Citrus Sinensis ID: 002462


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------92
MRWSMLLLDDCECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNATQPPPPETSGDSNRKIIVLSAVLGGFGLIVLLVLLALLALCFCKKRTPNQRGVGVGPVPAGSSLPPPGASINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLKVVREENSGSARLRTTSSRGSWNAALFGSWRQSSSDVAAIPVPPNTKAEGTSSLKQSGTTGSQGSGQIGGGEHSSSQRRQSRDIFPEPSDTQDVETQVQD
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccEEEEcccccEEEEEEcccccccccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccEEEEcccccccccccccEEEcccccccccccccccccccccEEEccccEEEEcccHHccccccccEEEccccEEcccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEccccccccccHHHccccccccEEEcccccccccccHHHHHHHHcccEEEcccccccccccccccccccEEccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEccccccEEEEEEEccccEEEEEEEcccccccHHHHHHHHHHccccccccccEEEEEEcccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccEEcccccccccccccccEEEccccccccccccccccEEEEEEEEEEccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccc
ccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccEEEEEcccEEEEEEcccccHHcccccccccccHHHccccccEEEEcccccccccccHHHHHHHccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEcccHHHHHccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHcccHHcEEEEcccccccccccHHHccccEEEcccccccccccHHHccccccEEEEcccccccccccccHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHccccccccHHHHHHHHccccHHcEEcccccEEEEEEEcccccEEEEEEEcccccccccHEEEHHHHcccccccHHHHHEEEccccccEEEEEEccccccHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccccEEEcccccHHHHHccHEEEEccccccccEEccccccccccHcEEEEEEccccccEEHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccHHHccHHHccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccc
mrwsmlllddcECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELRSSlglrrrdwprkvdpclvwngvrcqngsvvginisgfrrtrlgsqnprFAADALVNLTHLasfnasrfllpgsipdwlgqqlptlqaldlrscsisgvipfslgnltnltslylsdngltgtipsslgqlsVLSVLDLsrnsltgniptsfgllknlssldissnyltgsippglgtlskLQYLnvsnnslassipaqlgdldslvdldlsmnslsgsvpselRGLRSLQKfvignnflsgnlsvnlfptvSQLQIIVLRqngftgpppdvlwsmpqlrlldisrnnftgplpnsrsnvntSTVELNIsqnmfyggltpvlgrfrlvdlsgnyfegrvpeyvhsnassldsnclqnvpnqrtlvdcssfyaarglsfdnfgrpnatqppppetsgdsnrkIIVLSAVLGGFGLIVLLVLLALLALCFckkrtpnqrgvgvgpvpagsslpppgasinftnlgesFTYQQLLAatgdfsdanliknghsgdlfrgileggiPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPllghcmereneKFLVykympngdlssslyrktnteddlqsLDWITRLKIAIGAAEGLsylhhectlpfvhrdvqassillddkfeVRLGSLSEVCAQGGDAHQSRITRLlrlpqsseqgssgsltatcpydvyCFGKVLLELVTGkmgisassDAQVKEILEQTlpyisiydkelvtkivdpsliideDLLEEVWAMAIVARsclnpkptrrPLMRYILKALENPLkvvreensgsarlrttssrgswnaalfgswrqsssdvaaipvppntkaegtsslkqsgttgsqgsgqigggehsssqrrqsrdifpepsdtqdvetqvqd
mrwsmlllDDCECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELrsslglrrrdwprkvdpclvwngvrcqngsvVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFtgplpnsrsnVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNATQppppetsgdsnRKIIVLSAVLGGFGLIVLLVLLALLALCFCKKRTPNQRGVGVGPVPAGSSLPPPGASINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRlpqsseqgssgsltatcpYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVArsclnpkptrrPLMRYILKALenplkvvreensgsarlrttssrgswNAALFGSWRQSSSDVAAIPVPPNTKAegtsslkqsgttgsqgsgqigggehsssqrrqsrdifpepsdtqdvetqvqd
MRWSMLLLDDCECVKAMVDQRSvvmffvmflllfEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPsslgqlsvlsvldlsrnslTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQlgdldslvdldlsmnslsGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNATQPPPPETSGDSNRKIIVLSavlggfglivllvllallalCFCKKRTPNQRgvgvgpvpagsslpppgasINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLKVVREENSGSARLRTTSSRGSWNAALFGSWRQSSSDVAAIPVPPNTKAEgtsslkqsgttgsqgsgqigggehsssqRRQSRDIFPEPSDTQDVETQVQD
**WSMLLLDDCECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDL************LRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFT***********TSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDN********************KIIVLSAVLGGFGLIVLLVLLALLALCFCKKRT***********************INFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQ***************************TATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLKV********************NAALFG************************************************************************
***SMLLLDDCECVKAMVDQRSVVMFFVMFLLLFEPTFE************AALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFG***********************SAVLGGFGLIVLLVLLALLALCFCK**************************INFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTN**DDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGG*****RI*RLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALE*******************************************************************************************************
MRWSMLLLDDCECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNA***********SNRKIIVLSAVLGGFGLIVLLVLLALLALCFCKKRTPNQRGVGVGPVPAGSSLPPPGASINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRLP*********SLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLKVVRE**************GSWNAALFGSWRQSSSDVAAIPVPPN************************************RDIFP**************
*RWSMLLLDDCECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNATQPPPPETS****RKIIVLSAVLGGFGLIVLLVLLALLALCFCKKRTPNQR*************PPPGASINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPL****************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRWSMLLLDDCECVKAMVDQRSVVMFFVMFLLLFEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNATQPPPPETSGDSNRKIIVLSAVLGGFGLIVLLVLLALLALCFCKKRTPNQRGVGVGPVPAGSSLPPPGASINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLKVVREENSGSARLRTTSSRGSWNAALFGSWRQSSSDVAAIPVPPNTKAEGTSSLKQSGTTGSQGSGQIGGGEHSSSQRRQSRDIFPEPSDTQDVETQVQD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query919 2.2.26 [Sep-21-2011]
C0LGK4915 Probable LRR receptor-lik yes no 0.881 0.885 0.641 0.0
C0LGQ51249 LRR receptor-like serine/ no no 0.737 0.542 0.314 6e-75
Q9ZWC81166 Serine/threonine-protein no no 0.738 0.582 0.305 4e-70
Q9FIZ31252 LRR receptor-like serine/ no no 0.734 0.539 0.304 8e-70
Q6XAT2967 LRR receptor-like serine/ no no 0.761 0.723 0.293 8e-69
Q9LHP41141 Receptor-like protein kin no no 0.723 0.582 0.310 2e-68
Q9SHI21101 Leucine-rich repeat recep no no 0.701 0.585 0.284 7e-68
Q9LYN81192 Leucine-rich repeat recep no no 0.722 0.557 0.321 3e-66
O493181124 Probable leucine-rich rep no no 0.741 0.605 0.278 8e-65
Q8L8991207 Systemin receptor SR160 O N/A no 0.770 0.586 0.289 1e-63
>sp|C0LGK4|Y2165_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g16250 OS=Arabidopsis thaliana GN=At2g16250 PE=1 SV=1 Back     alignment and function desciption
 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/820 (64%), Positives = 638/820 (77%), Gaps = 10/820 (1%)

Query: 49  TELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRF 108
           +E   L  LRSSLGLR  DWP K DPC+ W G++C+NGS++GINISGFRRTR+G  NP+F
Sbjct: 35  SEKLILLNLRSSLGLRGTDWPIKGDPCVDWRGIQCENGSIIGINISGFRRTRIGKLNPQF 94

Query: 109 AADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNL 168
           + D L NLT L+ FNAS   LPG+IP+W G  L  L+ LDL SCS++GV+PF+LGNLT+L
Sbjct: 95  SVDPLRNLTRLSYFNASGLALPGTIPEWFGVSLLALEVLDLSSCSVNGVVPFTLGNLTSL 154

Query: 169 TSLYLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTG 228
            +L LS N LT  +PSSLGQL  LS LDLSRNS TG +P SF  LKNL +LD+SSNYLTG
Sbjct: 155 RTLNLSQNSLTSLVPSSLGQLLNLSQLDLSRNSFTGVLPQSFSSLKNLLTLDVSSNYLTG 214

Query: 229 SIPPGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSL 288
            IPPGLG LSKL +LN S+NS +S IP++LGDL +LVD DLS+NSLSGSVP ELR L  L
Sbjct: 215 PIPPGLGALSKLIHLNFSSNSFSSPIPSELGDLVNLVDFDLSINSLSGSVPQELRKLSKL 274

Query: 289 QKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFT 348
           Q   IG+N LSG L V+LF   SQLQ +VLR+NGF+G  PDV WS+P+LR+LDI++NNFT
Sbjct: 275 QLMAIGDNLLSGTLPVDLFSAESQLQTLVLRENGFSGSLPDVCWSLPKLRILDIAKNNFT 334

Query: 349 GPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSL 408
           G LP S  + +     ++IS N FYG LTP+L RFR++DLSGNYFEG++P+YV     S+
Sbjct: 335 GLLPYSSYDSDQIAEMVDISSNTFYGELTPILRRFRIMDLSGNYFEGKLPDYVTGENVSV 394

Query: 409 DSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNATQPPPPE-TSGDSNRKIIVLSAVL 467
            SNCL+N   Q+    C++FY +RGL FD+FGRPN TQP     +SG S R +I+L+AV 
Sbjct: 395 TSNCLRNERRQKPSAICAAFYKSRGLDFDDFGRPNLTQPTSKNASSGISRRTVIILAAVG 454

Query: 468 GGFGLIVLLVLL-ALLALCFCKKRTPNQRGVGVGPVPAG--SSLPPPGA-SINFTNLGES 523
           GG   I+L V+L  +L LC   +R   QRG    P PAG  S  PP GA + + + LG +
Sbjct: 455 GGVAFILLFVILPIILVLCMRHRRRAAQRGNNDRPKPAGEASQQPPKGAQTFDLSRLGNA 514

Query: 524 FTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFF 583
           F+Y+QLL AT +F+DANLIK GHSG+LFRG LE GIPVVIK+ID++  K+E Y+ EL+ F
Sbjct: 515 FSYEQLLQATEEFNDANLIKRGHSGNLFRGFLENGIPVVIKKIDVREGKSEGYISELELF 574

Query: 584 SKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTE-DDLQSLDWITRLKI 642
           SK  H RLVP LGHC+E E++KFLVYK+M +GDL+SSL+RK+  E D L+SLDWITRLKI
Sbjct: 575 SKAGHQRLVPFLGHCLENESQKFLVYKFMRHGDLASSLFRKSENEGDGLKSLDWITRLKI 634

Query: 643 AIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRL 702
           A+GAAEGLSYLHHEC+ P VHRDVQASSILLDDKFEVRLGSLSE  AQ GDA+QSRI+RL
Sbjct: 635 ALGAAEGLSYLHHECSPPLVHRDVQASSILLDDKFEVRLGSLSEAYAQ-GDAYQSRISRL 693

Query: 703 LRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYIS 762
           LRLPQSSE  SSG   A C YDVYCFGKVLLELVTGK+GIS+  +A  KE +E+ LPYIS
Sbjct: 694 LRLPQSSEPSSSGVTNAICSYDVYCFGKVLLELVTGKLGISSPDNALAKEYMEEALPYIS 753

Query: 763 IYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLKVV 822
             +KELVTKI+DPSL++DEDLLEEVWAMAI+A+SCLNPKPTRRPLMR+I+ ALENPLKVV
Sbjct: 754 TNEKELVTKILDPSLMVDEDLLEEVWAMAIIAKSCLNPKPTRRPLMRHIVNALENPLKVV 813

Query: 823 REEN---SGSARLRTTSSRGSWNAALFGSWRQSSSDVAAI 859
           RE+    SGS+RLRT SSRGSWNAA+FGSWRQS+SDV A+
Sbjct: 814 REDTNSGSGSSRLRTNSSRGSWNAAIFGSWRQSASDVTAV 853





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query919
255536845901 lrr receptor protein kinase, putative [R 0.978 0.997 0.734 0.0
359475328908 PREDICTED: probable LRR receptor-like se 0.981 0.993 0.718 0.0
224103409893 predicted protein [Populus trichocarpa] 0.944 0.972 0.741 0.0
356509565900 PREDICTED: probable LRR receptor-like se 0.946 0.966 0.676 0.0
356517903898 PREDICTED: probable LRR receptor-like se 0.946 0.968 0.679 0.0
449462274896 PREDICTED: probable LRR receptor-like se 0.944 0.968 0.686 0.0
225458279903 PREDICTED: probable LRR receptor-like se 0.944 0.961 0.657 0.0
449496837908 PREDICTED: probable LRR receptor-like se 0.960 0.972 0.662 0.0
449463390908 PREDICTED: probable LRR receptor-like se 0.960 0.972 0.662 0.0
297836662907 hypothetical protein ARALYDRAFT_480795 [ 0.912 0.925 0.644 0.0
>gi|255536845|ref|XP_002509489.1| lrr receptor protein kinase, putative [Ricinus communis] gi|223549388|gb|EEF50876.1| lrr receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1268 bits (3280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/905 (73%), Positives = 752/905 (83%), Gaps = 6/905 (0%)

Query: 17  MVDQRSVVMFFVMFLLL-FEPTFEQQLERLSSRTELAALFELRSSLGLRRRDWPRKVDPC 75
           MVDQR V+    + LLL F+P+F QQ+E L+S  E AAL +LRSSLG+R ++WPRK +PC
Sbjct: 1   MVDQRIVIALAFLLLLLKFQPSF-QQVETLNSPVERAALLQLRSSLGIRSKEWPRKTNPC 59

Query: 76  LVWNGVRCQNGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLASFNASRFLLPGSIPD 135
             W G+ C NGSV GINISGFRRTRLGSQNP+F  DALVNLTHL SFNASRF LPGSIPD
Sbjct: 60  SNWTGISCTNGSVSGINISGFRRTRLGSQNPQFVVDALVNLTHLISFNASRFQLPGSIPD 119

Query: 136 WLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLTGTIPSSLGQLSVLSVL 195
           W GQ L +LQALDL  C I   IP SLGNLTNLTSLYLS N L G+IPSSLGQL +LS+L
Sbjct: 120 WFGQSLGSLQALDLSFCDIRNAIPASLGNLTNLTSLYLSGNRLVGSIPSSLGQLVLLSIL 179

Query: 196 DLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIP 255
           +LS+NSLT +IP SFG L NL+ LDISSN+L+GSIPPG+G L KLQYLN+SNN L+S IP
Sbjct: 180 NLSQNSLTVSIPVSFGFLANLTILDISSNFLSGSIPPGIGMLLKLQYLNLSNNQLSSPIP 239

Query: 256 AQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNLFPTVSQLQI 315
           AQLGDL  LVDLDLS NSLSGSVP+ELRGLR+L++ +IGNN L G+L VNLF    QLQI
Sbjct: 240 AQLGDLVQLVDLDLSFNSLSGSVPAELRGLRNLKRMLIGNNMLVGSLPVNLFSASIQLQI 299

Query: 316 IVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRSNVNTSTVELNISQNMFYGG 375
           +V++ NGFTG  P+VLW+MP L  LDIS NNFTG LPN   N NTST ELNIS N+ YG 
Sbjct: 300 VVMKNNGFTGSVPNVLWTMPGLSFLDISGNNFTGLLPNVTFNANTSTAELNISGNLLYGF 359

Query: 376 LTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSLDSNCLQNVPNQRTLVDCSSFYAARGLS 435
           L P+L RF  VDLSGNYFEG+V + V  NAS L SNCLQNV NQR+L +C+SFYA RGL 
Sbjct: 360 LNPILRRFSFVDLSGNYFEGKVLDLVPDNASLL-SNCLQNVSNQRSLSECTSFYAERGLI 418

Query: 436 FDNFGRPNATQPPPPETSGDSNRKIIVLSAVLGGFGLIVLLVLLALLALCFCKKRTPNQR 495
           FDNFG PN+TQPP  E+ G SNR +I+L++VLGG GL+VLL++L LL +C CK+ T NQR
Sbjct: 419 FDNFGLPNSTQPPAGESEGKSNRMVIILASVLGGVGLVVLLIILVLLFVCHCKRGTANQR 478

Query: 496 GVGVGPVPAGSSLPPPGASINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGIL 555
           G GVGPVPAGSS PPP A+I+ ++LG++FTYQQLL AT DFSD NLIK+GHSGDL+RG+L
Sbjct: 479 GTGVGPVPAGSSPPPPEAAIDLSSLGDTFTYQQLLQATSDFSDENLIKHGHSGDLYRGVL 538

Query: 556 EGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNG 615
           E GI VVIKR+ LQS+K E+Y++ELD FSKVSH RLVP LGHC+  ENEKFLVYKYMPN 
Sbjct: 539 ENGISVVIKRVHLQSIKKESYVMELDIFSKVSHPRLVPFLGHCLANENEKFLVYKYMPNR 598

Query: 616 DLSSSLYRKTNTEDD-LQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASSILLD 674
           DLSSSLYRKT+++DD LQSLDWITRLKIA GAAE LS LHHECT P VHRDVQASSILLD
Sbjct: 599 DLSSSLYRKTSSDDDSLQSLDWITRLKIATGAAEALSCLHHECTPPIVHRDVQASSILLD 658

Query: 675 DKFEVRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLE 734
           DKFEVRLGSLSEVC Q GDAHQSRITRLLRLPQSSEQ +SGSLTA C YDVYCFGKVLLE
Sbjct: 659 DKFEVRLGSLSEVCPQEGDAHQSRITRLLRLPQSSEQSTSGSLTAMCAYDVYCFGKVLLE 718

Query: 735 LVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVA 794
           LVTGK+G SASS+AQ+KE LEQTLPYISIYDKELVTKIVDPSLI+DEDLLEEVWAMAIVA
Sbjct: 719 LVTGKLGTSASSEAQLKEWLEQTLPYISIYDKELVTKIVDPSLIVDEDLLEEVWAMAIVA 778

Query: 795 RSCLNPKPTRRPLMRYILKALENPLKVVREENSGSARLRTTSSRGSWNAALFGSWRQSSS 854
           RSCLNPKP+RRPLMRYILKALENPLKVVREE+S SARLRTTSSRGSWNAA+FGSWR SSS
Sbjct: 779 RSCLNPKPSRRPLMRYILKALENPLKVVREESSSSARLRTTSSRGSWNAAIFGSWR-SSS 837

Query: 855 DVAAIPVPPNTKAEGTSSLKQSGTTGSQGSGQIGGGEHSSSQRRQSRDIFPEPSDTQDVE 914
           DVA IP   NT+ EG+SSLK S  T + G     GGEHSSS RR SR+IFPEPS+ QD+E
Sbjct: 838 DVAVIPAGSNTRPEGSSSLKHS-GTSNSGGSGQNGGEHSSSHRRYSREIFPEPSEGQDIE 896

Query: 915 TQVQD 919
            Q QD
Sbjct: 897 RQGQD 901




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359475328|ref|XP_003631657.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224103409|ref|XP_002313045.1| predicted protein [Populus trichocarpa] gi|222849453|gb|EEE87000.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356509565|ref|XP_003523518.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Glycine max] Back     alignment and taxonomy information
>gi|356517903|ref|XP_003527625.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Glycine max] Back     alignment and taxonomy information
>gi|449462274|ref|XP_004148866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Cucumis sativus] gi|449507355|ref|XP_004163008.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225458279|ref|XP_002281409.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449496837|ref|XP_004160239.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449463390|ref|XP_004149417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g16250-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297836662|ref|XP_002886213.1| hypothetical protein ARALYDRAFT_480795 [Arabidopsis lyrata subsp. lyrata] gi|297332053|gb|EFH62472.1| hypothetical protein ARALYDRAFT_480795 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query919
TAIR|locus:2042599915 AT2G16250 [Arabidopsis thalian 0.934 0.938 0.556 9.3e-249
TAIR|locus:2136313864 AT4G39270 [Arabidopsis thalian 0.762 0.811 0.518 1.2e-177
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.373 0.273 0.317 1e-63
UNIPROTKB|Q8RZV71294 P0413C03.22 "Putative extra sp 0.304 0.216 0.335 1.3e-61
TAIR|locus:21203621249 GSO1 "GASSHO1" [Arabidopsis th 0.746 0.549 0.279 8.6e-60
TAIR|locus:20326971123 PEPR1 "PEP1 receptor 1" [Arabi 0.331 0.271 0.308 2.4e-58
TAIR|locus:20859491141 AT3G24240 [Arabidopsis thalian 0.309 0.248 0.348 1.9e-57
TAIR|locus:20465251124 AT2G33170 [Arabidopsis thalian 0.325 0.266 0.294 6.6e-57
TAIR|locus:20204171101 AT1G17230 [Arabidopsis thalian 0.299 0.249 0.302 7.5e-57
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.342 0.281 0.326 4.4e-56
TAIR|locus:2042599 AT2G16250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2396 (848.5 bits), Expect = 9.3e-249, P = 9.3e-249
 Identities = 486/873 (55%), Positives = 594/873 (68%)

Query:    49 TELAALFELRSSLGLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFRRTRLGSQNPRF 108
             +E   L  LRSSLGLR  DWP K DPC+ W G++C+NGS++GINISGFRRTR+G  NP+F
Sbjct:    35 SEKLILLNLRSSLGLRGTDWPIKGDPCVDWRGIQCENGSIIGINISGFRRTRIGKLNPQF 94

Query:   109 AADALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNL 168
             + D L NLT L+ FNAS   LPG+IP+W G  L  L+ LDL SCS++GV+PF+LGNLT+L
Sbjct:    95 SVDPLRNLTRLSYFNASGLALPGTIPEWFGVSLLALEVLDLSSCSVNGVVPFTLGNLTSL 154

Query:   169 TSLYLSDNGLTGTIPXXXXXXXXXXXXXXXXXXXTGNIPTSFGLLKNLSSLDISSNYLTG 228
              +L LS N LT  +P                   TG +P SF  LKNL +LD+SSNYLTG
Sbjct:   155 RTLNLSQNSLTSLVPSSLGQLLNLSQLDLSRNSFTGVLPQSFSSLKNLLTLDVSSNYLTG 214

Query:   229 SIPPGLGTLSKLQYLNVSNNSLASSIPAQXXXXXXXXXXXXXXXXXXGSVPSELRGLRSL 288
              IPPGLG LSKL +LN S+NS +S IP++                  GSVP ELR L  L
Sbjct:   215 PIPPGLGALSKLIHLNFSSNSFSSPIPSELGDLVNLVDFDLSINSLSGSVPQELRKLSKL 274

Query:   289 QKFVIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFT 348
             Q   IG+N LSG L V+LF   SQLQ +VLR+NGF+G  PDV WS+P+LR+LDI++NNFT
Sbjct:   275 QLMAIGDNLLSGTLPVDLFSAESQLQTLVLRENGFSGSLPDVCWSLPKLRILDIAKNNFT 334

Query:   349 GPLPNSRSNVNTSTVELNISQNMFYGGLTPVLGRFRLVDLSGNYFEGRVPEYVHSNASSL 408
             G LP S  + +     ++IS N FYG LTP+L RFR++DLSGNYFEG++P+YV     S+
Sbjct:   335 GLLPYSSYDSDQIAEMVDISSNTFYGELTPILRRFRIMDLSGNYFEGKLPDYVTGENVSV 394

Query:   409 DSNCLQNVPNQRTLVDCSSFYAARGLSFDNFGRPNATQPPPPE-TSGDSNRKIIVLSXXX 467
              SNCL+N   Q+    C++FY +RGL FD+FGRPN TQP     +SG S R +I+L+   
Sbjct:   395 TSNCLRNERRQKPSAICAAFYKSRGLDFDDFGRPNLTQPTSKNASSGISRRTVIILAAVG 454

Query:   468 XXXXXXXXXXXX-XXXXXCFCKKRTPNQRXXXXXXXXXXXXXXX---XXXXINFTNLGES 523
                               C   +R   QR                       + + LG +
Sbjct:   455 GGVAFILLFVILPIILVLCMRHRRRAAQRGNNDRPKPAGEASQQPPKGAQTFDLSRLGNA 514

Query:   524 FTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFF 583
             F+Y+QLL AT +F+DANLIK GHSG+LFRG LE GIPVVIK+ID++  K+E Y+ EL+ F
Sbjct:   515 FSYEQLLQATEEFNDANLIKRGHSGNLFRGFLENGIPVVIKKIDVREGKSEGYISELELF 574

Query:   584 SKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDD-LQSLDWITRLKI 642
             SK  H RLVP LGHC+E E++KFLVYK+M +GDL+SSL+RK+  E D L+SLDWITRLKI
Sbjct:   575 SKAGHQRLVPFLGHCLENESQKFLVYKFMRHGDLASSLFRKSENEGDGLKSLDWITRLKI 634

Query:   643 AIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRL 702
             A+GAAEGLSYLHHEC+ P VHRDVQASSILLDDKFEVRLGSLSE  AQG DA+QSRI+RL
Sbjct:   635 ALGAAEGLSYLHHECSPPLVHRDVQASSILLDDKFEVRLGSLSEAYAQG-DAYQSRISRL 693

Query:   703 LRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYIS 762
             LRLPQSSE  SSG   A C YDVYCFGKVLLELVTGK+GIS+  +A  KE +E+ LPYIS
Sbjct:   694 LRLPQSSEPSSSGVTNAICSYDVYCFGKVLLELVTGKLGISSPDNALAKEYMEEALPYIS 753

Query:   763 IYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLKVV 822
               +KELVTKI+DPSL++DEDLLEEVWAMAI+A+SCLNPKPTRRPLMR+I+ ALENPLKVV
Sbjct:   754 TNEKELVTKILDPSLMVDEDLLEEVWAMAIIAKSCLNPKPTRRPLMRHIVNALENPLKVV 813

Query:   823 REEN---SGSARLRTTSSRGSWNAALFGSWRQSSSDVAAIPVPPNTKAEXXXXXXXXXXX 879
             RE+    SGS+RLRT SSRGSWNAA+FGSWRQS+SDV A+     T              
Sbjct:   814 REDTNSGSGSSRLRTNSSRGSWNAAIFGSWRQSASDVTAVQAGATTSGGGGGGGGNGLRN 873

Query:   880 XXXXXXXXXXXX----XXXXXRRQSRDIFPEPS 908
                                  RRQS +I PEP+
Sbjct:   874 SGSQGSSGRNNNNNGNSSSSRRRQSSEIVPEPA 906




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2136313 AT4G39270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8RZV7 P0413C03.22 "Putative extra sporogenous cells" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032697 PEPR1 "PEP1 receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
C0LGK4Y2165_ARATH2, ., 7, ., 1, 1, ., 10.64140.88130.8852yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query919
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-49
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-43
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-26
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 1e-23
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-20
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 5e-20
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-19
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-19
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 9e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-16
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-15
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-14
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-13
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 3e-12
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 4e-12
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 9e-12
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 4e-11
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 1e-10
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-10
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 4e-10
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 5e-10
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 5e-10
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 6e-10
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 6e-10
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 7e-10
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-09
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 3e-09
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 4e-09
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 4e-09
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 8e-09
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 9e-09
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 9e-09
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-08
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 2e-08
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 2e-08
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 2e-08
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 3e-08
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 3e-08
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 4e-08
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 5e-08
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 5e-08
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 7e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 2e-07
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 2e-07
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 3e-07
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 3e-07
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 6e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-06
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 1e-06
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 1e-06
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-06
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 2e-06
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 2e-06
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-06
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 3e-06
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 4e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-06
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 5e-06
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 6e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 1e-05
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 1e-05
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-05
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-05
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 2e-05
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 2e-05
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 3e-05
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 3e-05
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 3e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-05
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 5e-05
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 5e-05
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 6e-05
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 8e-05
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 8e-05
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 9e-05
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 9e-05
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 1e-04
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 1e-04
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 1e-04
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 1e-04
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 1e-04
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 2e-04
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-04
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 2e-04
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 3e-04
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 3e-04
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 3e-04
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 3e-04
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 4e-04
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 5e-04
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 5e-04
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 5e-04
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 5e-04
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 5e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 6e-04
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 6e-04
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 6e-04
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 7e-04
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 0.001
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 0.001
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 0.001
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 0.001
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 0.001
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 0.002
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 0.002
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 0.002
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 0.003
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 0.003
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 0.003
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 0.004
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 0.004
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 0.004
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 0.004
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 0.004
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  188 bits (478), Expect = 4e-49
 Identities = 215/755 (28%), Positives = 337/755 (44%), Gaps = 102/755 (13%)

Query: 112 ALVNLTHLASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSLGNLTNLTSL 171
           +L NL +L      +  L G IP  +   L  L +LDL   S+SG IP  +  L NL  L
Sbjct: 255 SLGNLKNLQYLFLYQNKLSGPIPPSIFS-LQKLISLDLSDNSLSGEIPELVIQLQNLEIL 313

Query: 172 YLSDNGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIP 231
           +L  N  TG IP +L  L  L VL L  N  +G IP + G   NL+ LD+S+N LTG IP
Sbjct: 314 HLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIP 373

Query: 232 PGLGTLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRGLRSLQKF 291
            GL +   L  L + +NSL   IP  LG   SL  + L  NS SG +PSE   L  +   
Sbjct: 374 EGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFL 433

Query: 292 VIGNNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPL 351
            I NN L G ++   +  +  LQ++ L +N F G  PD   S  +L  LD+SRN F+G +
Sbjct: 434 DISNNNLQGRINSRKW-DMPSLQMLSLARNKFFGGLPDSFGS-KRLENLDLSRNQFSGAV 491

Query: 352 PNSRSNVNTSTVELNISQNMFYGGLTPVLGRFR-LV--DLSGNYFEGRVPEYVHSNA--S 406
           P    ++ +  ++L +S+N   G +   L   + LV  DLS N   G++P         S
Sbjct: 492 PRKLGSL-SELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLS 550

Query: 407 SLDSNCLQ-------NVPNQRTLVDCS--------------SFYA--ARGLSFDNF--GR 441
            LD +  Q       N+ N  +LV  +              +F A  A  ++ +    G 
Sbjct: 551 QLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGG 610

Query: 442 PNATQPPPPETSGDSNRKIIVLSAVLGGFGLIVLLVLLALLALCFCK-------KRTPNQ 494
              +  PP +    +      ++  LG F    L++ L      F +       KR  N+
Sbjct: 611 DTTSGLPPCKRVRKTPSWWFYITCTLGAF----LVLALVAFGFVFIRGRNNLELKRVENE 666

Query: 495 RGVGVGPVPAGSSLPPPGASINFTN--LGESFTYQQLLAATGDFSDANLIKNGHSGDLFR 552
            G                  + F +  + +S T   +L++     + N+I  G  G  ++
Sbjct: 667 DGTW---------------ELQFFDSKVSKSITINDILSSL---KEENVISRGKKGASYK 708

Query: 553 G-ILEGGIPVVIKRI-DLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYK 610
           G  ++ G+  V+K I D+ S+       E+    K+ H  +V L+G C   E   +L+++
Sbjct: 709 GKSIKNGMQFVVKEINDVNSIP----SSEIADMGKLQHPNIVKLIGLC-RSEKGAYLIHE 763

Query: 611 YMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDVQASS 670
           Y+   +LS            L++L W  R KIAIG A+ L +LH  C+   V  ++    
Sbjct: 764 YIEGKNLSEV----------LRNLSWERRRKIAIGIAKALRFLHCRCSPAVVVGNLSPEK 813

Query: 671 ILLDDKFE--VRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSSGSLTATCPYDVYCF 728
           I++D K E  +RL     +C       +  I+     P++ E     +   T   D+Y F
Sbjct: 814 IIIDGKDEPHLRLSLPGLLCTD----TKCFISSAYVAPETRE-----TKDITEKSDIYGF 864

Query: 729 GKVLLELVTGKMGISASSDAQ--VKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLE- 785
           G +L+EL+TGK    + +DA+  V   + +   Y   Y    +   +DPS+  D  + + 
Sbjct: 865 GLILIELLTGK----SPADAEFGVHGSIVEWARY--CYSDCHLDMWIDPSIRGDVSVNQN 918

Query: 786 EVWAMAIVARSCLNPKPTRRPLMRYILKALENPLK 820
           E+  +  +A  C    PT RP    +LK LE+  +
Sbjct: 919 EIVEVMNLALHCTATDPTARPCANDVLKTLESASR 953


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 919
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
KOG3653534 consensus Transforming growth factor beta/activin 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
KOG0201467 consensus Serine/threonine protein kinase [Signal 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.98
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.98
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.98
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.98
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.98
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.98
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.98
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.98
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.98
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.98
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 99.98
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.98
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.98
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.98
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.98
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.98
PTZ00284467 protein kinase; Provisional 99.98
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.98
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.98
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.98
PHA03211461 serine/threonine kinase US3; Provisional 99.98
PHA03212391 serine/threonine kinase US3; Provisional 99.98
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.98
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.98
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.98
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.98
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.98
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.98
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.98
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.98
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.98
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.98
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.98
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.97
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.97
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.97
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.97
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.97
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.97
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.97
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.97
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.97
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.97
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.97
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.97
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.97
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.97
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.97
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.97
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.97
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.97
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.97
PTZ00036440 glycogen synthase kinase; Provisional 99.97
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.97
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.97
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.97
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.97
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.97
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.97
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.97
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.97
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.97
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.97
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.97
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.97
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.97
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.97
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.97
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.97
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.97
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.97
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.97
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.97
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.97
PHA03207392 serine/threonine kinase US3; Provisional 99.97
PHA03209357 serine/threonine kinase US3; Provisional 99.97
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.97
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.97
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.97
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.97
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.97
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.97
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.97
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.97
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.97
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.97
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.97
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.97
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.97
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.97
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.97
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.97
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.97
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.97
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.97
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.97
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.97
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.97
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.97
KOG0589426 consensus Serine/threonine protein kinase [General 99.97
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.97
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.97
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.97
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.97
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.97
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.97
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.97
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.97
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.97
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.97
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.97
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.97
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.97
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.97
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.97
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.97
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.97
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.97
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.97
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.97
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.97
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.97
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.97
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.97
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.97
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.97
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.97
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.97
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.97
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.97
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.97
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.97
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.97
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.97
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.97
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.97
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.97
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.97
KOG0584 632 consensus Serine/threonine protein kinase [General 99.97
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.97
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.97
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.97
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.97
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.97
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.97
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.97
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.97
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.97
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.96
PLN00009294 cyclin-dependent kinase A; Provisional 99.96
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.96
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.96
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.96
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.96
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.96
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.96
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.96
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.96
KOG0605550 consensus NDR and related serine/threonine kinases 99.96
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.96
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.96
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.96
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.96
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.96
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.96
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.96
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.96
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.96
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.96
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.96
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.96
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.96
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.96
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.96
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.96
PHA02882294 putative serine/threonine kinase; Provisional 99.96
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.96
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.96
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.96
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.96
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.96
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.96
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 99.96
PHA03210501 serine/threonine kinase US3; Provisional 99.96
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.96
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.96
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.96
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.96
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.96
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.96
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.95
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.95
KOG0586 596 consensus Serine/threonine protein kinase [General 99.95
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.95
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.95
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.95
PLN03224507 probable serine/threonine protein kinase; Provisio 99.95
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.95
KOG0596677 consensus Dual specificity; serine/threonine and t 99.95
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.95
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.94
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.94
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.94
KOG0610459 consensus Putative serine/threonine protein kinase 99.94
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.94
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.94
KOG0986591 consensus G protein-coupled receptor kinase [Signa 99.94
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.93
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.93
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.93
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.93
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.92
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.92
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.92
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.92
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.92
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.92
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.91
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.91
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.91
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.9
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.9
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.89
KOG1027903 consensus Serine/threonine protein kinase and endo 99.88
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.88
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.87
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.87
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.86
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.86
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.85
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.85
PLN00181 793 protein SPA1-RELATED; Provisional 99.85
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.85
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PLN032101153 Resistant to P. syringae 6; Provisional 99.82
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.81
PRK09188365 serine/threonine protein kinase; Provisional 99.81
KOG1152772 consensus Signal transduction serine/threonine kin 99.81
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.8
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.8
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.8
PLN032101153 Resistant to P. syringae 6; Provisional 99.78
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.78
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.77
KOG1167418 consensus Serine/threonine protein kinase of the C 99.77
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.77
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.76
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.73
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.72
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.72
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.71
KOG4237498 consensus Extracellular matrix protein slit, conta 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
PRK10345210 hypothetical protein; Provisional 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
PRK12274218 serine/threonine protein kinase; Provisional 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
PRK14879211 serine/threonine protein kinase; Provisional 99.65
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.64
smart00090237 RIO RIO-like kinase. 99.64
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.64
PLN03150623 hypothetical protein; Provisional 99.63
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.62
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.62
KOG4237498 consensus Extracellular matrix protein slit, conta 99.61
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.54
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.53
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.52
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.5
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.47
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.47
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.44
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.4
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.4
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.37
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.36
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.32
KOG1266458 consensus Protein kinase [Signal transduction mech 99.31
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.31
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.24
PLN03150623 hypothetical protein; Provisional 99.23
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.21
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.17
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.11
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.92
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.9
KOG0590 601 consensus Checkpoint kinase and related serine/thr 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
KOG1243 690 consensus Protein kinase [General function predict 98.76
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.69
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.67
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.61
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.57
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.54
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.54
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.53
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.5
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.44
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.42
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG3087229 consensus Serine/threonine protein kinase [General 98.31
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.28
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.19
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 98.16
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.05
KOG06061205 consensus Microtubule-associated serine/threonine 98.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.98
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 97.96
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 97.89
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.89
COG0661517 AarF Predicted unusual protein kinase [General fun 97.8
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.79
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.1e-81  Score=793.33  Aligned_cols=722  Identities=28%  Similarity=0.431  Sum_probs=429.8

Q ss_pred             CCHHHHHHHHHHHHhCCCC---CCCCCCCCCCCCCCCCeeec-CCCEEEEEcCCCcccCCCCCCCccChhhhcCCCCCCE
Q 002462           46 SSRTELAALFELRSSLGLR---RRDWPRKVDPCLVWNGVRCQ-NGSVVGINISGFRRTRLGSQNPRFAADALVNLTHLAS  121 (919)
Q Consensus        46 ~~~~e~~aLl~~k~~l~~~---~~~W~~~~~~C~~W~gv~C~-~~~v~~l~l~~~~~~~~g~~~~~~~~~~l~~L~~L~~  121 (919)
                      ..++|+.||++||+++...   ..+|+...+ ||.|.||+|+ .++|+.+++++....  |.++     ..+..+++|+.
T Consensus        26 ~~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~-~c~w~gv~c~~~~~v~~L~L~~~~i~--~~~~-----~~~~~l~~L~~   97 (968)
T PLN00113         26 LHAEELELLLSFKSSINDPLKYLSNWNSSAD-VCLWQGITCNNSSRVVSIDLSGKNIS--GKIS-----SAIFRLPYIQT   97 (968)
T ss_pred             CCHHHHHHHHHHHHhCCCCcccCCCCCCCCC-CCcCcceecCCCCcEEEEEecCCCcc--ccCC-----hHHhCCCCCCE
Confidence            3668999999999999642   478976555 5599999997 579999999875432  2222     23444555555


Q ss_pred             EecCCCCCCCCCchhhhhC----------------------CCCCcEEEeecCCCCccCCcCCCCCCCCCEEEeeCCCCC
Q 002462          122 FNASRFLLPGSIPDWLGQQ----------------------LPTLQALDLRSCSISGVIPFSLGNLTNLTSLYLSDNGLT  179 (919)
Q Consensus       122 l~ls~n~l~g~ip~~~~~~----------------------L~~L~~LdLs~N~l~g~~p~~~~~l~~L~~L~Ls~N~l~  179 (919)
                      |++++|.+.|.+|..++..                      +++|++|+|++|.+++.+|..++++++|++|+|++|.+.
T Consensus        98 L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~  177 (968)
T PLN00113         98 INLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLV  177 (968)
T ss_pred             EECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCccc
Confidence            5555555555555444322                      344444444444444555556666666666666666666


Q ss_pred             CCCcccccCCCCCCEEEccCCcCCCCCCccccCCCCCCEEeccCCcCCCCCCcccCCCCCCCEEEccCCCCCCCCccccC
Q 002462          180 GTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLGTLSKLQYLNVSNNSLASSIPAQLG  259 (919)
Q Consensus       180 g~~p~~l~~L~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~g~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~  259 (919)
                      +.+|..++++++|++|+|++|++++.+|..|+++++|+.|+|++|.+++.+|..++++++|++|+|++|++++.+|..++
T Consensus       178 ~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~  257 (968)
T PLN00113        178 GKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG  257 (968)
T ss_pred             ccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHh
Confidence            66666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             CCCCCCEEEcCCCCCCCCCchhhhccccCCEEEccCCcCCCCCCCcc-----------------------cCCCCCCCEE
Q 002462          260 DLDSLVDLDLSMNSLSGSVPSELRGLRSLQKFVIGNNFLSGNLSVNL-----------------------FPTVSQLQII  316 (919)
Q Consensus       260 ~l~~L~~L~Ls~N~l~g~~p~~l~~l~~L~~L~ls~N~l~g~i~~~~-----------------------~~~l~~L~~L  316 (919)
                      ++++|++|+|++|++.+.+|..+.++++|+.|++++|.+.+.+|..+                       +..+++|+.|
T Consensus       258 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L  337 (968)
T PLN00113        258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVL  337 (968)
T ss_pred             CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEE
Confidence            66666666666666555555555555555555555555554443321                       2455666777


Q ss_pred             EccCCCCCCCCccccCCCCCCCEEEccCCCCCCCCCcccc----------------------------------------
Q 002462          317 VLRQNGFTGPPPDVLWSMPQLRLLDISRNNFTGPLPNSRS----------------------------------------  356 (919)
Q Consensus       317 ~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~----------------------------------------  356 (919)
                      +|++|.+++.+|..++.+++|+.|+|++|++++.+|....                                        
T Consensus       338 ~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~  417 (968)
T PLN00113        338 QLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFS  417 (968)
T ss_pred             ECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEee
Confidence            7777766666665555555555555555444433321100                                        


Q ss_pred             -------c------------------------CC-----------------------CCCcEEEccCCcCc---------
Q 002462          357 -------N------------------------VN-----------------------TSTVELNISQNMFY---------  373 (919)
Q Consensus       357 -------~------------------------~~-----------------------~~l~~L~ls~N~~~---------  373 (919)
                             .                        ..                       .+|+.|++++|.+.         
T Consensus       418 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~  497 (968)
T PLN00113        418 GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGS  497 (968)
T ss_pred             eECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhh
Confidence                   0                        00                       11223333333333         


Q ss_pred             ---------------cCCCC---CCCCCcEEEccCCcCCCcCCccccc--cc--CCCCcccCCCCCCC-C---------c
Q 002462          374 ---------------GGLTP---VLGRFRLVDLSGNYFEGRVPEYVHS--NA--SSLDSNCLQNVPNQ-R---------T  421 (919)
Q Consensus       374 ---------------g~~~~---~l~~L~~ldLs~N~l~g~ip~~~~~--~~--~~l~~n~l~~~~~~-~---------~  421 (919)
                                     +.+|.   .+.+|+.|+|++|.++|.+|..+..  ++  -.+++|.+.+.... .         .
T Consensus       498 l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~  577 (968)
T PLN00113        498 LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVN  577 (968)
T ss_pred             hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEe
Confidence                           33332   2356778888888888888876531  11  13455555432110 0         0


Q ss_pred             ccccc-----------------cccccCCCccCCCCCCCCCCCCCCCCCCCCcceeeeeeeehhhHHHHHHHHHHHHHHH
Q 002462          422 LVDCS-----------------SFYAARGLSFDNFGRPNATQPPPPETSGDSNRKIIVLSAVLGGFGLIVLLVLLALLAL  484 (919)
Q Consensus       422 ~~~c~-----------------~~~~~~~l~~~~~~~p~~~~p~~~~~~~~~~~~~~i~~~v~~~~~~~~~~~~~~~~~~  484 (919)
                      ...|.                 .+.++.++|...   +....+++.. ..+.....++++++++   +++++++++++++
T Consensus       578 ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~---~~~~~~~c~~-~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~  650 (968)
T PLN00113        578 ISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD---TTSGLPPCKR-VRKTPSWWFYITCTLG---AFLVLALVAFGFV  650 (968)
T ss_pred             ccCCcceeeCCCcchhcccChhhhcCCccccCCc---cccCCCCCcc-ccccceeeeehhHHHH---HHHHHHHHHHHHH
Confidence            00110                 111111111100   0000111111 1111122222222222   2222222222222


Q ss_pred             hhhcccCCCCCCCCCCcCCCCCCCCCCCCccccccCCcccCHHHHHHHhCCCCcccccccCCCCcEEEEEe-cCCccEEE
Q 002462          485 CFCKKRTPNQRGVGVGPVPAGSSLPPPGASINFTNLGESFTYQQLLAATGDFSDANLIKNGHSGDLFRGIL-EGGIPVVI  563 (919)
Q Consensus       485 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~at~~f~~~~~ig~G~~G~Vy~g~l-~~g~~vav  563 (919)
                      ++++|+....+....   ..+.    .............++++++..   .|.+.++||+|+||.||+|+. .+|..|||
T Consensus       651 ~~~~~~~~~~~~~~~---~~~~----~~~~~~~~~~~~~~~~~~~~~---~~~~~~~ig~G~~g~Vy~~~~~~~~~~vav  720 (968)
T PLN00113        651 FIRGRNNLELKRVEN---EDGT----WELQFFDSKVSKSITINDILS---SLKEENVISRGKKGASYKGKSIKNGMQFVV  720 (968)
T ss_pred             HHHhhhccccccccc---cccc----ccccccccccchhhhHHHHHh---hCCcccEEccCCCeeEEEEEECCCCcEEEE
Confidence            222222111110000   0000    000000011123466666654   467788999999999999996 67899999


Q ss_pred             EEeccccccHHHHHHHHHHHhhcCCCCccceeeEEeecCCcEEEEEEecCCCChhhhhhccCCCCCccCCCCHHHHHHHH
Q 002462          564 KRIDLQSVKTEAYLLELDFFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIA  643 (919)
Q Consensus       564 K~l~~~~~~~~~f~~Ei~~l~~l~H~niV~l~g~c~~~~~~~~lV~Ey~~~GsL~~~L~~~~~~~~~~~~l~w~~rl~Ia  643 (919)
                      |+++.....   ...|++++++++|||||+++|+|.+. +..++|||||++|+|.++++          .++|.++.+||
T Consensus       721 K~~~~~~~~---~~~~~~~l~~l~HpnIv~~~~~~~~~-~~~~lv~Ey~~~g~L~~~l~----------~l~~~~~~~i~  786 (968)
T PLN00113        721 KEINDVNSI---PSSEIADMGKLQHPNIVKLIGLCRSE-KGAYLIHEYIEGKNLSEVLR----------NLSWERRRKIA  786 (968)
T ss_pred             EEccCCccc---cHHHHHHHhhCCCCCcceEEEEEEcC-CCCEEEEeCCCCCcHHHHHh----------cCCHHHHHHHH
Confidence            998643322   23568999999999999999999764 57899999999999999984          27899999999


Q ss_pred             HHHHHHhhhhhcCCCCCeeeccCCCCceecCCCCceeeCCcchhhhcCCCCcceeeeeeccCCCCccccCCCCCCCCCCC
Q 002462          644 IGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSSGSLTATCPY  723 (919)
Q Consensus       644 ~~iA~gL~yLH~~~~~~ivHrDlK~~NILld~~~~~kl~dfg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~  723 (919)
                      .|+|+||+|||+.+.++||||||||+||++|.++.+++. |+..........      ..+++.|.+++......++.|+
T Consensus       787 ~~ia~~L~yLH~~~~~~iiH~dlkp~Nil~~~~~~~~~~-~~~~~~~~~~~~------~~~t~~y~aPE~~~~~~~~~~s  859 (968)
T PLN00113        787 IGIAKALRFLHCRCSPAVVVGNLSPEKIIIDGKDEPHLR-LSLPGLLCTDTK------CFISSAYVAPETRETKDITEKS  859 (968)
T ss_pred             HHHHHHHHHhccCCCCCeecCCCCHHhEEECCCCceEEE-eccccccccCCC------ccccccccCcccccCCCCCccc
Confidence            999999999999888999999999999999999988875 443322211111      1223344455555555788999


Q ss_pred             cchhHHHHHHHHHcCCCCCCCCCh--hHHHHHHHhhcccccccccccccccccCCCCCC-cchHHHHHHHHHHHHHccCC
Q 002462          724 DVYCFGKVLLELVTGKMGISASSD--AQVKEILEQTLPYISIYDKELVTKIVDPSLIID-EDLLEEVWAMAIVARSCLNP  800 (919)
Q Consensus       724 DVySfGvvLlEllTGk~p~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~i~d~~l~~~-~~~~~~~~~~~~la~~C~~~  800 (919)
                      |||||||++|||+||+.|++....  ....+|+....      .......++||.+... +...+++.++.+++.+||+.
T Consensus       860 Dv~S~Gvvl~el~tg~~p~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Cl~~  933 (968)
T PLN00113        860 DIYGFGLILIELLTGKSPADAEFGVHGSIVEWARYCY------SDCHLDMWIDPSIRGDVSVNQNEIVEVMNLALHCTAT  933 (968)
T ss_pred             chhhHHHHHHHHHhCCCCCCcccCCCCcHHHHHHHhc------CccchhheeCccccCCCCccHHHHHHHHHHHHhhCcC
Confidence            999999999999999999865322  23444443322      1123445566655322 22345667788999999999


Q ss_pred             CCCCCCCHHHHHHHhhccc
Q 002462          801 KPTRRPLMRYILKALENPL  819 (919)
Q Consensus       801 ~P~~RPsm~~V~~~L~~~~  819 (919)
                      +|++||+|+||+++|+...
T Consensus       934 ~P~~RPt~~evl~~L~~~~  952 (968)
T PLN00113        934 DPTARPCANDVLKTLESAS  952 (968)
T ss_pred             CchhCcCHHHHHHHHHHhh
Confidence            9999999999999998654



>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query919
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 5e-29
3uim_A326 Structural Basis For The Impact Of Phosphorylation 1e-28
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 3e-25
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 3e-25
2nry_A307 Crystal Structure Of Irak-4 Length = 307 8e-19
2nru_A307 Crystal Structure Of Irak-4 Length = 307 1e-18
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 1e-18
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 6e-17
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-13
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-13
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 3e-12
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 5e-12
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 7e-12
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 7e-12
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 7e-12
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 8e-12
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 9e-12
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 9e-12
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 9e-12
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 1e-11
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 1e-11
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 1e-11
2pl0_A289 Lck Bound To Imatinib Length = 289 1e-11
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 2e-11
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 3e-10
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 4e-10
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 7e-10
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 1e-09
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 2e-09
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 2e-09
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 3e-09
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 3e-09
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 3e-09
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 3e-09
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 3e-09
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 3e-09
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 3e-09
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 3e-09
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 3e-09
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 3e-09
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 3e-09
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 3e-09
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 4e-09
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 4e-09
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 5e-09
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 5e-09
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 5e-09
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 5e-09
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 7e-09
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-08
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-08
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-08
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 5e-08
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 6e-08
2g15_A318 Structural Characterization Of Autoinhibited C-Met 6e-08
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 6e-08
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 6e-08
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 6e-08
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 6e-08
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 7e-08
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 7e-08
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 7e-08
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 8e-08
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 8e-08
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 8e-08
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 9e-08
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 9e-08
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 9e-08
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 9e-08
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 9e-08
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 9e-08
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 1e-07
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 1e-07
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 1e-07
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 1e-07
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 1e-07
4h58_A275 Braf In Complex With Compound 3 Length = 275 1e-07
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-07
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-07
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 1e-07
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 2e-07
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 2e-07
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 2e-07
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 2e-07
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 2e-07
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 2e-07
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 2e-07
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 3e-07
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 3e-07
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 4e-07
3a4o_X286 Lyn Kinase Domain Length = 286 5e-07
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 5e-07
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 5e-07
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 6e-07
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 6e-07
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 6e-07
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 6e-07
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 6e-07
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 6e-07
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-07
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-06
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 6e-07
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 7e-07
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 9e-07
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 1e-06
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 2e-06
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 2e-06
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-06
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 2e-06
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 3e-06
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 3e-06
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 3e-06
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 3e-06
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 3e-06
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 3e-06
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 3e-06
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 3e-06
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 3e-06
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 3e-06
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 4e-06
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 4e-06
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 4e-06
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 4e-06
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 4e-06
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 4e-06
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 5e-06
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 5e-06
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 6e-06
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 6e-06
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 7e-06
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 8e-06
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 9e-06
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 1e-05
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 1e-05
3kmu_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 2e-05
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 2e-05
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 2e-05
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 2e-05
1fvr_A327 Tie2 Kinase Domain Length = 327 2e-05
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-05
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 3e-05
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 3e-05
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 3e-05
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 3e-05
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 4e-05
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 6e-05
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 6e-05
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 8e-05
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 1e-04
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 1e-04
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 1e-04
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 1e-04
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 1e-04
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 1e-04
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-04
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-04
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 2e-04
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 2e-04
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-04
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 2e-04
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-04
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-04
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 2e-04
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 3e-04
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-04
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 3e-04
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 4e-04
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 4e-04
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 4e-04
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 4e-04
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 4e-04
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 4e-04
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 4e-04
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 4e-04
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-04
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 4e-04
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 4e-04
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 4e-04
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 4e-04
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 5e-04
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 5e-04
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 5e-04
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 5e-04
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 5e-04
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 5e-04
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 5e-04
3lxn_A318 Structural And Thermodynamic Characterization Of Th 6e-04
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 6e-04
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 6e-04
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 7e-04
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 7e-04
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 7e-04
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 7e-04
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 7e-04
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 8e-04
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 8e-04
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 8e-04
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 8e-04
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 9e-04
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 9e-04
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 9e-04
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 9e-04
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 9e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 126 bits (317), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 94/306 (30%), Positives = 152/306 (49%), Gaps = 31/306 (10%) Query: 524 FTYQQLLAATGDFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEA--YLLELD 581 F+ ++L A+ +FS+ N++ G G +++G L G V +KR+ + + + E++ Sbjct: 28 FSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQGGELQFQTEVE 87 Query: 582 FFSKVSHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLK 641 S H L+ L G CM E+ LVY YM NG ++S L + ++ LDW R + Sbjct: 88 MISMAVHRNLLRLRGFCMT-PTERLLVYPYMANGSVASCLRERPESQ---PPLDWPKRQR 143 Query: 642 IAIGAAEGLSYLHHECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITR 701 IA+G+A GL+YLH C +HRDV+A++ILLD++FE +G A+ D + Sbjct: 144 IALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFG--LAKLMDYKDXHVXX 201 Query: 702 LLR------LPQSSEQGSSGSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILE 755 +R P+ G S T DV+ +G +LLEL+TG+ + A +++ Sbjct: 202 AVRGTIGHIAPEYLSTGKSSEKT-----DVFGYGVMLLELITGQRAFDLARLANDDDVM- 255 Query: 756 QTLPYISIYDKELVTKIVDPSLIIDEDLL-----EEVWAMAIVARSCLNPKPTRRPLMRY 810 L ++ KE K+ ++D DL EEV + VA C P RP M Sbjct: 256 -LLDWVKGLLKE--KKL---EALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSE 309 Query: 811 ILKALE 816 +++ LE Sbjct: 310 VVRMLE 315
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3KMU|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Apo) Length = 271 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query919
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-78
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-75
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-70
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-70
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-69
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-63
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-50
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-45
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-05
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 4e-69
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 8e-66
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 9e-61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-49
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-48
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-43
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-45
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-42
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-38
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-43
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-29
3soc_A322 Activin receptor type-2A; structural genomics cons 6e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-38
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-38
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-35
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-34
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-34
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-28
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-33
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-32
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-31
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-30
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-30
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-32
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-27
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-31
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-31
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-30
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-30
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 4e-30
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-08
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 4e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-20
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 2e-28
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-28
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-21
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 4e-28
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 9e-28
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-27
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-26
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-27
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-19
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-27
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 1e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-26
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-26
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-23
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-22
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 3e-25
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-24
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-24
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-23
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-23
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 2e-23
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 4e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 7e-23
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-23
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-15
3q4u_A301 Activin receptor type-1; structural genomics conso 1e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-22
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-12
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 4e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-14
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 8e-15
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
3pls_A298 Macrophage-stimulating protein receptor; protein k 5e-14
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 9e-14
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-13
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-13
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-13
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 1e-13
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 3e-13
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 5e-13
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 6e-13
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 6e-13
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-10
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-12
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 2e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-11
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 5e-12
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-12
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 5e-12
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 7e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-10
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-11
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-11
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-04
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 5e-11
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 6e-11
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 6e-11
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 6e-11
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 8e-11
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 9e-11
3lzb_A327 Epidermal growth factor receptor; epidermal growth 1e-10
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-10
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-10
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-10
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-10
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-10
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 3e-10
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 4e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 5e-10
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 6e-10
2a19_B284 Interferon-induced, double-stranded RNA-activated 7e-10
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 7e-10
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 9e-10
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 9e-10
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-06
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 1e-09
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 1e-09
3poz_A327 Epidermal growth factor receptor; kinase domain, a 1e-09
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 2e-09
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-09
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 3e-09
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 4e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 5e-09
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 6e-09
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 7e-09
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 7e-09
2xir_A316 Vascular endothelial growth factor receptor 2; ang 8e-09
3eqc_A360 Dual specificity mitogen-activated protein kinase; 8e-09
4aoj_A329 High affinity nerve growth factor receptor; transf 8e-09
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 8e-09
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 9e-09
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-08
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-08
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 3e-08
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 8e-08
2dyl_A318 Dual specificity mitogen-activated protein kinase 8e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-05
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-07
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 1e-07
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-07
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 2e-07
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-07
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-07
3aln_A327 Dual specificity mitogen-activated protein kinase; 3e-07
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 4e-07
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 4e-07
3fme_A290 Dual specificity mitogen-activated protein kinase; 5e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 9e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-06
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 9e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-05
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 1e-05
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-05
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-04
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 1e-04
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 2e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 6e-04
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 4e-04
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  270 bits (693), Expect = 1e-78
 Identities = 109/420 (25%), Positives = 169/420 (40%), Gaps = 65/420 (15%)

Query: 46  SSRTELAALFELRSSL--GLRRRDWPRKVDPCLVWNGVRCQNGSVVGINISGFR-RTRLG 102
           S   E+  L   +  L       DW    +PC  ++GV C++  V  I++S         
Sbjct: 9   SLYREIHQLISFKDVLPDKNLLPDWSSNKNPCT-FDGVTCRDDKVTSIDLSSKPLNVGFS 67

Query: 103 SQNPRF--------------------------------------------AADALVNLTH 118
           + +                                                  +L + + 
Sbjct: 68  AVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSG 127

Query: 119 LASFNASRFLLPGSIPDWLGQQLPTLQALDLRSCSISGVIPFSL---GNLTNLTSLYLSD 175
           L   N S   L        G +L +L+ LDL + SISG              L  L +S 
Sbjct: 128 LKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISG 187

Query: 176 NGLTGTIPSSLGQLSVLSVLDLSRNSLTGNIPTSFGLLKNLSSLDISSNYLTGSIPPGLG 235
           N ++G +   + +   L  LD+S N+ +  IP   G    L  LDIS N L+G     + 
Sbjct: 188 NKISGDVD--VSRCVNLEFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFSRAIS 244

Query: 236 TLSKLQYLNVSNNSLASSIPAQLGDLDSLVDLDLSMNSLSGSVPSELRG-LRSLQKFVIG 294
           T ++L+ LN+S+N     IP     L SL  L L+ N  +G +P  L G   +L    + 
Sbjct: 245 TCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLS 302

Query: 295 NNFLSGNLSVNLFPTVSQLQIIVLRQNGFTGP-PPDVLWSMPQLRLLDISRNNFTGPLPN 353
            N   G +      + S L+ + L  N F+G  P D L  M  L++LD+S N F+G LP 
Sbjct: 303 GNHFYGAVPPFFG-SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE 361

Query: 354 SRSNVNTSTVELNISQNMFYGGLTPVLGRFRL-----VDLSGNYFEGRVPEYVHSNASSL 408
           S +N++ S + L++S N F G + P L +        + L  N F G++P  + SN S L
Sbjct: 362 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL-SNCSEL 420


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 919
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-37
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 4e-37
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-36
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-35
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-34
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-33
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-33
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 3e-32
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 9e-32
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-31
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-31
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 7e-31
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 7e-31
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 4e-30
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 5e-30
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 8e-30
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-29
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 7e-29
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 7e-29
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-28
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-27
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-27
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-26
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-26
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 4e-26
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-26
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 6e-26
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-25
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-25
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-25
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-25
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-25
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 5e-25
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-24
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-24
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 3e-24
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 4e-24
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-19
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-22
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-22
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-21
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-20
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 4e-20
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-19
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-19
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 4e-19
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 7e-19
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 9e-19
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-18
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 6e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-04
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 7e-18
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-17
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-17
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-17
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-16
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-16
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 8e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-10
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 3e-15
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 4e-12
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 6e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 1e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-08
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 7e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 3e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Lymphocyte kinase (lck)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  139 bits (352), Expect = 1e-37
 Identities = 58/286 (20%), Positives = 117/286 (40%), Gaps = 32/286 (11%)

Query: 535 DFSDANLIKNGHSGDLFRGILEGGIPVVIKRIDLQSVKTEAYLLELDFFSKVSHARLVPL 594
                  +  G  G+++ G   G   V +K +   S+  +A+L E +   ++ H RLV L
Sbjct: 14  TLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRL 73

Query: 595 LGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLH 654
                  +   +++ +YM NG L   L   +        L     L +A   AEG++++ 
Sbjct: 74  YAVVT--QEPIYIITEYMENGSLVDFLKTPSG-----IKLTINKLLDMAAQIAEGMAFIE 126

Query: 655 HECTLPFVHRDVQASSILLDDKFEVRLGSLSEVCAQGGDAHQSRITRLLRLPQSSEQGSS 714
                 ++HRD++A++IL+ D    ++           + + +R      +  ++ +  +
Sbjct: 127 ERN---YIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAIN 183

Query: 715 GSLTATCPYDVYCFGKVLLELVTGKMGISASSDAQVKEILEQTLPYISIYDKELVTKIV- 773
              T T   DV+ FG +L E+VT                    +PY  + + E++  +  
Sbjct: 184 YG-TFTIKSDVWSFGILLTEIVTHG-----------------RIPYPGMTNPEVIQNLER 225

Query: 774 DPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPL 819
              ++  ++  EE++    + R C   +P  RP   Y+   LE+  
Sbjct: 226 GYRMVRPDNCPEELYQ---LMRLCWKERPEDRPTFDYLRSVLEDFF 268


>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query919
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.98
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.98
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.97
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.97
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.94
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.91
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.9
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.89
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.89
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.89
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.88
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.88
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.87
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.86
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.85
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.85
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.74
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.73
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.71
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.69
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.67
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.67
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.57
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.52
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.51
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.64
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.08
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.94
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 97.9
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.49
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.3
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 95.32
d1cjaa_342 Actin-fragmin kinase, catalytic domain {Physarum p 89.07
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=0  Score=379.71  Aligned_cols=269  Identities=21%  Similarity=0.330  Sum_probs=208.2

Q ss_pred             CCCCHHHHHHHHCCCCC---------CCCCCCCCCCCEEEEEECC-C---CCEEEEEECCCCC--CHHHHHHHHHHHHHC
Q ss_conf             65579999998399983---------2333458888489999549-9---6189999515531--089999999998616
Q 002462          522 ESFTYQQLLAATGDFSD---------ANLIKNGHSGDLFRGILEG-G---IPVVIKRIDLQSV--KTEAYLLELDFFSKV  586 (919)
Q Consensus       522 ~~~~~~~l~~~t~~f~~---------~~~ig~G~~G~Vy~g~l~~-g---~~vavK~l~~~~~--~~~~f~~Ei~~l~~l  586 (919)
                      ..+||+++.+++.+|+.         .++||+|+||.||+|.... +   ..||||++.....  ..++|.+|+++|+++
T Consensus         5 d~~t~~d~~~a~~~f~~~i~~~~~~~~~~lG~G~fg~Vy~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~~l~~l   84 (299)
T d1jpaa_           5 DPFTFEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQF   84 (299)
T ss_dssp             CGGGSSSHHHHHHHHSCBCCGGGEEEEEEEEECSSSEEEEEEECC---CCEEEEEEECCSSCCHHHHHHHHHHHHHHTTC
T ss_pred             CCCCHHHHHHHHHHHCHHHCHHHCEEEEEEEECCCEEEEEEEEECCCCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHC
T ss_conf             98887989999960462208004278569802788299999995799788999999978445989999999999999857


Q ss_pred             CCCCCCCEEEEEEECCCCEEEEEEECCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEECCC
Q ss_conf             99984136558860488179999722799810010006999775677799999999999999855451289999264468
Q 002462          587 SHARLVPLLGHCMERENEKFLVYKYMPNGDLSSSLYRKTNTEDDLQSLDWITRLKIAIGAAEGLSYLHHECTLPFVHRDV  666 (919)
Q Consensus       587 ~H~NiV~l~g~c~~~~~~~~LV~Ey~~~GsL~~~L~~~~~~~~~~~~l~w~~rl~Ia~~iA~gL~yLH~~~~~~IiHrDl  666 (919)
                      +|||||+++|+|.+ ++..++|||||++|+|.+++....      ..++|.++++|+.|+|+||+|||+.   +||||||
T Consensus        85 ~HpnIv~l~g~~~~-~~~~~iv~Ey~~~g~L~~~~~~~~------~~l~~~~~~~i~~qia~gl~yLH~~---~iiHrDl  154 (299)
T d1jpaa_          85 DHPNVIHLEGVVTK-STPVMIITEFMENGSLDSFLRQND------GQFTVIQLVGMLRGIAAGMKYLADM---NYVHRDL  154 (299)
T ss_dssp             CCTTBCCEEEEECS-SSSCEEEEECCTTEEHHHHHHTTT------TCSCHHHHHHHHHHHHHHHHHHHHT---TCCCSCC
T ss_pred             CCCCCCCEEEEEEE-CCEEEEEEEECCCCCCEEEECCCC------CCCCHHHHHHHHHHHHHHHHHHHHC---CCCCCCC
T ss_conf             99888618999962-887799997227985300210456------7999999999999999988988527---9835761


Q ss_pred             CCCCEECCCCCCEEECCCCHHHHCCCCCCCEE---EEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHC-CCCCC
Q ss_conf             89960017999622488500240389985103---552025777754567787799977860348999999990-99999
Q 002462          667 QASSILLDDKFEVRLGSLSEVCAQGGDAHQSR---ITRLLRLPQSSEQGSSGSLTATCPYDVYCFGKVLLELVT-GKMGI  742 (919)
Q Consensus       667 K~~NILld~~~~~ki~dfg~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~t~~sDVySfGvvLlEllT-G~~p~  742 (919)
                      ||+|||+|.++.+||+|||.++..........   .....+++.+++|+......++.++|||||||++|||+| |+.||
T Consensus       155 Kp~NILl~~~~~~Kl~DFGla~~~~~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~sDvwS~Gvvl~el~t~g~~Pf  234 (299)
T d1jpaa_         155 AARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPY  234 (299)
T ss_dssp             CGGGEEECTTCCEEECCC-----------------------CGGGSCHHHHHSCCCCHHHHHHHHHHHHHHHHTTSCCTT
T ss_pred             CCCEEEECCCCCEEECCCCCCEECCCCCCCCEEEECCCCCCCCCCCCHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCC
T ss_conf             50448988999199888443157567777653650256668830038788836997861214453578999986799999


Q ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             899946899999841233111232220110268888890069999999999987159999999998999999202323
Q 002462          743 SASSDAQVKEILEQTLPYISIYDKELVTKIVDPSLIIDEDLLEEVWAMAIVARSCLNPKPTRRPLMRYILKALENPLK  820 (919)
Q Consensus       743 ~~~~~~~~~~~~~~~~p~~~~~~~~~~~~i~d~~l~~~~~~~~~~~~~~~l~~~Cl~~~P~~RPsm~~v~~~L~~~~~  820 (919)
                      ......+....+.....                 +.......++   +..++..||+.+|++||+|++|++.|+..++
T Consensus       235 ~~~~~~~~~~~i~~~~~-----------------~~~~~~~~~~---l~~li~~cl~~~P~~RPs~~ei~~~L~~~l~  292 (299)
T d1jpaa_         235 WDMTNQDVINAIEQDYR-----------------LPPPMDCPSA---LHQLMLDCWQKDRNHRPKFGQIVNTLDKMIR  292 (299)
T ss_dssp             TTCCHHHHHHHHHTTCC-----------------CCCCTTCCHH---HHHHHHHHTCSSTTTSCCHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHCCCC-----------------CCCCCCCHHH---HHHHHHHHCCCCHHHCCCHHHHHHHHHHHHC
T ss_conf             99999999999973788-----------------9997422699---9999999758797689299999999999841



>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1cjaa_ d.144.1.3 (A:) Actin-fragmin kinase, catalytic domain {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure