Citrus Sinensis ID: 002462


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------92
MRWSMLLLDDCECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNATQPPPPETSGDSNRKIIVLSAVLGGFGLIVLLVLLALLALCFCKKRTPNQRGVGVGPVPAGSSLPPPGASINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLKVVREENSGSARLRTTSSRGSWNAALFGSWRQSSSDVAAIPVPPNTKAEGTSSLKQSGTTGSQGSGQIGGGEHSSSQRRQSRDIFPEPSDTQDVETQVQD
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccEEEEcccccEEEEECcccccccccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccCEECcccccccccccccEEEcccccccccccccccccccccEEEccccCEECcccccccccccccEEEccccCEcccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEcccccccccccHHccccccccEEEcccccccccccHHHHHHHHcccEEEcccccccccccccccccccEEccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEccccccEEEEEECccccEEEEEEEcccccccHHHHHHHHHHccccccccccEEEEECcccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccEEcccccccccccccccEEEccccccccccccccccEEEEEEEEECccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccc
**WSMLLLDDCECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFG******************KIIVLSAVLGGFGLIVLLVLLALLALCFCKKRT***********************INFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGG*****RI*RLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPL****************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRWSMLLLDDCECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNATQPPPPETSGDSNRKIIVLSAVLGGFGLIVLLVLLALLALCFCKKRTPNQRGVGVGPVPAGSSLPPPGASINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLKVVREENSGSARLRTTSSRGSWNAALFGSWRQSSSDVAAIPVPPNTKAEGTSSLKQSGTTGSQGSGQIGGGEHSSSQRRQSRDIFPEPSDTQDVETQVQD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable LRR receptor-like serine/threonine-protein kinase At2g16250 probableC0LGK4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 45-83,111-365
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 45-83,111-365
View the alignment between query and template
View the model in PyMOL
Template: 2QKW, chain B
Confidence level:very confident
Coverage over the Query: 525-821
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:confident
Coverage over the Query: 46-408
View the alignment between query and template
View the model in PyMOL
Template: 2ID5, chain A
Confidence level:confident
Coverage over the Query: 109-370
View the alignment between query and template
View the model in PyMOL
Template: 3HGK, chain A
Confidence level:confident
Coverage over the Query: 529-821
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:probable
Coverage over the Query: 132-418
View the alignment between query and template
View the model in PyMOL
Template: 3S95, chain A
Confidence level:probable
Coverage over the Query: 545-689,712-759,771-777,791-854
View the alignment between query and template
View the model in PyMOL