Citrus Sinensis ID: 002539


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-
MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVEGSQSSGFHPNSYQMPSQTADTSLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRSRPRSQVITMSLCMLLQHEYKISSVVGRVGKIS
ccccccccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccEEEEEcHHHHHHccccccEEEccccccHHHHHHHcccccEEEEEEEEEcccccccHHHHHccccccccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccEEEEEEccccccccccccccEEEEEccccccEEEEEccccEEEccccccccccEEEEEcccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHcHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcHHHHcccccccc
cccHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccEEEEEccEEEEEEEccccccEEcccccccHHHHHHHccccEEEEEEEEEcccccccHHHHHHHHHccccccEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccEEEccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEccccccccccccccEEEEEcccEccHHEEcccEEEEEccccccccEEEEEEEcccEEcccEEEEEEccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccEEEccEEEccEEEccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
madsrrfaLGNQLDIEQILIEAQHRWLRPAEICEILRNYtkfriapesphtppsgslflfdRKVLRYFRkdghnwrkkkdgktVKEAHERLKAGSVDVLHCYYahgeenenfQRRSYWMLEEELSHIVLVHYRevkgnrtnfnrakvaegatpysqeneetipnsevegsqssgfhpnsyqmpsqtadtslnsaqaseyedaesvynnqassrfhsfldlQQPVAEKidagladpyypssltnnyqgkfsvvpgadfispaqtdksrnsndtgltyepqknldfpswEDVLQNcsqgvgsqpealgdipnqgydilgepftnsfgerkefgshlqtrgewqasrndsshlsnwpmdqkvyldsahdltsqsceqgaahdglldslrpphahpnmendvheqlpnaehghllksdpessltidgksfYSSAIKQHLIDGSTEGLKKLDSFNRWMSKElgdvkesnmqsssgaywetvesengvddsgvspqarldtymmspslsqdqlysiidfspnwayvSSEVKVLITGRFLMSQqeaenckwscmfgeievpaeIVAGGVlrchtssqkvgrvpfyvtcsnrlscsevrefeyrashipdvdvadncgditsenLRMQFGKLLCltsvstpnydpsnlsdisQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKaaeggkgpcvldhcgqGVLHFAAALgydwalepttvagvninfrdvngwTALHWAAYCGRERTVASLIALgaapgalsdptpkypsgrtpadlassighkgiAGYLAESDLSSALSAISlnkkdgdvaevtgatavqtvpqrcptpvsdgdlpyglsmKDSLAAVRNATQAAARIHQVFRSRPRSQVITMSLCMLLQHEykissvvgrvgkis
madsrrfalgnqLDIEQILIEaqhrwlrpAEICEILRNYTKFRiapesphtppsgslflfDRKVLRYfrkdghnwrkkkdgktvkeaherlkagsvdvLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYrevkgnrtnfnrakvaegatpysqeneeTIPNSEVEGSQSSGFHPNSYQMPSQTADTSLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFIspaqtdksrnsndTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKElgdvkesnmqSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTssqkvgrvpfyvTCSNRLSCSEVREFEYrashipdvdvaDNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAeekfsseeVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTGatavqtvpqrcptpvsDGDLPYGLSMKDSLAAVRNATQAAARIhqvfrsrprsqVITMSLCMllqheykissvvgrvgkis
MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVEGSQSSGFHPNSYQMPSQTADTSLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAeekfsseevkeklvqkllkeklqvwlvqkAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYlaesdlssalsaislNKKDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLaavrnatqaaaRIHQVFRSRPRSQVITMSLCMLLQHEYKISSVVGRVGKIS
******FALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIA**********SLFLFDRKVLRYFRKDGHNWRK***********ERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNF*************************************************************************SFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADF****************************SWEDVLQNC****************QGYDILGE************************************************************************************************************Y**AIKQHLI********************************************************************DQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVST***************************DWDLMLKLT***********EKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAA***************************GIAGYLA**********************VTGATAV*****************YGL****SLAAVRNATQAAARIHQVFRSRPRSQVITMSLCMLLQHEYKISSVVGR*****
**********NQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAP****TPPSGSLFLFDRKVLRYFRKDGHNWRKKK*****KEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGN************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************IDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVS**************LNSKISSLLKDENDDWDLM************EVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESD********************TGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQ**********************YKISSVVGRVG***
MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHN*************HERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGA***********************FHPNSY***********************SVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKE*******************HLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKELGDV*************************GVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRSRPRSQVITMSLCMLLQHEYKISSVVGRVGKIS
*****RFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGN****NRAKVAE*********EETIPNSE*EGSQSSGFH***********************EDAESVYNNQASSRFHSFLD*QQP*************************************************************************************************************************************************************************************************************************EGLKKLDSFNRWMSKELGDVKE***********************************MSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQ**SKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISL******************************DLPYGLSMKDSLAAVRNATQAAARIHQVFRSRPRSQVITMSLCMLLQHEYKISSVVGRVGK**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVEGSQSSGFHPNSYQMPSQTADTSLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVVPGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLIDGSTEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRSRPRSQVITMSLCMLLQHEYKISSVVGRVGKIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query911 2.2.26 [Sep-21-2011]
Q8GSA7 1032 Calmodulin-binding transc yes no 0.867 0.765 0.494 0.0
Q6NPP4 1050 Calmodulin-binding transc no no 0.893 0.775 0.448 0.0
Q9FY74 1007 Calmodulin-binding transc no no 0.470 0.426 0.486 1e-118
Q9FYG2 1016 Calmodulin-binding transc no no 0.386 0.346 0.366 9e-63
Q9LSP8 838 Calmodulin-binding transc no no 0.490 0.533 0.323 8e-53
O23463 923 Calmodulin-binding transc no no 0.452 0.446 0.320 1e-48
Q9Y6Y1 1673 Calmodulin-binding transc yes no 0.125 0.068 0.420 1e-16
A2A891 1682 Calmodulin-binding transc yes no 0.125 0.067 0.420 2e-16
O94983 1202 Calmodulin-binding transc no no 0.124 0.094 0.385 1e-14
Q80Y50 1208 Calmodulin-binding transc no no 0.124 0.093 0.370 8e-13
>sp|Q8GSA7|CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana GN=CMTA3 PE=1 SV=1 Back     alignment and function desciption
 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/900 (49%), Positives = 575/900 (63%), Gaps = 110/900 (12%)

Query: 1   MADSRRFALGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLF 60
           MA++RRF+  ++LD+ QIL EA+HRWLRP EICEIL+NY +F+I+ E P TP SGS+F+F
Sbjct: 1   MAEARRFSPVHELDVGQILSEARHRWLRPPEICEILQNYQRFQISTEPPTTPSSGSVFMF 60

