Citrus Sinensis ID: 002541

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910

MEDVKIAEEMPPPESTLSPKADNGSSSELPEDPVTNGKVSNELSNMETSKPKPVEDTADVPVGGQDEVLSADNSVSNSAIAIDESETDHRDTVMEDSKTEATKDNPNGKQSQDDGSVIDSHVHTDNSDIPSVSSPQVHDSRDDQRIEPSDKLALPHTELASIAVRAPGTVDSPKHVLDSPKPGDSPKYVLNSPKHVLDSPKSGDSPKYVLNSPKHLVNSPKHVFGSPKQFGSPRYGISSPKLAKQGEMKRGLIDTTAPFESVKEVVSKFGGIVDWKAHRMQTVERRKYVEQELERSHEEMPEYRKRSEAAEVAKNQVLKELDQTKRLVEELKLNLERAQTEEHQAKQDSELAKLRVEEMEQGIADDASVAARAQLEVAKARHVAAVSELKSVKDEVESLRKDYASLVTEKDIAVKKAEEAISASKEVEKTVEELTIELIATKESLESAHAAHLEAEEQRIGAAMARDQDSHLWEKELKQAEEELQKLTQQILSAKDLRSKLDTASALLLDLKAELSAYMESKLKEESNEEGHSNGELEEPERKTHTDIQAAVASAKKELEEVKLNIEKATAEVNCLKVAATSLQSELEREKSALAAIRQREGMASVAVASLEAELDRTRSEIALVQMKEKEAREKTVELPKQLQVAAQEADQAKSLAQAAGEELHKAKEEAEQAKAGASTIESRLTAARKEIEAARASEKLALAAIKALQESESAQRTDDVDSPTGVTLSLEEYYELSKRAHEAEEQANMRVVAAISQIEVAKASELRSLERLEEVNKEIATRKEALKVAMEKAEKAKEGKLGIEQELRKWRAEHEQRRKAGESGQGVNSTKIPTPSLEEKKDSKKYDRMSSAAAVPNMTSPKASMQGSNTETESSPEAKGPKKKKKSLFPRLFMFLARRRSHASKSSST

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcHHccccccHHcccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHccccccccccccccccccHHHcccHHHHHHHHHHHHccccccccc

***********************************************************************************************************************************************************************************************************************************************************LIDTTAPFESVKEVVSKFGGIVDWKAHRMQTV**************************************************************************************************************************LV**************************LTIELI******************************************************************ALLLDL****************************************************LNIEKATAEVNCLKVAA***************************************************************************************************************************************************************************VVAAISQI*************************************************************************************************************************************L*****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEDVKIAEEMPPPESTLSPKADNGSSSELPEDPVTNGKVSNELSNMETSKPKPVEDTADVPVGGQDEVLSADNSVSNSAIAIDESETDHRDTVMEDSKTEATKDNPNGKQSQDDGSVIDSHVHTDNSDIPSVSSPQVHDSRDDQRIEPSDKLALPHTELASIAVRAPGTVDSPKHVLDSPKPGDSPKYVLNSPKHVLDSPKSGDSPKYVLNSPKHLVNSPKHVFGSPKQFGSPRYGISSPKLAKQGEMKRGLIDTTAPFESVKEVVSKFGGIVDWKAHRMQTVERRKYVEQELERSHEEMPEYRKRSEAAEVAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSELAKLRVEEMEQGIADDASVAARAQLEVAKARxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDIAVKKxxxxxxxxxxxxxxxxxxxxxLIATKESLESAHAAHLEAEEQRIGAAMARDQDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSAYMESKLKEESNEEGHSNGELEEPERKTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEGMASVAxxxxxxxxxxxxxxxxxxxxxxxxxxxxTVELPKQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEKLALAAIKALQESESAQRTDDVDSPTGVTLSLEEYYELSKRAHEAEEQANMRVVAAISQIEVAKASELRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHEQRRKAGESGQGVNSTKIPTPSLEEKKDSKKYDRMSSAAAVPNMTSPKASMQGSNTETESSPEAKGPKKKKKSLFPRLFMFLARRRSHASKSSST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1	Required for the chloroplast avoidance response under high intensity blue light. This avoidance response consists in the relocation of chloroplasts on the anticlinal side of exposed cells. Acts in association with PMI2 to maintain the velocity of chloroplast photorelocation movement via cp-actin filaments regulation.	probable	O48724

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 284-345
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3h0g, chain A		probable	Alignment \| Template Structure