SPYVMLKKNHE-QLEG-  441 (897)
T ss_pred             ccCceeeccccccc-------------------cccc-c------ccccceEEEEEecC----CchhHHHhhHH-HhcC-
Confidence            99887654432110                   0000 0      01122223333332    36777766531 1233 


Q ss_pred             CCcceeeeeHHHHHHHHHHCCCccceEEEe--------cCCC-hhHHHHHHHcCcccEEEeceeeecCceeeeeeccccc
Q 002454          483 KNLRYDGFSIELFRLVVDHLNYDLPYEFVP--------HDGV-YDDLINGVYDKTYDAAVGDLTILGNRTEYVEFTQPYA  553 (920)
Q Consensus       483 ~~~~~~G~~~dl~~~la~~ln~~~~~~~~~--------~~gs-~~~~~~~l~~~~~D~~~~~~~~t~~r~~~~~fs~p~~  553 (920)
                       |++|+|||+||+.++|++.+++++..++.        .+++ |+||++.|..|++|+++++++||.+|++.+|||.|++
T Consensus       442 -n~ryEGyCvdLa~~iAkhi~~~Y~l~iv~dgkyGardaD~k~WnGMvGeLv~grAdiavApLTIt~~REeviDFSKPfM  520 (897)
T KOG1054|consen  442 -NERYEGYCVDLAAEIAKHIGIKYKLFIVGDGKYGARDADTKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFM  520 (897)
T ss_pred             -CcccceeHHHHHHHHHHhcCceEEEEEecCCcccccCCCcccccchhHHHhcCccceEEeeeeeehhhhhhhccccchh
Confidence             66999999999999999999984333332        2456 9999999999999999999999999999999999999


Q ss_pred             cccEEEEEecCCCC--CceeeeccCcHhHHHHHHHHHHHHHHHHhhhhcccCccCc------Ccc-------chhhhhHH
Q 002454          554 ESGFSMIVPAKQEE--STWMFTKPFTWEMWMVTAASFIYTMFIVWLLEHQSNPEFR------GTL-------KDQISNIL  618 (920)
Q Consensus       554 ~~~~~~iv~~~~~~--~~~~~l~pF~~~vW~~i~~~~~~~~~~~~~~~~~~~~~~~------~~~-------~~~~~~~~  618 (920)
                      ..|+.+|.++++..  ..++|+.|+..++|+|+++.++.+++++++..|+++.+++      ++.       ..++.|++
T Consensus       521 slGISIMIKKPqKsk~gVFSFldPLa~eIWm~ivfaYiGVSvvlFLVSrFSPYEwh~Ee~~rg~~t~~~~~NeFgifNsL  600 (897)
T KOG1054|consen  521 SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFERGRFTPSDPPNEFGIFNSL  600 (897)
T ss_pred             hcCeEEEEeCcccCCCCeeeecchhHHHHHHHHHHHHhcceEEEEEEeccCchheeccccccCCCCCCCCCccchhhHHH
Confidence            99999999887543  3999999999999999999999999999999999876543      222       23488999


Q ss_pred             HHHHHHHhccCcc-cccccchhhHHHHHHHHHHHHHHHhhccccceeeeeccCCCCCChHHh-hhCCcccccccchHHHH
Q 002454          619 WFAFSTIFFSHRA-NIQSNLTRVVVVLWLFVVFILTSSYTASLSSLLTVRRLEPNVTDIQSL-KSGNLKVGCVDDSFVKK  696 (920)
Q Consensus       619 ~~~~~~l~~~~~~-~~~s~s~Ri~~~~w~~~~lil~~~Yta~L~s~Lt~~~~~~~i~s~~dL-~~s~~~vg~~~~~~~~~  696 (920)
                      ||+++++|+||++ .|||.|+||+-.+||||+||++++|||||+||||+.++.+||.|.||| +|+++.+|+..+....+
T Consensus       601 WFsLgAFMQQG~DI~PRslSGRIvggvWWFFTlIIiSSYTANLAAFLTvErMvsPIESaEDLAkQteIaYGt~~~GSTke  680 (897)
T KOG1054|consen  601 WFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKE  680 (897)
T ss_pred             HHHHHHHHhcCCCCCccccccceeccchhhhhhhhhhhhhhHHHHHHhHHhhcCcchhHHHHhhcceeeeeecCCCchHH
Confidence            9999999999976 579999999999999999999999999999999999999999999999 57889999977766666


Q ss_pred             HHHHh--------cCCCCC-c-eeecCCCHHHHHHHHhc-CCeeEEEeechhHHHHHh-hcCCceEEeeeeeecceeeEe
Q 002454          697 YLEEV--------LGFRSG-N-IVPFGNTEANYIQKFEN-NTIDSLFLERPYEKVFLD-KYCKKYTAINTYRFGGLGFAF  764 (920)
Q Consensus       697 ~l~~~--------~~~~~~-~-~~~~~~~~~~~~~~l~~-~~~~a~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~  764 (920)
                      ++++.        +.+..+ . -+.+.+ ..++++++++ +..+|++.|....+|..+ +.|+-+++++.+.+.+||++.
T Consensus       681 FFr~Skiavy~kMW~yM~SaepsVFv~t-~aeGv~rVRksKGkyAfLLEsTmNey~eqRkPCDTMKVGgNLds~GYGiAT  759 (897)
T KOG1054|consen  681 FFRRSKIAVYEKMWTYMKSAEPSVFVRT-TAEGVARVRKSKGKYAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT  759 (897)
T ss_pred             HHhhhhHHHHHHHHHHHhcCCcceeeeh-hhhHHHHHHhcCCceEeehHhhhhhhhhccCCccceecccccCCcceeecC
Confidence            65532        222211 1 134555 8889999875 345899999888888654 569999999999999999999


Q ss_pred             cCCCcchHHHHHHHHhhhccchHHHHHHHHcCCCCCCCCcccC-CCCCccccccchhHHHHHHHHHHHHHHHHHHHHHHH
Q 002454          765 QRGSPIALDISRAILDLSEDGRLKTLEEEWFKPSSECSADERY-STRPENLTLHSFWGLYIVYGATSIFCFLLFVIRLLN  843 (920)
Q Consensus       765 ~k~sp~~~~~n~~i~~l~e~G~~~~~~~~~~~~~~~c~~~~~~-~~~~~~L~l~~~~g~f~il~~g~~ls~~vf~~E~~~  843 (920)
                      ||||.++..+|.++++|.|.|+++++++|||.++++|.....+ .+++.+|+|.+++|+|||+..|+++|+++.++|+|+
T Consensus       760 p~Gsslr~~vNLAvLkL~E~G~LdKLkNKWWYDkGeC~sg~~ds~~ktsaLsLSnVAGvFYIL~gGl~laMlvALiEF~y  839 (897)
T KOG1054|consen  760 PKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCY  839 (897)
T ss_pred             CCCcccccchhhhhhhhcccchHHHhhhhhcccccccCCCCCCCCcchhhcchhhccceeeeehhhHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999987542 455589999999999999999999999999999999


Q ss_pred             hhcccc
Q 002454          844 NSWSHQ  849 (920)
Q Consensus       844 ~~~~~~  849 (920)
                      +.|...
T Consensus       840 ksr~Ea  845 (897)
T KOG1054|consen  840 KSRAEA  845 (897)
T ss_pred             HhhHHH
Confidence            887543

>KOG4440 consensus NMDA selective glutamate-gated ion channel receptor subunit GRIN1 [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG1053 consensus Glutamate-gated NMDA-type ion channel receptor subunit GRIN2A and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG1052 consensus Glutamate-gated kainate-type ion channel receptor subunit GluR5 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor	Back alignment and domain information

>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family	Back alignment and domain information

>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA)	Back alignment and domain information

>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor	Back alignment and domain information

>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor	Back alignment and domain information

>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor	Back alignment and domain information

>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR)	Back alignment and domain information

>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor	Back alignment and domain information

>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor	Back alignment and domain information

>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor	Back alignment and domain information

>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor	Back alignment and domain information

>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor	Back alignment and domain information

>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor	Back alignment and domain information

>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor	Back alignment and domain information

>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily	Back alignment and domain information

>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family	Back alignment and domain information

>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor	Back alignment and domain information

>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors	Back alignment and domain information

>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily	Back alignment and domain information

>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor	Back alignment and domain information

>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor	Back alignment and domain information

>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases	Back alignment and domain information

>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G	Back alignment and domain information

>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors	Back alignment and domain information

>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family	Back alignment and domain information

>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor	Back alignment and domain information

>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors	Back alignment and domain information

>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues	Back alignment and domain information

>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor	Back alignment and domain information

>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional	Back alignment and domain information

>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2	Back alignment and domain information

>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine)	Back alignment and domain information

>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF)	Back alignment and domain information

>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors	Back alignment and domain information

>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type	Back alignment and domain information

>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism]	Back alignment and domain information

>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein	Back alignment and domain information

>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF)	Back alignment and domain information

>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure []	Back alignment and domain information

>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins	Back alignment and domain information

>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family	Back alignment and domain information

>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A	Back alignment and domain information

>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems	Back alignment and domain information

>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family	Back alignment and domain information

>KOG1056 consensus Glutamate-gated metabotropic ion channel receptor subunit GRM2 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway	Back alignment and domain information

>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family	Back alignment and domain information

>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs)	Back alignment and domain information

>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins	Back alignment and domain information

>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria	Back alignment and domain information

>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF)	Back alignment and domain information

>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene	Back alignment and domain information

>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides	Back alignment and domain information

>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family	Back alignment and domain information

>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes	Back alignment and domain information

>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors	Back alignment and domain information

>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A	Back alignment and domain information

>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs)	Back alignment and domain information

>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins	Back alignment and domain information

>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen	Back alignment and domain information

>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors	Back alignment and domain information

>KOG1055 consensus GABA-B ion channel receptor subunit GABABR1 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems	Back alignment and domain information

>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids	Back alignment and domain information

>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily	Back alignment and domain information

>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C	Back alignment and domain information

>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed	Back alignment and domain information

>PRK10797 glutamate and aspartate transporter subunit; Provisional	Back alignment and domain information

>PRK11260 cystine transporter subunit; Provisional	Back alignment and domain information

>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane	Back alignment and domain information

>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional	Back alignment and domain information

>PRK15007 putative ABC transporter arginine-biding protein; Provisional	Back alignment and domain information

>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed	Back alignment and domain information

>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein	Back alignment and domain information

>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional	Back alignment and domain information

>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein	Back alignment and domain information

>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional	Back alignment and domain information

>PRK10859 membrane-bound lytic transglycosylase F; Provisional	Back alignment and domain information

>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory	Back alignment and domain information

>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ	Back alignment and domain information

>TIGR02285 conserved hypothetical protein	Back alignment and domain information

>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms]	Back alignment and domain information

>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional	Back alignment and domain information

>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions	Back alignment and domain information

>smart00062 PBPb Bacterial periplasmic substrate-binding proteins	Back alignment and domain information

>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein	Back alignment and domain information

>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily	Back alignment and domain information

>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown	Back alignment and domain information

>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins	Back alignment and domain information

>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein	Back alignment and domain information

>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems	Back alignment and domain information

>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ]	Back alignment and domain information

>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed	Back alignment and domain information

>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily	Back alignment and domain information

>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily	Back alignment and domain information

>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily	Back alignment and domain information

>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis	Back alignment and domain information

>COG3107 LppC Putative lipoprotein [General function prediction only]	Back alignment and domain information

>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only]	Back alignment and domain information

>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>PRK10653 D-ribose transporter subunit RbsB; Provisional	Back alignment and domain information

>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A	Back alignment and domain information

>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs	Back alignment and domain information

>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems	Back alignment and domain information

>PRK10936 TMAO reductase system periplasmic protein TorT; Provisional	Back alignment and domain information

>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>COG1879 RbsB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria	Back alignment and domain information

>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines	Back alignment and domain information

>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily	Back alignment and domain information

>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein	Back alignment and domain information

>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>PRK09701 D-allose transporter subunit; Provisional	Back alignment and domain information

>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators	Back alignment and domain information

>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation	Back alignment and domain information

>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria	Back alignment and domain information

>PRK15395 methyl-galactoside ABC transporter galactose-binding periplasmic protein MglB; Provisional	Back alignment and domain information

>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species	Back alignment and domain information

>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli	Back alignment and domain information

>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems	Back alignment and domain information

>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR	Back alignment and domain information

>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism	Back alignment and domain information

>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PRK10355 xylF D-xylose transporter subunit XylF; Provisional	Back alignment and domain information

>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs	Back alignment and domain information

>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>TIGR01481 ccpA catabolite control protein A	Back alignment and domain information

>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation	Back alignment and domain information

>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs	Back alignment and domain information

>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors	Back alignment and domain information

>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia	Back alignment and domain information

>cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria	Back alignment and domain information

>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily	Back alignment and domain information

>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily	Back alignment and domain information

>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PRK15408 autoinducer 2-binding protein lsrB; Provisional	Back alignment and domain information

>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PRK10014 DNA-binding transcriptional repressor MalI; Provisional	Back alignment and domain information

>PRK11303 DNA-binding transcriptional regulator FruR; Provisional	Back alignment and domain information

>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>PRK10703 DNA-binding transcriptional repressor PurR; Provisional	Back alignment and domain information

>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>COG1609 PurR Transcriptional regulators [Transcription]	Back alignment and domain information

>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor	Back alignment and domain information

>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs	Back alignment and domain information

>cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs	Back alignment and domain information

>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species	Back alignment and domain information

>PRK10423 transcriptional repressor RbsR; Provisional	Back alignment and domain information

>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs	Back alignment and domain information

>TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT	Back alignment and domain information

>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional	Back alignment and domain information

>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>PRK10727 DNA-binding transcriptional regulator GalR; Provisional	Back alignment and domain information

>cd06307 PBP1_uncharacterized_sugar_binding Periplasmic sugar-binding domain of uncharacterized transport systems	Back alignment and domain information

>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A	Back alignment and domain information

>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein	Back alignment and domain information

>PRK10401 DNA-binding transcriptional regulator GalS; Provisional	Back alignment and domain information

>PRK09526 lacI lac repressor; Reviewed	Back alignment and domain information

>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR)	Back alignment and domain information

>cd06304 PBP1_BmpA_like Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria	Back alignment and domain information

>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein	Back alignment and domain information

>PRK09492 treR trehalose repressor; Provisional	Back alignment and domain information

>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems	Back alignment and domain information

>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs	Back alignment and domain information

>PRK11041 DNA-binding transcriptional regulator CytR; Provisional	Back alignment and domain information

>PRK14987 gluconate operon transcriptional regulator; Provisional	Back alignment and domain information

>TIGR02637 RhaS rhamnose ABC transporter, rhamnose-binding protein	Back alignment and domain information

>cd06354 PBP1_BmpA_PnrA_like Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea	Back alignment and domain information

>cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region	Back alignment and domain information

>cd01544 PBP1_GalR Ligand-binding domain of DNA transcription repressor GalR which is one of two regulatory proteins involved in galactose transport and metabolism	Back alignment and domain information

>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial	Back alignment and domain information

>PF13379 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_A 2I49_A 2I4B_A 2I48_A 3QSL_A	Back alignment and domain information

>COG4213 XylF ABC-type xylose transport system, periplasmic component [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1744 Med Uncharacterized ABC-type transport system, periplasmic component/surface lipoprotein [General function prediction only]	Back alignment and domain information

>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PF14503 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B	Back alignment and domain information

>PF09084 NMT1: NMT1/THI5 like; InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins	Back alignment and domain information

>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea	Back alignment and domain information

>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family	Back alignment and domain information

>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family	Back alignment and domain information

>PRK11480 tauA taurine transporter substrate binding subunit; Provisional	Back alignment and domain information

>PF03466 LysR_substrate: LysR substrate binding domain; InterPro: IPR005119 The structure of this domain is known and is similar to the periplasmic binding proteins []	Back alignment and domain information

>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional	Back alignment and domain information

>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria []	Back alignment and domain information

>PF12727 PBP_like: PBP superfamily domain; InterPro: IPR024370 This entry represents members of the periplasmic binding domain superfamily []	Back alignment and domain information

>TIGR00363 lipoprotein, YaeC family	Back alignment and domain information

>cd05466 PBP2_LTTR_substrate The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily	Back alignment and domain information

>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional	Back alignment and domain information

>cd08440 PBP2_LTTR_like_4 TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold	Back alignment and domain information

>PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria	Back alignment and domain information

>cd06276 PBP1_FucR_like Ligand-binding domain of a transcription repressor, FucR, which functions as a molecular sensor of L-fucose availability	Back alignment and domain information

>TIGR02990 ectoine_eutA ectoine utilization protein EutA	Back alignment and domain information

>PRK12684 transcriptional regulator CysB-like protein; Reviewed	Back alignment and domain information

>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional	Back alignment and domain information

>CHL00180 rbcR LysR transcriptional regulator; Provisional	Back alignment and domain information

>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd08459 PBP2_DntR_NahR_LinR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold	Back alignment and domain information

>PRK09791 putative DNA-binding transcriptional regulator; Provisional	Back alignment and domain information

>cd08418 PBP2_TdcA The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold	Back alignment and domain information

>PRK10837 putative DNA-binding transcriptional regulator; Provisional	Back alignment and domain information

>cd08466 PBP2_LeuO The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of leucine synthesis operon, contains the type 2 periplasmic binding fold	Back alignment and domain information

>PRK12679 cbl transcriptional regulator Cbl; Reviewed	Back alignment and domain information

>cd08421 PBP2_LTTR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold	Back alignment and domain information

>cd08468 PBP2_Pa0477 The C-terminal substrate biniding domain of an uncharacterized LysR-like transcriptional regulator Pa0477 related to DntR, contains the type 2 periplasmic binding fold	Back alignment and domain information

>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea	Back alignment and domain information

>cd08412 PBP2_PAO1_like The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily	Back alignment and domain information

>PF13377 Peripla_BP_3: Periplasmic binding protein-like domain; PDB: 3K9C_B 3BIL_B 3JVD_B 1ZAY_A 1VPW_A 1DBQ_A 2PUA_A 1QQA_A 1PNR_A 1JHZ_A	Back alignment and domain information

>PF02608 Bmp: Basic membrane protein; InterPro: IPR003760 This is a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria	Back alignment and domain information

>TIGR00035 asp_race aspartate racemase	Back alignment and domain information

>cd08462 PBP2_NodD The C-terminal substsrate binding domain of NodD family of LysR-type transcriptional regulators that regulates the expression of nodulation (nod) genes; contains the type 2 periplasmic binding fold	Back alignment and domain information

>cd08426 PBP2_LTTR_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold	Back alignment and domain information

>TIGR00787 dctP tripartite ATP-independent periplasmic transporter solute receptor, DctP family	Back alignment and domain information

>PRK12681 cysB transcriptional regulator CysB; Reviewed	Back alignment and domain information

>PF13531 SBP_bac_11: Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A	Back alignment and domain information

>cd08442 PBP2_YofA_SoxR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold	Back alignment and domain information

>cd08463 PBP2_DntR_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold	Back alignment and domain information

>cd08433 PBP2_Nac The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold	Back alignment and domain information

>PRK11233 nitrogen assimilation transcriptional regulator; Provisional	Back alignment and domain information

>cd08419 PBP2_CbbR_RubisCO_like The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold	Back alignment and domain information

>PRK10200 putative racemase; Provisional	Back alignment and domain information

>cd08420 PBP2_CysL_like C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold	Back alignment and domain information

>PF03480 SBP_bac_7: Bacterial extracellular solute-binding protein, family 7; InterPro: IPR018389 This family of proteins are involved in binding extracellular solutes for transport across the bacterial cytoplasmic membrane	Back alignment and domain information

>cd08415 PBP2_LysR_opines_like The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold	Back alignment and domain information

>cd08438 PBP2_CidR The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold	Back alignment and domain information

>PRK10341 DNA-binding transcriptional activator TdcA; Provisional	Back alignment and domain information

>cd08417 PBP2_Nitroaromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold	Back alignment and domain information

>PRK11242 DNA-binding transcriptional regulator CynR; Provisional	Back alignment and domain information

>PF03401 TctC: Tripartite tricarboxylate transporter family receptor; InterPro: IPR005064 Bordetella pertussis, the causative agent of human whooping cough (pertussis), is an obligate human pathogen with diverse high-affinity transport systems for the assimilation of iron, a biometal that is essential for growth []	Back alignment and domain information

>cd08461 PBP2_DntR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold	Back alignment and domain information

>COG2358 Imp TRAP-type uncharacterized transport system, periplasmic component [General function prediction only]	Back alignment and domain information

>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein	Back alignment and domain information

>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ	Back alignment and domain information

>cd08425 PBP2_CynR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator CynR, contains the type 2 periplasmic binding fold	Back alignment and domain information

>cd08435 PBP2_GbpR The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold	Back alignment and domain information

>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd08444 PBP2_Cbl The C-terminal substrate binding domain of LysR-type transcriptional regulator Cbl, which is required for expression of sulfate starvation-inducible (ssi) genes, contains the type 2 periplasmic binding fold	Back alignment and domain information

>cd08411 PBP2_OxyR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily	Back alignment and domain information

>cd08413 PBP2_CysB_like The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold	Back alignment and domain information

>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold	Back alignment and domain information

>PRK12680 transcriptional regulator CysB-like protein; Reviewed	Back alignment and domain information

>cd08467 PBP2_SyrM The C-terminal substrate binding of LysR-type symbiotic regulator SyrM, which activates expression of nodulation gene NodD3, contains the type 2 periplasmic binding fold	Back alignment and domain information

>PRK12682 transcriptional regulator CysB-like protein; Reviewed	Back alignment and domain information

>cd08460 PBP2_DntR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		920
3kg2_A		823	Ampa Subtype Ionotropic Glutamate Receptor In Compl		2e-13
4f11_A		433	Crystal Structure Of The Extracellular Domain Of Hu		1e-10
4ey3_A		368	Crystal Structure Of Solute Binding Protein Of Abc		5e-08
3lmk_A		492	Ligand Binding Domain Of Metabotropoc Glutamate Rec		7e-06
2e4z_A		501	Crystal Structure Of The Ligand-Binding Region Of T		7e-05
3mq4_A		481	Metabotropic Glutamate Receptor Mglur7 Complexed Wi		8e-05
4evs_A		371	Crystal Structure Of Abc Transporter From R. Palust		8e-05
3ks9_A		496	Metabotropic Glutamate Receptor Mglur1 Complexed Wi		8e-05
2liv_A		344	Periplasmic Binding Protein Structure And Function.		1e-04
1ewk_A		490	Crystal Structure Of Metabotropic Glutamate Recepto		1e-04
2e4u_A		555	Crystal Structure Of The Extracellular Region Of Th		1e-04
3oek_A		286	Crystal Structure Of Glun2d Ligand-Binding Core In		2e-04
1z15_A		344	Crystal Structure Analysis Of Periplasmic Leu/ile/v		2e-04
3g3k_A		259	Crystal Structure Of The Glur6 Ligand Binding Domai		2e-04
3g3j_A		259	Crystal Structure Of The Glur6 Ligand Binding Domai		2e-04
3g3i_A		259	Crystal Structure Of The Glur6 Ligand Binding Domai		2e-04
3sm9_A		479	Crystal Structure Of Metabotropic Glutamate Recepto		2e-04
4f06_A		371	Crystal Structure Of Solute Binding Protein Of Abc		3e-04
2v3u_A		265	Structure Of The Ligand-binding Core Of The Ionotro		5e-04

>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823