Query: 61  DRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWML 120
           DRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHG++NENFQRRSYW+L
Sbjct: 61  DRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGQDNENFQRRSYWLL 120

Query: 121 EEELSHIVLVHYREVKGNR--TNFNRAKVAEGATPYSQENEETIPNSEVEGSQSSGFHPN 178
           +EELSHIV VHY EVKG+R  T+FNR +  E A    QE  + +  SE +G  S  F+ N
Sbjct: 121 QEELSHIVFVHYLEVKGSRVSTSFNRMQRTEDAARSPQETGDAL-TSEHDGYASCSFNQN 179

Query: 179 SYQMPSQTADT-SLNSAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYY 237
            +   SQT D+ S+N   + E EDAES YN   SS  +S  +LQQP       G  DPYY
Sbjct: 180 DHSNHSQTTDSASVNGFHSPELEDAESAYNQHGSSTAYSHQELQQPATGGNLTGF-DPYY 238

Query: 238 PSSLT--NNYQGKFSVVPGADFISPAQTDKSRNSNDTGLT--YEPQKNLDFPSWEDVLQN 293
             SLT  ++YQ +   +P  D  S    DKS+  N  G+T   + +K++D  +WE++L N
Sbjct: 239 QISLTPRDSYQKELRTIPVTD--SSIMVDKSKTINSPGVTNGLKNRKSIDSQTWEEILGN 296

Query: 294 CSQGVGSQPEALGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSN- 352
           C  GV    EAL   PN  +++L +   +SF   ++F S  ++  + Q    +S   S+ 
Sbjct: 297 CGSGV----EALPLQPNSEHEVLDQILESSF-TMQDFASLQESMVKSQNQELNSGLTSDR 351

Query: 353 --WPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVHEQLPNAEHGHL 410
             W   Q + L++  +L S                             +E+ P       
Sbjct: 352 TVWFQGQDMELNAISNLAS-----------------------------NEKAP------- 375

Query: 411 LKSDPESSLTIDGKSFYSSAIKQHLIDGST--EGLKKLDSFNRWMSKELGDV------KE 462
                           Y S +KQHL+ G+   EGLKK+DSFNRWMSKELGDV       E
Sbjct: 376 ----------------YLSTMKQHLLHGALGEEGLKKMDSFNRWMSKELGDVGVIADANE 419

Query: 463 SNMQSSSGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSS 522
           S  QSSS  YWE VESE+G   +G + +  +D Y+MSPSLS++QL+SI DFSP+WAYV  
Sbjct: 420 SFTQSSSRTYWEEVESEDG--SNGHNSRRDMDGYVMSPSLSKEQLFSINDFSPSWAYVGC 477

Query: 523 EVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCS 582
           EV V +TG+FL +++E E  +WSCMFG+ EVPA++++ G+L+C     + GRVPFYVTCS
Sbjct: 478 EVVVFVTGKFLKTREETEIGEWSCMFGQTEVPADVISNGILQCVAPMHEAGRVPFYVTCS 537

Query: 583 NRLSCSEVREFEYRA--SHIPDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNL 640
           NRL+CSEVREFEY+   S + D +  D     T + L  +F KLLC  S +T      N 
Sbjct: 538 NRLACSEVREFEYKVAESQVFDREADDES---TIDILEARFVKLLCSKSENTSPV-SGND 593

Query: 641 SDISQLNSKISSLLKDENDDWDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAA 700
           SD+SQL+ KIS LL + +D  D ML      + S E +K  L+Q+ LKE L  WL+QK A
Sbjct: 594 SDLSQLSEKISLLLFENDDQLDQMLM----NEISQENMKNNLLQEFLKESLHSWLLQKIA 649

Query: 701 EGGKGPCVLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRER 760
           EGGKGP VLD  GQGVLHFAA+LGY+WALEPT +AGV+++FRDVNGWTALHWAA+ GRER
Sbjct: 650 EGGKGPSVLDEGGQGVLHFAASLGYNWALEPTIIAGVSVDFRDVNGWTALHWAAFFGRER 709

Query: 761 TVASLIALGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNK 820
            + SLIALGAAPG L+DP P +PSG TP+DLA + GHKGIAGYL+E  L + +S +SLN 
Sbjct: 710 IIGSLIALGAAPGTLTDPNPDFPSGSTPSDLAYANGHKGIAGYLSEYALRAHVSLLSLND 769

Query: 821 KDGDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFRSR 880
           K+ +  E+  + +  +                   + DSL AVRNATQAAARIHQVFR++
Sbjct: 770 KNAETVEMAPSPSSSS-------------------LTDSLTAVRNATQAAARIHQVFRAQ 810




Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6NPP4|CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana GN=CMTA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FY74|CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana GN=CMTA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FYG2|CMTA4_ARATH Calmodulin-binding transcription activator 4 OS=Arabidopsis thaliana GN=CMTA4 PE=1 SV=1 Back     alignment and function description
>sp|Q9LSP8|CMTA6_ARATH Calmodulin-binding transcription activator 6 OS=Arabidopsis thaliana GN=CMTA6 PE=2 SV=1 Back     alignment and function description
>sp|O23463|CMTA5_ARATH Calmodulin-binding transcription activator 5 OS=Arabidopsis thaliana GN=CMTA5 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens GN=CAMTA1 PE=1 SV=4 Back     alignment and function description
>sp|A2A891|CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus GN=Camta1 PE=2 SV=1 Back     alignment and function description
>sp|O94983|CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens GN=CAMTA2 PE=1 SV=3 Back     alignment and function description
>sp|Q80Y50|CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus GN=Camta2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query911
2240961751007 predicted protein [Populus trichocarpa] 0.878 0.794 0.626 0.0
297742873 1243 unnamed protein product [Vitis vinifera] 0.895 0.656 0.639 0.0
356511089 1107 PREDICTED: calmodulin-binding transcript 0.953 0.785 0.589 0.0
301030829 1097 calmodulin-binding protein [Solanum lyco 0.949 0.788 0.6 0.0
356528461 1115 PREDICTED: calmodulin-binding transcript 0.949 0.775 0.572 0.0
30681670 1032 calmodulin-binding transcription activat 0.867 0.765 0.494 0.0
110741068 1032 Calmodulin-binding transcription activat 0.867 0.765 0.493 0.0
297821451 1031 hypothetical protein ARALYDRAFT_481093 [ 0.871 0.770 0.494 0.0
356557555 1088 PREDICTED: calmodulin-binding transcript 0.926 0.775 0.470 0.0
356528046 1079 PREDICTED: calmodulin-binding transcript 0.923 0.779 0.469 0.0
>gi|224096175|ref|XP_002310562.1| predicted protein [Populus trichocarpa] gi|222853465|gb|EEE91012.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/878 (62%), Positives = 655/878 (74%), Gaps = 78/878 (8%)

Query: 14  DIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGH 73
           DI+QIL+EAQHRWLRPAEICEIL NY +FRIAPE  H PPSGSLFLFDRKVLRYFRKDGH
Sbjct: 1   DIQQILLEAQHRWLRPAEICEILTNYQRFRIAPEPAHMPPSGSLFLFDRKVLRYFRKDGH 60

Query: 74  NWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYR 133
           NWRKKKDGKTVKEAHERLK+GSVDVLHCYYAHGE+NENFQRRSYW+LEEELSHIVLVHYR
Sbjct: 61  NWRKKKDGKTVKEAHERLKSGSVDVLHCYYAHGEDNENFQRRSYWLLEEELSHIVLVHYR 120

Query: 134 EVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVEGSQSSGFHPNSYQMPSQTAD-TSLN 192
           EVKG RTNFNR K  E   PYSQE E+T+P+SE++ S SS FHPN YQ+P++T D TS+N
Sbjct: 121 EVKGTRTNFNRIKEHEECIPYSQETEDTMPSSEMDTSVSSRFHPNGYQVPTRTTDTTSMN 180

Query: 193 SAQASEYEDAESVYNNQASSRFHSFLDLQQPVAEKIDAGLADPYYPSSLTNNYQGKFSVV 252
           SAQASEYEDAESVYNNQASS FHSFL++Q+P  E+ID G +  Y   + +++YQGK S V
Sbjct: 181 SAQASEYEDAESVYNNQASSTFHSFLEVQKPAMERIDTGSSVHYDHMTFSSDYQGKLSAV 240

Query: 253 PGADFISPAQTDKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQP--------EA 304
           PG D IS AQ DK++ +N T    EPQK +D PSWEDVL+N ++G  S P        + 
Sbjct: 241 PGMDVISLAQVDKTKETNGTESACEPQKVIDLPSWEDVLENYARGTESVPFQTLLSQDDT 300

Query: 305 LGDIPNQGYDILGEPFTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSA 364
           +G IP Q   IL +  TNSF +R++ G                                 
Sbjct: 301 VGIIPKQEDGILEKLLTNSFDKREDIGR-------------------------------- 328

Query: 365 HDLTSQSCEQGAAHDGLLDSLRPPHAHPN---MENDVHEQLPNAEHGHLLKSDPESSLTI 421
           +DLT++  +Q      L+++L P     N   ++ND+  Q  NA+HG          +T+
Sbjct: 329 YDLTARFPDQQLDSGNLINTLEPLCTQENDLHIQNDIQIQPANADHG----------MTL 378

Query: 422 DGKSFYSSAIKQHLIDGS-TEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYWETVESEN 480
           +GKS YSS++K H++DGS TEGLKKLDSF RWMSKELGDV E  +QSSSG+YW T ESEN
Sbjct: 379 EGKSMYSSSVKHHILDGSGTEGLKKLDSFTRWMSKELGDV-EPQVQSSSGSYWITAESEN 437

Query: 481 GVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAE 540
           GVDDS    Q  LD Y++SPSLSQDQL+SIIDFSPNWAY  +E+KVLI GRFL  ++ AE
Sbjct: 438 GVDDSSNPSQGNLDAYLLSPSLSQDQLFSIIDFSPNWAYAGTEIKVLIMGRFLKGREAAE 497

Query: 541 NCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHI 600
           NC+WS MFGE+EVPAE++A GVLRC+T S K GR+PFYVTCSNR++CSEVREFEY  SH 
Sbjct: 498 NCQWSIMFGEVEVPAEVIADGVLRCNTPSHKAGRIPFYVTCSNRVACSEVREFEY-LSHT 556

Query: 601 PDVDVADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLNSKISSLLKDENDD 660
            D+       D  +E+L M+FGKLL L+SVS   YD S++ +I  L+SKI+SLL ++N+ 
Sbjct: 557 QDITYY--YSDSVTEDLNMRFGKLLSLSSVSPSKYDSSSVDEI--LSSKINSLLNEDNET 612

Query: 661 WDLMLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEGGKGPCVLDHCGQGVLHFA 720
           WD M KLT+EE FSSE+VKE+LVQKLLKE+L VWL+QKA+EGGKGP VLD  GQGVLHFA
Sbjct: 613 WDQMFKLTSEEGFSSEKVKEQLVQKLLKEQLHVWLLQKASEGGKGPSVLDEGGQGVLHFA 672

Query: 721 AALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTP 780
           AALGYDWALEPT VAGV++NFRDVNGWTALHWAA  GRERTVASLI LGAAPGAL+DPTP
Sbjct: 673 AALGYDWALEPTIVAGVSVNFRDVNGWTALHWAASYGRERTVASLIHLGAAPGALTDPTP 732

Query: 781 KYPSGRTPADLASSIGHKGIAGYLAESDLSSALSAISLNKKDGDVAEVTGATAVQTVPQR 840
           KYP+ RTPADLAS+ GHKGI+G+LAES LS+ LS+++L K+DG  AE             
Sbjct: 733 KYPTSRTPADLASANGHKGISGFLAESALSAHLSSLNLEKQDGKAAE------------- 779

Query: 841 CPTPVSDGDLPYGLSMKDSLAAVRNATQAAARIHQVFR 878
                +D DLP  L +KDSLAAV NATQAAARIHQVFR
Sbjct: 780 ----FNDADLPSRLPLKDSLAAVCNATQAAARIHQVFR 813




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297742873|emb|CBI35638.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511089|ref|XP_003524262.1| PREDICTED: calmodulin-binding transcription activator 3-like [Glycine max] Back     alignment and taxonomy information
>gi|301030829|gb|ADK47999.1| calmodulin-binding protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356528461|ref|XP_003532821.1| PREDICTED: calmodulin-binding transcription activator 3-like [Glycine max] Back     alignment and taxonomy information
>gi|30681670|ref|NP_850023.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] gi|186502240|ref|NP_001118361.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] gi|75328728|sp|Q8GSA7.1|CMTA3_ARATH RecName: Full=Calmodulin-binding transcription activator 3; AltName: Full=Ethylene-induced calmodulin-binding protein 1; Short=EICBP1; AltName: Full=Ethylene-induced calmodulin-binding protein a; Short=EICBP.a; AltName: Full=Signal-responsive protein 1 gi|25229116|gb|AAN74651.1| calmodulin-binding transcription factor SR1 [Arabidopsis thaliana] gi|27311707|gb|AAO00819.1| Unknown protein [Arabidopsis thaliana] gi|41056727|gb|AAR98746.1| ethylene-induced calmodulin-binding protein 1 [Arabidopsis thaliana] gi|330252195|gb|AEC07289.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] gi|330252196|gb|AEC07290.1| calmodulin-binding transcription activator 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110741068|dbj|BAE98628.1| Calmodulin-binding transcription activator 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297821451|ref|XP_002878608.1| hypothetical protein ARALYDRAFT_481093 [Arabidopsis lyrata subsp. lyrata] gi|297324447|gb|EFH54867.1| hypothetical protein ARALYDRAFT_481093 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356557555|ref|XP_003547081.1| PREDICTED: calmodulin-binding transcription activator 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356528046|ref|XP_003532616.1| PREDICTED: calmodulin-binding transcription activator 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query911
TAIR|locus:2060405 1032 SR1 "signal responsive 1" [Ara 0.442 0.390 0.515 5.6e-199
TAIR|locus:2173368 1050 AT5G64220 [Arabidopsis thalian 0.502 0.436 0.433 1.4e-157
TAIR|locus:2019534 1016 AT1G67310 [Arabidopsis thalian 0.407 0.365 0.317 1.3e-85
TAIR|locus:2130125923 AT4G16150 [Arabidopsis thalian 0.192 0.189 0.475 1.4e-72
FB|FBgn0259234 2044 Camta "Calmodulin-binding tran 0.218 0.097 0.327 2e-29
UNIPROTKB|Q9Y6Y1 1673 CAMTA1 "Calmodulin-binding tra 0.125 0.068 0.420 4.8e-28
MGI|MGI:2140230 1682 Camta1 "calmodulin binding tra 0.125 0.067 0.420 7.9e-28
UNIPROTKB|F1P8J0 1204 CAMTA2 "Uncharacterized protei 0.118 0.089 0.407 1.4e-25
UNIPROTKB|J9NZ90 1214 CAMTA2 "Uncharacterized protei 0.118 0.088 0.407 1.4e-25
UNIPROTKB|O94983 1202 CAMTA2 "Calmodulin-binding tra 0.118 0.089 0.407 4.4e-25
TAIR|locus:2060405 SR1 "signal responsive 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1031 (368.0 bits), Expect = 5.6e-199, Sum P(3) = 5.6e-199
 Identities = 217/421 (51%), Positives = 275/421 (65%)

Query:   417 SSLTIDGKSFYSSAIKQHLIDGST--EGLKKLDSFNRWMSKELGDV------KESNMQSS 468
             S+L  + K+ Y S +KQHL+ G+   EGLKK+DSFNRWMSKELGDV       ES  QSS
Sbjct:   366 SNLASNEKAPYLSTMKQHLLHGALGEEGLKKMDSFNRWMSKELGDVGVIADANESFTQSS 425

Query:   469 SGAYWETVESENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLI 528
             S  YWE VESE+G   +G + +  +D Y+MSPSLS++QL+SI DFSP+WAYV  EV V +
Sbjct:   426 SRTYWEEVESEDG--SNGHNSRRDMDGYVMSPSLSKEQLFSINDFSPSWAYVGCEVVVFV 483

Query:   529 TGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCS 588
             TG+FL +++E E  +WSCMFG+ EVPA++++ G+L+C     + GRVPFYVTCSNRL+CS
Sbjct:   484 TGKFLKTREETEIGEWSCMFGQTEVPADVISNGILQCVAPMHEAGRVPFYVTCSNRLACS 543

Query:   589 EVREFEYRASHIPDVD-VADNCGDITSENLRMQFGKLLCLTSVSTPNYDPSNLSDISQLN 647
             EVREFEY+ +     D  AD+  + T + L  +F KLLC  S +T      N SD+SQL+
Sbjct:   544 EVREFEYKVAESQVFDREADD--ESTIDILEARFVKLLCSKSENTSPVS-GNDSDLSQLS 600

Query:   648 SKISSLLKDENDDWDLMLKLTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAEGGKGPC 707
              KIS LL + +D  D ML                                  AEGGKGP 
Sbjct:   601 EKISLLLFENDDQLDQMLM----NEISQENMKNNLLQEFLKESLHSWLLQKIAEGGKGPS 656

Query:   708 VLDHCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIA 767
             VLD  GQGVLHFAA+LGY+WALEPT +AGV+++FRDVNGWTALHWAA+ GRER + SLIA
Sbjct:   657 VLDEGGQGVLHFAASLGYNWALEPTIIAGVSVDFRDVNGWTALHWAAFFGRERIIGSLIA 716

Query:   768 LGAAPGALSDPTPKYPSGRTPADLASSIGHKGIAGYXXXXXXXXXXXXXXXNKKDGDVAE 827
             LGAAPG L+DP P +PSG TP+DLA + GHKGIAGY               N K+ +  E
Sbjct:   717 LGAAPGTLTDPNPDFPSGSTPSDLAYANGHKGIAGYLSEYALRAHVSLLSLNDKNAETVE 776

Query:   828 V 828
             +
Sbjct:   777 M 777


GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0005516 "calmodulin binding" evidence=TAS;IPI
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0042742 "defense response to bacterium" evidence=IGI;IMP
GO:0010150 "leaf senescence" evidence=IMP
GO:0050832 "defense response to fungus" evidence=IGI
TAIR|locus:2173368 AT5G64220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019534 AT1G67310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130125 AT4G16150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0259234 Camta "Calmodulin-binding transcription activator" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y6Y1 CAMTA1 "Calmodulin-binding transcription activator 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2140230 Camta1 "calmodulin binding transcription activator 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P8J0 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ90 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O94983 CAMTA2 "Calmodulin-binding transcription activator 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VII.1798.1
hypothetical protein (994 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query911
pfam03859119 pfam03859, CG-1, CG-1 domain 4e-70
smart01076118 smart01076, CG-1, CG-1 domains are highly conserve 5e-60
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-08
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.003
>gnl|CDD|217766 pfam03859, CG-1, CG-1 domain Back     alignment and domain information
 Score =  227 bits (580), Expect = 4e-70
 Identities = 80/119 (67%), Positives = 97/119 (81%)

Query: 18  ILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRK 77
           +L EA+ RWLRP EI  IL+N+ K  I  E P  PPSGSLFL++RKV+RYFRKDG+NW+K
Sbjct: 1   LLPEAKSRWLRPEEIYAILQNFEKHFITLEPPTRPPSGSLFLYNRKVVRYFRKDGYNWKK 60

Query: 78  KKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVK 136
           KKDGKT +EAHE+LK G V+VL+CYYAHGE+N  FQRR YW+L+E+L HIVLVHY  VK
Sbjct: 61  KKDGKTTREAHEKLKVGGVEVLNCYYAHGEDNPTFQRRCYWLLDEDLEHIVLVHYLNVK 119


CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs. Length = 119

>gnl|CDD|198144 smart01076, CG-1, CG-1 domains are highly conserved domains of about 130 amino-acid residues Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 911
KOG0520 975 consensus Uncharacterized conserved protein, conta 100.0
PF03859118 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domain 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 99.98
PHA03100 480 ankyrin repeat protein; Provisional 99.98
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA02791284 ankyrin-like protein; Provisional 99.97
PHA02878 477 ankyrin repeat protein; Provisional 99.97
PHA02875413 ankyrin repeat protein; Provisional 99.97
PHA02876 682 ankyrin repeat protein; Provisional 99.97
PHA02946446 ankyin-like protein; Provisional 99.97
PHA02874434 ankyrin repeat protein; Provisional 99.97
PHA03095471 ankyrin-like protein; Provisional 99.97
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
PHA02876 682 ankyrin repeat protein; Provisional 99.97
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
PHA02989 494 ankyrin repeat protein; Provisional 99.96
PHA02730672 ankyrin-like protein; Provisional 99.96
PHA03100480 ankyrin repeat protein; Provisional 99.96
PHA02791284 ankyrin-like protein; Provisional 99.96
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.96
KOG0510 929 consensus Ankyrin repeat protein [General function 99.95
PHA02874434 ankyrin repeat protein; Provisional 99.95
PHA02798489 ankyrin-like protein; Provisional 99.95
PHA02989494 ankyrin repeat protein; Provisional 99.95
KOG0510 929 consensus Ankyrin repeat protein [General function 99.95
PHA02798 489 ankyrin-like protein; Provisional 99.95
PHA02875 413 ankyrin repeat protein; Provisional 99.95
PHA02878477 ankyrin repeat protein; Provisional 99.94
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
PHA02917 661 ankyrin-like protein; Provisional 99.93
PHA02917661 ankyrin-like protein; Provisional 99.93
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.93
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.93
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.93
PHA02792631 ankyrin-like protein; Provisional 99.92
PHA02859209 ankyrin repeat protein; Provisional 99.92
KOG0508 615 consensus Ankyrin repeat protein [General function 99.91
PHA02730672 ankyrin-like protein; Provisional 99.9
PHA02795437 ankyrin-like protein; Provisional 99.9
KOG0508 615 consensus Ankyrin repeat protein [General function 99.89
PHA02859209 ankyrin repeat protein; Provisional 99.88
PHA02795437 ankyrin-like protein; Provisional 99.87
PLN03192823 Voltage-dependent potassium channel; Provisional 99.87
PHA02792631 ankyrin-like protein; Provisional 99.86
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.85
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.85
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.84
KOG0514452 consensus Ankyrin repeat protein [General function 99.81
PLN03192823 Voltage-dependent potassium channel; Provisional 99.79
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.79
PHA02743166 Viral ankyrin protein; Provisional 99.79
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.76
PHA02741169 hypothetical protein; Provisional 99.76
PHA02743166 Viral ankyrin protein; Provisional 99.76
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.75
PHA02741169 hypothetical protein; Provisional 99.74
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.74
PHA02884300 ankyrin repeat protein; Provisional 99.74
PHA02736154 Viral ankyrin protein; Provisional 99.72
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.72
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.71
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.69
KOG0514452 consensus Ankyrin repeat protein [General function 99.69
PHA02736154 Viral ankyrin protein; Provisional 99.69
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.68
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.67
PHA02884300 ankyrin repeat protein; Provisional 99.66
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.65
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.57
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.54
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.53
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.51
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.51
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.49
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.48
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.43
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.41
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.4
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.39
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.38
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.33
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.32
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.31
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.31
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.3
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.28
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.26
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.17
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.08
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.8
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.76
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.63
PF1360630 Ank_3: Ankyrin repeat 98.61
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.47
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.47
KOG2384223 consensus Major histocompatibility complex protein 98.42
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.38
KOG0522 560 consensus Ankyrin repeat protein [General function 98.36
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.32
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.31
PF1360630 Ank_3: Ankyrin repeat 98.29
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.28
KOG0522 560 consensus Ankyrin repeat protein [General function 98.18
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.17
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.14
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.07
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.02
KOG0511 516 consensus Ankyrin repeat protein [General function 97.98
KOG2384223 consensus Major histocompatibility complex protein 97.87
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.86
KOG0511 516 consensus Ankyrin repeat protein [General function 97.74
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.69
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.31
KOG2505591 consensus Ankyrin repeat protein [General function 96.67
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.64
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.42
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.65
KOG2505591 consensus Ankyrin repeat protein [General function 95.5
cd0117585 IPT_COE IPT domain of the COE family (Col/Olf-1/EB 93.69
PF08549669 SWI-SNF_Ssr4: Fungal domain of unknown function (D 89.2
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 85.13
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=9.3e-101  Score=905.69  Aligned_cols=740  Identities=40%  Similarity=0.630  Sum_probs=503.5

Q ss_pred             CCChhhHHHHHHHHHHhcCChHHHHHHHhccccceeCcCCCCCCCCcceEeeehhhhhhhcccCccceecCCCcchHhhh
Q 002539            9 LGNQLDIEQILIEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAH   88 (911)
Q Consensus         9 ~~~~~d~~~~~~~~~~rw~~~~e~~~~l~~~~~~~~~~~~~~~p~~g~~~l~~r~~~~~fr~dg~~w~k~~~~~~~~e~h   88 (911)
                      ....||+..+++|+++|||+|+||+.||+||++|.++++||+||.|||+||||||+|||||||||+||||||||||||||
T Consensus        19 sl~~l~~~~ll~~~~~rWl~~~EI~~il~n~~~~~lt~~s~trp~sGS~flfnRk~lr~fRKDGh~WkKkkDGKtirEaH   98 (975)
T KOG0520|consen   19 SLQDLDIQTLLPEAKSRWLTPEEILAILINHEKFTLTVSSPTRPQSGSIFLFNRKVLRYFRKDGHNWKKKKDGKTIREAH   98 (975)
T ss_pred             hhhhhhhhhhhHHHHhccCChHHHHHHHhcccccccccCCCCCCCCCceeeeccHHHHHHhhcchhhhhcCCCCcChHHH
Confidence            34679999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhccCCEeeEEEEeecccCCcccceeeeeccccccccEEEEeeeeccCCccccccccccCCCCCCCCCCccCCCCCCcc
Q 002539           89 ERLKAGSVDVLHCYYAHGEENENFQRRSYWMLEEELSHIVLVHYREVKGNRTNFNRAKVAEGATPYSQENEETIPNSEVE  168 (911)
Q Consensus        89 ~~lk~~~~~~~~~~y~~~~~~~~f~rr~y~~~~~~~~~~vlvhy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  168 (911)
                      |||||||+|+||||||||+++|||||||||||++.++||||||||||++.+.. ..+..+..                 .
T Consensus        99 e~LKvg~~~~l~~~Y~Hg~~~ptF~RRcYwllq~~~~hIVLVHYl~v~~~~~~-~~~~~~~~-----------------~  160 (975)
T KOG0520|consen   99 EKLKVGGVEVLHCYYAHGEINPTFQRRCYWLLQQELEHIVLVHYLNVKGNEDA-AKGAGEIF-----------------S  160 (975)
T ss_pred             HhhccCCccceeeeeecccccchHHHHHHHhhccccCceEEEEEeeccccccc-ccCccccc-----------------c
Confidence            99999999999999999999999999999999999999999999999987731 11111110                 1


Q ss_pred             CCCCCCCCCCCCCCCCcccc-CCcCcc-cccchhhhhccccCCCCccccccc------cccchhhhhcccCCCCCCCCCC
Q 002539          169 GSQSSGFHPNSYQMPSQTAD-TSLNSA-QASEYEDAESVYNNQASSRFHSFL------DLQQPVAEKIDAGLADPYYPSS  240 (911)
Q Consensus       169 ~~~~~~~~~~~~~~~~~~~~-~s~~~~-~~~~~e~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~  240 (911)
                      +++|+.-  +   ...+-.+ .+|.-. +.+..++++++++.+.+..+-...      .-+++.++..        .+  
T Consensus       161 s~~sd~~--~---S~~~~~~q~~~~~~~~~s~~~~v~~i~s~~~~~~~g~~~~~s~~h~i~~~~~~s~--------~~--  225 (975)
T KOG0520|consen  161 SIISDKA--W---SLNQLAGQLSPIFHNHSSVNEDVAEINSNQTGNALGSVFGNSRNHRIRLHEVNSL--------DP--  225 (975)
T ss_pred             ccccccc--c---cHHHhhcccCcchhcccchHHHHHHHhhhccccccccccCcchhhhhcccccCCc--------cc--
Confidence            2222221  1   0111111 122111 345566776654332222221110      1111111100        00  


Q ss_pred             cccCcCCcccccCCCCCcCCcCc-cCCCCCCCCCCcCCCCCCCCCCChHHHhhhcCCCCCCCCCccCCCCCCCCCcCCCC
Q 002539          241 LTNNYQGKFSVVPGADFISPAQT-DKSRNSNDTGLTYEPQKNLDFPSWEDVLQNCSQGVGSQPEALGDIPNQGYDILGEP  319 (911)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  319 (911)
                          +.......+...... .++ ....-.....     ..+.+...|.++++++....-....++.             
T Consensus       226 ----~~~~p~s~~s~~~~~-~~~~~~~~~~~~~~-----~rs~~~s~~te~l~n~~~~~~~~g~s~s-------------  282 (975)
T KOG0520|consen  226 ----LYKLPVSDDSLNLSA-PKPIDLPKGPTSVK-----QRSSSPSYFTEILGNAPSGLVSQGNSLS-------------  282 (975)
T ss_pred             ----cccccccCCcccccc-CCCcccccCCcchh-----hcCCCCcchhhhcccCCCcccccccccc-------------
Confidence                111111100000000 000 0000000000     0113334677777766622111111100             


Q ss_pred             ccCCccccccccCcccccccccccccCCcCCCCCccccccccccccccccccccccccccCccCCCCCCCCCCCCCCccc
Q 002539          320 FTNSFGERKEFGSHLQTRGEWQASRNDSSHLSNWPMDQKVYLDSAHDLTSQSCEQGAAHDGLLDSLRPPHAHPNMENDVH  399 (911)
Q Consensus       320 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  399 (911)
                        +.+  +..        ..|+.        +          +.+.       ....+    ..+|+|....+.   ...
T Consensus       283 --~~l--~~i--------~~~~~--------~----------~~~~-------~~~p~----~~nf~~~ss~~s---~~~  318 (975)
T KOG0520|consen  283 --SSL--QRI--------SSFTG--------L----------DNAA-------YEQPN----SQNFEPNSSLNS---HVT  318 (975)
T ss_pred             --cch--hhc--------ccccc--------c----------cccc-------ccCCc----cccccccccCCC---Ccc
Confidence              000  000        01110        0          0000       00000    000100000000   000


Q ss_pred             ccCCccccccCCCCCCCcccccccccccchhhhccccc--ccccccccccchhhHHhhhcCccccccccCCCCccccccc
Q 002539          400 EQLPNAEHGHLLKSDPESSLTIDGKSFYSSAIKQHLID--GSTEGLKKLDSFNRWMSKELGDVKESNMQSSSGAYWETVE  477 (911)
Q Consensus       400 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~dsf~rw~~~~~~~~~~~~~~~~~~~~~~~~~  477 (911)
                      .    ...+.+  .....+...+..-|     .....+  ...+||++.|||.|||+ .|++..|..-.++-+.+|.+..
T Consensus       319 ~----~~~g~g--~~~~~~sa~~~~~P-----~~~~~~~~~~~~~l~sgdsf~~~~~-t~~e~~d~~q~~s~~~~~~p~~  386 (975)
T KOG0520|consen  319 G----QSYGQG--LQARSPSATSESRP-----ITSAADAALSELGLKSGDSFSRWAS-TFGEISDLGQDPSGEAVWTPEN  386 (975)
T ss_pred             c----cccCcc--ccCCCcccccccCC-----cchhhccccccccccccccccchhh-hhcccccCCCCCccccccccCC
Confidence            0    000000  00001111112223     111122  12789999999999996 8888887773344456787653


Q ss_pred             ccCCCCCCCCCcccccccccCCCccCCCCceEEEeeccccccCCCceEEEEEcc-cccCcccchHHHHHHHcCCcHHHHH
Q 002539          478 SENGVDDSGVSPQARLDTYMMSPSLSQDQLYSIIDFSPNWAYVSSEVKVLITGR-FLMSQQEAENCKWSCMFGEIEVPAE  556 (911)
Q Consensus       478 ~~~~~~~~~~~~~~~l~~~~~~~s~s~~q~fsI~dfSP~wa~s~~~tKVlI~G~-fl~~~~~~T~LH~Ac~~G~~eVV~~  556 (911)
                        +.+.+.+         ...++| +++|+|+|+||||+|+|.++++||+|+|. +..     +.-+|.|+||+.+|++.
T Consensus       387 --~~~~~~~---------s~~~~S-~p~qlf~I~DfSP~Wsy~~ggvKVlV~G~~~~~-----~~~~ysc~Fg~~~VPAe  449 (975)
T KOG0520|consen  387 --DPMGPPG---------SFLSPS-SPEQLFTITDFSPEWSYLDGGVKVLVTGFPQDE-----TRSNYSCMFGEQRVPAE  449 (975)
T ss_pred             --CcCCCcc---------cccCCC-CCcceeeeeccCcccccCCCCcEEEEecCcccc-----CCCceEEEeCCccccHH
Confidence              2222221         136666 44999999999999999999999999995 333     35679999999999999


Q ss_pred             HHHCCCCCCCCCCCCCCChHHHHHHH-cCCCcchHHHHHHHHhCCCCccccCCCCChHHHhhHHHHHHHHhcCCCCC-CC
Q 002539          557 IVAGGVLRCHTSSQKVGRVPFYVTCS-NRLSCSEVREFEYRASHIPDVDVADNCGDITSENLRMQFGKLLCLTSVST-PN  634 (911)
Q Consensus       557 LL~~Gadvn~~~~d~~G~TPLhvAa~-nG~a~seVv~felLl~~GAdin~~D~~G~TpL~~~~~~ivkLLl~ga~v~-~~  634 (911)
                      ||+.||.+|++|++..|.++|++||. ++..|+++++|+|+...-..++..+.+-.+--+....++..++.....+. ..
T Consensus       450 liq~GVLrC~~P~h~~G~V~l~V~c~~~~~~~se~ref~~~~~~~~~~d~~s~~d~~~~~sl~~rl~~~~~r~~~~~~s~  529 (975)
T KOG0520|consen  450 LIQEGVLRCYAPPHEPGVVNLQVTCRISGLACSEVREFAYLVQPSQQIDKLSWEDFLFQMSLLHRLETMLNRKQSILSSK  529 (975)
T ss_pred             HhhcceeeeecCccCCCeEEEEEEecccceeeeeehheeecccCcccccccccccchhhhHHHHHHHHHHHHhHhHhhcc
Confidence            99999999999999999999999999 88899999999999988888888774444444545556655555222221 11


Q ss_pred             CCCCCchhhhH--HHHHHHhhhccCCcchhH-HHHHHhhcCCChHHHHHHHHHHHHHHhhHHHHHHHHHhC-CCCCCccc
Q 002539          635 YDPSNLSDISQ--LNSKISSLLKDENDDWDL-MLKLTAEEKFSSEEVKEKLVQKLLKEKLQVWLVQKAAEG-GKGPCVLD  710 (911)
Q Consensus       635 ~~~~~~~~~~~--l~~~I~sl~~~d~~g~t~-L~~a~~~~~~~~~~~~~~ll~~a~k~~l~~~Lv~lLle~-Gad~n~~D  710 (911)
                      ...........  +..++..+    .+.|.. ++.....+.....+.++.+|..++++.++.||++.+++- |......|
T Consensus       530 ~~~~n~~~~~~~~l~skv~~l----~~~~~~r~~~~~~~~~~~~~~~r~~lllhL~a~~lyawLie~~~e~~~~~~~eld  605 (975)
T KOG0520|consen  530 PSTENTSDAESGNLASKVVHL----LNEWAYRLLKSISENLSSSVNFRDMLLLHLLAELLYAWLIEKVIEWAGSGDLELD  605 (975)
T ss_pred             CCccccccccchhHHHHHHHH----HHHHHHHHHhhHhhhccccCCCcchHHHHHHHHHhHHHHHHHHhcccccCchhhc
Confidence            11122222222  66666666    566776 777777777777888999999999999999999999986 88888999


Q ss_pred             CCCCcHHHHHHHcCCHhHHHhHHhcCCCccccCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCCCCCCCHHH
Q 002539          711 HCGQGVLHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALSDPTPKYPSGRTPAD  790 (911)
Q Consensus       711 ~~G~TpLH~AA~~G~~eiVklLLe~GAdvN~~D~~G~TPLH~Aa~~G~~eiVklLL~~GAd~na~tDpn~~D~~G~TPLh  790 (911)
                      .+|+..+|++|..|+.+++.+++..|..++++|..||||||||+.+|++.+|..|++.|++.++++||++.++.|.|+..
T Consensus       606 ~d~qgV~hfca~lg~ewA~ll~~~~~~ai~i~D~~G~tpL~wAa~~G~e~l~a~l~~lga~~~~~tdps~~~p~g~ta~~  685 (975)
T KOG0520|consen  606 RDGQGVIHFCAALGYEWAFLPISADGVAIDIRDRNGWTPLHWAAFRGREKLVASLIELGADPGAVTDPSPETPGGKTAAD  685 (975)
T ss_pred             ccCCChhhHhhhcCCceeEEEEeecccccccccCCCCcccchHhhcCHHHHHHHHHHhccccccccCCCCCCCCCCchhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCcHHHHHHHHHcCCCCccccCcccCC-C-CCcHhhhcHHHHHHhhhcCCCCCCCCCCCCccchhhHHHHHHHHHH
Q 002539          791 LASSIGHKGIAGYLAESDLSSALSAISLNKK-D-GDVAEVTGATAVQTVPQRCPTPVSDGDLPYGLSMKDSLAAVRNATQ  868 (911)
Q Consensus       791 lAa~~G~~eIvklLLe~G~~sh~adln~~D~-~-G~Ta~~~~~~~V~~Lle~ga~~~~~~~~~~~lsLkdsLaAvr~Aaq  868 (911)
                      +|..+|+.++..+|.++.++.+..++...+. . +.++..   +..+...+..+.+.     ++..+|+|+|+|||+|++
T Consensus       686 la~s~g~~gia~~lse~~L~~~~~~~~~~~~~~s~~~~~~---~~~~t~~e~s~~~~-----~~~~sl~Dtl~avrdAa~  757 (975)
T KOG0520|consen  686 LARANGHKGIAGYLSEKALSAHLSNLELADPNLSADSEED---KAEKTSSEGSPNPD-----EDSDSLKDTLAAVRDAAQ  757 (975)
T ss_pred             hhhcccccchHHHHhhhHHHHHHhhccccccccCCCchhh---hhhhccCCCCCCCC-----ccccccccccccccchHH
Confidence            9999999999999999999988888888773 2 233333   33333333333333     444569999999999999


Q ss_pred             HHHHHHHHHh--cchhhhHHHhh
Q 002539          869 AAARIHQVFR--SRPRSQVITMS  889 (911)
Q Consensus       869 AAarIq~afR--Sf~rk~~~~~~  889 (911)
                      ||+|||++||  +|+|+++.+..
T Consensus       758 aa~r~q~vfr~~~~~~~~a~~i~  780 (975)
T KOG0520|consen  758 AAARIQAVFRAQSFQKKQAREIM  780 (975)
T ss_pred             HHHhhhhhhhhhhhhhhhHHHHH
Confidence            9999999999  99999988865



>PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors Back     alignment and domain information
>PF08549 SWI-SNF_Ssr4: Fungal domain of unknown function (DUF1750); InterPro: IPR013859 This is a fungal protein of unknown function Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query911
2cxk_A95 Crystal Structure Of The Tig Domain Of Human Calmod 1e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 8e-08
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 5e-06
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 5e-05
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 6e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-04
>pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95 Back     alignment and structure

Iteration: 1

Score = 65.9 bits (159), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 36/88 (40%), Positives = 53/88 (60%), Gaps = 6/88 (6%) Query: 510 IIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGVLRCHTSS 569 + D+SP W+Y VKVLITG + QEA N +SC+F +I VPA ++ GVLRC+ + Sbjct: 9 VTDYSPEWSYPEGGVKVLITGPW----QEASN-NYSCLFDQISVPASLIQPGVLRCYCPA 63 Query: 570 QKVGRVPFYVTCSNRLSCSEVREFEYRA 597 G V V +N++ + V FEY++ Sbjct: 64 HDTGLVTLQVAFNNQIISNSVV-FEYKS 90
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query911
2cxk_A95 Camta1, calmodulin binding transcription activator 4e-34
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-12
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-08
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-12
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 6e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-12
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-09
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-06
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-12
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-09
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-04
2rfa_A232 Transient receptor potential cation channel subfa 1e-11
2rfa_A232 Transient receptor potential cation channel subfa 7e-10
2rfa_A232 Transient receptor potential cation channel subfa 4e-09
2rfa_A232 Transient receptor potential cation channel subfa 1e-08
2rfa_A232 Transient receptor potential cation channel subfa 1e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-07
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-09
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-10
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-06
2etb_A256 Transient receptor potential cation channel subfam 9e-10
2etb_A256 Transient receptor potential cation channel subfam 8e-07
2etb_A256 Transient receptor potential cation channel subfam 2e-06
2etb_A256 Transient receptor potential cation channel subfam 4e-06
2etb_A256 Transient receptor potential cation channel subfam 4e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-04
2pnn_A273 Transient receptor potential cation channel subfa 5e-09
2pnn_A273 Transient receptor potential cation channel subfa 6e-08
2pnn_A273 Transient receptor potential cation channel subfa 1e-07
2pnn_A273 Transient receptor potential cation channel subfa 4e-07
2pnn_A273 Transient receptor potential cation channel subfa 8e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-06
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-06
3muj_A138 Transcription factor COE3; immunoglobulin like fol 1e-05
>2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95 Back     alignment and structure
 Score =  124 bits (313), Expect = 4e-34
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 6/96 (6%)

Query: 503 SQDQLYSIIDFSPNWAYVSSEVKVLITGRFLMSQQEAENCKWSCMFGEIEVPAEIVAGGV 562
           S      + D+SP W+Y    VKVLITG +  +     +  +SC+F +I VPA ++  GV
Sbjct: 2   SSGSSGMVTDYSPEWSYPEGGVKVLITGPWQEA-----SNNYSCLFDQISVPASLIQPGV 56

Query: 563 LRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRAS 598
           LRC+  +   G V   V  +N++  + V  FEY++ 
Sbjct: 57  LRCYCPAHDTGLVTLQVAFNNQIISNSV-VFEYKSG 91


>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 911
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-11
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.004
d2cxka182 b.1.18.1 (A:872-953) Calmodulin binding transcript 6e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.002
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.003
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.004
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.003
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 9e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 65.4 bits (158), Expect = 1e-11
 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 6/90 (6%)

Query: 717 LHFAAALGYDWALEPTTVAGVNINFRDVNGWTALHWAAYCGRERTVASLIALGAAPGALS 776
           LH A+ +G+   ++     G + N  +V   T LH AA  G       L+   A      
Sbjct: 4   LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA------ 57

Query: 777 DPTPKYPSGRTPADLASSIGHKGIAGYLAE 806
               K    +TP   A+ IGH  +   L E
Sbjct: 58  KVNAKAKDDQTPLHCAARIGHTNMVKLLLE 87


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query911
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.98
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.98
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.94
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.91
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.9
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.9
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.85
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.85
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.83
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.8
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.8
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.73
d2cxka182 Calmodulin binding transcription activator 1 {Huma 96.63
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=9.8e-35  Score=244.17  Aligned_cols=82  Identities=13%  Similarity=0.144  Sum_probs=57.0

Q ss_pred             CHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHH--
Q ss_conf             449899997399189999998899988888988997388999971998612788998871999965457999907773--
Q 002539          539 AENCKWSCMFGEIEVPAEIVAGGVLRCHTSSQKVGRVPFYVTCSNRLSCSEVREFEYRASHIPDVDVADNCGDITSEN--  616 (911)
Q Consensus       539 ~T~LHlAc~fG~~eVv~~LLe~Gadvn~~p~d~~G~TPLhiAa~ng~a~seVv~feyLl~~gadin~~D~~G~TaL~~--  616 (911)
                      +||||+||..|+.++|+.||+.|++++  ..+..|.||||+||..|+  .+++  ++|+++|++++..+..|.||++.  
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in--~~d~~g~TpL~~A~~~g~--~~iv--~~Ll~~gadi~~~~~~g~t~L~~A~   74 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGASPN--VSNVKVETPLHMAARAGH--TEVA--KYLLQNKAKVNAKAKDDQTPLHCAA   74 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTCCSC--CSSSCCCCHHHHHHHHTC--HHHH--HHHHHHTCCSSCCCTTSCCHHHHHH
T ss_pred             CCHHHHHHHCCCHHHHHHHHHCCCCCC--CCCCCCCCHHHHHHHCCC--HHHH--HHHHHCCCCCCCCCCCCCCHHHHHH
T ss_conf             986999998848999999997878999--889999889999998688--9999--9999885998877999899999999


Q ss_pred             --HHHHHHHHHH
Q ss_conf             --3799999981
Q 002539          617 --LRMQFGKLLC  626 (911)
Q Consensus       617 --~~~~ivkLLl  626 (911)
                        ++.+++++|+
T Consensus        75 ~~g~~~~~~~Ll   86 (408)
T d1n11a_          75 RIGHTNMVKLLL   86 (408)
T ss_dssp             HHTCHHHHHHHH
T ss_pred             HCCCHHHHHHHH
T ss_conf             869977999998



>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure