Citrus Sinensis ID: 002552

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------91
MSPRFLGATKSIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNYQGGQRRGGGGPSTSGRGGRRGGRGGGGGRGGGGGGRGEQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSRRQDSKKDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSVRSYIFYYYRKLSIPSPLLSLLVVV
ccccccccccEEEccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHcHHHHHcccccEEEEEEccccccHHHHHHHccccHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEEEccccccEEEEEcHHHHHHHHccccccccccEEEEcccccccccHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHcccccEEEEcccccccEEEEHHHHHHHHcccccccccccccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHcccccccccEEEEEcccccccHHHHccccccccccEEEEEEccccccccccccEEEEEEcccccEEEEccccccccccccccHHHHHHHHccccccccccEEEEcccHHHHHHccccccccEEEccHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHcccccccccccHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHcc
ccccHccccHHHHccccEEEEEEcccccccEEcccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccEEEEEcccccHHcHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccHHHcccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHccccccccccEEEEccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEcccHHHHHHHHccccccccEEEEEEcHHHcccHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccccccHHcHHHcEEEccccccHHHHHHHHccccccccccccccEEEEHccccccccccHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHcccccccccEEEEEEcccccHHHHHHHHccccccccEEEEEEccEEEEEEEccEEEEEccccEEEcccccccccccccEcHHHHHHHHHHcccccccccccEEEEccHHHHHHHccccccHHHcccHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHcHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccccHHHHHHHHHHHHHHHHHccEEEEc
MSPRFLGATKSIFSRSKYLLVVaapitrprvlstssvsfplktakppvmsyrpnyqggqrrggggpstsgrggrrggrgggggrggggggrgeqrwwdpVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKAlavskvplpmyrpdlderhgsteKELQMSIETERRVGNllnssqgnvpvndsgiessevarrpklsVKVAntisppqsdsAKERLNVILKERQeklkssdsgKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSgetgcgkttqlpQFILEEELsslrgadcniictqprrISAISVAARVSsergenlgETVGYQIRLESKRSAQTRLLFCTTGVLLRqlvedpdlscvSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLfskyfgnaptvhipgltfpvtdlFLEDVLEKTRYKMNSKldsfqgnsrrsrrqdskkdHLTALFedvdidsnyknyrASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVnkflgdpnkflvlplhgsmptinqreifdrpppnkrkIVLATNiaessitidDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAhqrrgragrvqpgvcyklypriihdamlpyqlpeilRTPLQELCLHIKslqlgtvgsflskalqppdplAVQNAIELLKTIgalddmenltplgrhlctlpvdpnigkMLLMGAIFQCLNPALTIAAALahrnpfvlpvnmQKEVDEAkrsfagdsCSDHIALLKAFDGykdakrnrrerdfcwenflsPITLQMMEDMRSQFLDLLSDigfvdkskgpsvrSYIFYYYRklsipspllsllvvv
msprflgatksifsrskYLLVVaapitrprvlstssvsfplktakppvmsyrpnyqggqrrggggpstsgrggrrggrgggggrggggggrgeqrwwDPVWRAERLRQQAAEmevfdqnewwgKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNllnssqgnvpvndsgiessevarrpklsvkvantisppqsdsakeRLNVILKErqeklkssdsgkaMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAarvssergenlgetvgYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKmnskldsfqgnsrrsrrqdskkdhltalfedvdidsnykNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTInqreifdrpppnKRKIVLAtniaessitiddvVYVVDCGKAKETSYDALNKLACLLPSWISKAsahqrrgragrvqpgVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAfdgykdakrnrrerdfcWENFLSPITLQMMEDMRSQFLDLLSDIgfvdkskgpsVRSYIFYYYrklsipspllsllvvv
MSPRFLGATKSIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNYQggqrrggggpstsgrggrrggrgggggrggggggrgEQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPrrisaisvaarvssERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFlliilrdllprrpdlrlilMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNsrrsrrQDSKKDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSVRSYIFYYYRKlsipspllsllvvv
*******ATKSIFSRSKYLLVVAAPITRPRVL***************************************************************WWDPVWRAERLRQQAAEMEVFDQNEWWGKLE**********************TLADMAHQLGLHFHAYNKGKALAVSKVPL*******************************************************************************************************LPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARV*******LGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRY**************************TALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFD*****KRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVD***RSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSVRSYIFYYYRKLSIPSPLLSLLVV*
***R***ATKSIFSRSKYLLVVAAPIT*******************************************************************************************NEWWGKLEQMKRG***************QQTLADMAHQLGLHF**********VSKVPLPMYRPDLD***********************************************************************************************LPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMN*****************SKKDHLTALFEDVDIDS************LEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKV****GDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFV***************FAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFV*****************KLSIPSPLLSLLVVV
********TKSIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNY**************************************QRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQ********GKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKL*****************DHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISK***********RVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSVRSYIFYYYRKLSIPSPLLSLLVVV
**********SIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNYQ*************************************QRWWDPVWRAERLRQQA*EMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVN*************************PQSDSAKERLNVILKERQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSRRQDSKKDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQR**RAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSVRSYIFYYYRKLSIPSPLLSLLVVV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPRFLGATKSIFSRSKYLLVVAAPITRPRVLSTSSVSFPLKTAKPPVMSYRPNYQGGQRRGGGGPSTSGRGGRRGGRGGGGGRGGGGGGRGEQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLADMAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSSQGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSRRQDSKKDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSVRSYIFYYYRKLSIPSPLLSLLVVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query908 2.2.26 [Sep-21-2011]
Q9H2U1 1008 Probable ATP-dependent RN yes no 0.662 0.597 0.496 1e-174
Q8VHK9 1001 Probable ATP-dependent RN yes no 0.745 0.676 0.453 1e-173
Q6P158 1386 Putative ATP-dependent RN no no 0.669 0.438 0.439 1e-146
Q6P5D3 1388 Putative ATP-dependent RN no no 0.677 0.443 0.439 1e-143
Q7Z478 1369 ATP-dependent RNA helicas no no 0.670 0.444 0.414 1e-136
Q6PGC1 1365 ATP-dependent RNA helicas no no 0.683 0.454 0.416 1e-136
A3KMI0 1362 ATP-dependent RNA helicas N/A no 0.666 0.444 0.419 1e-134
Q08211 1270 ATP-dependent RNA helicas no no 0.683 0.488 0.400 1e-130
Q5R874 1269 ATP-dependent RNA helicas no no 0.683 0.489 0.400 1e-130
Q28141 1287 ATP-dependent RNA helicas no no 0.677 0.477 0.404 1e-129
>sp|Q9H2U1|DHX36_HUMAN Probable ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 Back     alignment and function desciption
 Score =  614 bits (1583), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 310/624 (49%), Positives = 429/624 (68%), Gaps = 22/624 (3%)

Query: 274 MLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNI 333
           M  FREKLP++ M+ E +  +  +QV V+SGETGCGKTTQ+ QFIL+  +   +G+ C I
Sbjct: 200 MQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRI 259

Query: 334 ICTQPRRISAISVAARVSSERGENLG--ETVGYQIRLESKR-SAQTRLLFCTTGVLLRQL 390
           +CTQPRRISAISVA RV++ER E+ G   + GYQIRL+S+    Q  +L+CTTG++L+ L
Sbjct: 260 VCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWL 319

Query: 391 VEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFG 450
             DP LS VSH+++DEIHER +  D L+ +++DLL  R DL++ILMSAT+NA+ FS+YFG
Sbjct: 320 QSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDLKVILMSATLNAEKFSEYFG 379

Query: 451 NAPTVHIPGLTFPVTDLFLEDVLEKTRY-------KMNSKLDSFQGNSRRSRRQDSKKDH 503
           N P +HIPG TFPV +  LEDV+EK RY       +   K    QG+  R  +++ +   
Sbjct: 380 NCPMIHIPGFTFPVVEYLLEDVIEKIRYVPEQKEHRSQFKRGFMQGHVNRQEKEEKE--- 436

Query: 504 LTALFEDVDID---SNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVF 560
             A++++   D      + Y AST   +E    +++DL L+ + I YI   E DGAILVF
Sbjct: 437 --AIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIRYIVLEEEDGAILVF 494

Query: 561 LTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNI 620
           L GW++IS L D + +++ +   +KFL++PLH  MPT+NQ ++F R PP  RKIV+ATNI
Sbjct: 495 LPGWDNISTLHDLL-MSQVMFKSDKFLIIPLHSLMPTVNQTQVFKRTPPGVRKIVIATNI 553

Query: 621 AESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYK 680
           AE+SITIDDVVYV+D GK KET +D  N ++ +   W+SKA+A QR+GRAGRVQPG CY 
Sbjct: 554 AETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQPGHCYH 613

Query: 681 LYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIEL 740
           LY  +    +  YQLPEILRTPL+ELCL IK L+LG +  FLS+ + PP   AV  +I  
Sbjct: 614 LYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMDPPSNEAVLLSIRH 673

Query: 741 LKTIGALDDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVL 800
           L  + ALD  E LTPLG HL  LPV+P+IGKM+L GA+F CL+P LTIAA+L+ ++PFV+
Sbjct: 674 LMELNALDKQEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLTIAASLSFKDPFVI 733

Query: 801 PVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDAKRN--RRERDFCWENFLSPITLQM 858
           P+  +K  D  ++  A D+ SDH+ ++ AF+G+++A+R   R E+D+CWE FLS  TLQM
Sbjct: 734 PLGKEKIADARRKELAKDTRSDHLTVVNAFEGWEEARRRGFRYEKDYCWEYFLSSNTLQM 793

Query: 859 MEDMRSQFLDLLSDIGFVDKSKGP 882
           + +M+ QF + L   GFV  S+ P
Sbjct: 794 LHNMKGQFAEHLLGAGFV-SSRNP 816
Plays a role in degradation and deadenylation of mRNAs containing in their 3'-UTR the consensus ARE sequence element. May function in sex development and spermatogenesis.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q8VHK9|DHX36_MOUSE Probable ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=2 SV=2 Back     alignment and function description
>sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 Back     alignment and function description
>sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=2 SV=2 Back     alignment and function description
>sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 Back     alignment and function description
>sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=2 SV=1 Back     alignment and function description
>sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 Back     alignment and function description
>sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 Back     alignment and function description
>sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 Back     alignment and function description
>sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query908
255566157994 ATP-dependent RNA helicase, putative [Ri 0.888 0.811 0.802 0.0
449501156999 PREDICTED: probable ATP-dependent RNA he 0.871 0.791 0.790 0.0
359481069991 PREDICTED: probable ATP-dependent RNA he 0.868 0.796 0.8 0.0
4494374761000 PREDICTED: probable ATP-dependent RNA he 0.871 0.791 0.790 0.0
224138290 1022 predicted protein [Populus trichocarpa] 0.870 0.772 0.764 0.0
356534552990 PREDICTED: probable ATP-dependent RNA he 0.867 0.795 0.778 0.0
30686606995 helicase associated domain-containing pr 0.868 0.792 0.758 0.0
4510377993 putative ATP-dependent RNA helicase A [A 0.866 0.792 0.757 0.0
297823399996 helicase domain-containing protein [Arab 0.859 0.783 0.749 0.0
356498671989 PREDICTED: probable ATP-dependent RNA he 0.860 0.789 0.754 0.0
>gi|255566157|ref|XP_002524066.1| ATP-dependent RNA helicase, putative [Ricinus communis] gi|223536634|gb|EEF38276.1| ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1353 bits (3502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/812 (80%), Positives = 722/812 (88%), Gaps = 5/812 (0%)

Query: 93  EQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLAD 152
           EQRWWDPVWRAERLRQQAAEMEV ++NEWW K+E+MK   +QEMI+KR +SR DQQTL+D
Sbjct: 36  EQRWWDPVWRAERLRQQAAEMEVLNENEWWDKMEKMKNSGDQEMIVKRNYSRTDQQTLSD 95

Query: 153 MAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSS 212
           MA+QLGL+FHAYNKGKAL VSKVPLP YR DLDERHGS +KE+QMS ETE+RV NLLN +
Sbjct: 96  MAYQLGLYFHAYNKGKALVVSKVPLPNYRADLDERHGSAQKEIQMSTETEKRVKNLLNCT 155

Query: 213 QGNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDSGK 272
           Q   PVNDSG  S +   R     K+   +S  ++DSAKE+L++ LK+R++K  +SDS K
Sbjct: 156 QREAPVNDSGASSGQGDNRSSTGPKITKPVSTIETDSAKEKLSLELKQRRDKTMASDSLK 215

Query: 273 AMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCN 332
            M SFREKLPAFKMK EFLKAVAENQVLV+SGETGCGKTTQLPQ+ILEEE++ LRGADCN
Sbjct: 216 EMQSFREKLPAFKMKGEFLKAVAENQVLVISGETGCGKTTQLPQYILEEEITRLRGADCN 275

Query: 333 IICTQPRRISAISVAARVSSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVE 392
           IICTQPRRISAISVAAR+SSERGENLGETVGYQIRLE+KRSAQT LLFCTTGVLLRQLV+
Sbjct: 276 IICTQPRRISAISVAARISSERGENLGETVGYQIRLEAKRSAQTHLLFCTTGVLLRQLVQ 335

Query: 393 DPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNA 452
           DPDL+ VSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNA
Sbjct: 336 DPDLTGVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADLFSKYFGNA 395

Query: 453 PTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSR--RQDSKKDHLTALFED 510
           PT+HIPGLTFPVT+ FLED+LEK+ YK+ S+ D+F+G SRR R   QDSKKD LT L+ED
Sbjct: 396 PTMHIPGLTFPVTEFFLEDILEKSLYKIQSEPDNFRGTSRRRRRREQDSKKDPLTELYED 455

Query: 511 VDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKL 570
           VDIDS YKNY +STR SLEAWS  Q+DLGLVE+TIEYICRHEG GAILVFLTGW++ISKL
Sbjct: 456 VDIDSEYKNYSSSTRVSLEAWSGSQLDLGLVEATIEYICRHEGGGAILVFLTGWDEISKL 515

Query: 571 LDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDV 630
           LD++K NK LGD +KFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDV
Sbjct: 516 LDRVKGNKLLGDQSKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDV 575

Query: 631 VYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAM 690
           VYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCY+LYP+IIHDAM
Sbjct: 576 VYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYRLYPKIIHDAM 635

Query: 691 LPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDDM 750
           L YQLPEILRTPLQELCLHIKSLQLG VGSFL+KALQPPDPL+VQNAIELLKTIGALDD 
Sbjct: 636 LQYQLPEILRTPLQELCLHIKSLQLGAVGSFLAKALQPPDPLSVQNAIELLKTIGALDDN 695

Query: 751 ENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDE 810
           E LTPLGRHLCTLP+DPNIGKMLLMG +FQCLNPALTIA+ALAHR+PFVLP+ M+ E D 
Sbjct: 696 EELTPLGRHLCTLPLDPNIGKMLLMGCVFQCLNPALTIASALAHRDPFVLPIEMKNEADA 755

Query: 811 AKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLL 870
           AK+SFAGDSCSDHIAL+KAF+GY +AK NR ER FCWENFLSPITL+MMEDMR QFL+LL
Sbjct: 756 AKQSFAGDSCSDHIALVKAFEGYMEAKCNRNERAFCWENFLSPITLRMMEDMREQFLNLL 815

Query: 871 SDIGFVDKSKGPSVRSYIFYYYRKLSIPSPLL 902
           SDIGFVDKSKG S  +    Y   L + S +L
Sbjct: 816 SDIGFVDKSKGASAYN---QYSHDLEMVSAIL 844

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449501156|ref|XP_004161293.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359481069|ref|XP_002264021.2| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449437476|ref|XP_004136518.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224138290|ref|XP_002322777.1| predicted protein [Populus trichocarpa] gi|222867407|gb|EEF04538.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356534552|ref|XP_003535817.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Glycine max] Back     alignment and taxonomy information
>gi|30686606|ref|NP_850255.1| helicase associated domain-containing protein [Arabidopsis thaliana] gi|330254083|gb|AEC09177.1| helicase associated domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4510377|gb|AAD21465.1| putative ATP-dependent RNA helicase A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297823399|ref|XP_002879582.1| helicase domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325421|gb|EFH55841.1| helicase domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356498671|ref|XP_003518173.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query908
TAIR|locus:2039280 995 AT2G35920 [Arabidopsis thalian 0.875 0.798 0.721 1.69999999999e-313
TAIR|locus:2008144 1206 AT1G48650 [Arabidopsis thalian 0.852 0.641 0.479 3.5e-194
TAIR|locus:504954904 1161 ABO6 "ABA overly sensitive 6" 0.854 0.668 0.492 3.1e-193
TAIR|locus:2038796 1113 AT2G01130 [Arabidopsis thalian 0.853 0.696 0.460 1e-180
UNIPROTKB|E7EWK3797 DHX36 "Probable ATP-dependent 0.686 0.781 0.460 2.8e-146
UNIPROTKB|Q9H2U1 1008 DHX36 "Probable ATP-dependent 0.686 0.618 0.460 2.8e-146
MGI|MGI:1919412 1001 Dhx36 "DEAH (Asp-Glu-Ala-His) 0.810 0.735 0.406 9.3e-146
UNIPROTKB|Q05B79 1010 DHX36 "Uncharacterized protein 0.699 0.628 0.452 1.2e-145
RGD|1308767 1000 Dhx36 "DEAH (Asp-Glu-Ala-His) 0.810 0.736 0.408 1.5e-145
UNIPROTKB|F6V8H1 1122 DHX36 "Uncharacterized protein 0.699 0.565 0.449 3.2e-145
TAIR|locus:2039280 AT2G35920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3007 (1063.6 bits), Expect = 1.7e-313, P = 1.7e-313
 Identities = 579/802 (72%), Positives = 673/802 (83%)

Query:    93 EQRWWDPVWRAERLRQQAAEMEVFDQNEWWGKLEQMKRGEEQEMIIKRKFSRADQQTLAD 152
             EQRWWDPVWRAERLRQQ AEMEV D+NEWW K+EQ K G EQEM+IKR FSR DQQTL+D
Sbjct:    39 EQRWWDPVWRAERLRQQQAEMEVLDENEWWNKIEQWKTGGEQEMLIKRNFSRGDQQTLSD 98

Query:   153 MAHQLGLHFHAYNKGKALAVSKVPLPMYRPDLDERHGSTEKELQMSIETERRVGNLLNSS 212
             MA Q+GL+FHAYNKGKAL VSKVPLP YR DLDERHGST+KE++MS ETER++G+LL ++
Sbjct:    99 MALQMGLYFHAYNKGKALVVSKVPLPDYRADLDERHGSTQKEIKMSTETERKLGSLLKTT 158

Query:   213 Q--GNVPVNDSGIESSEVARRPKLSVKVANTISPPQSDSAKERLNVILKERQEKLKSSDS 270
             Q  G+   + S     +  R   L +K  ++ S       KE+ +  LKERQEKLK+++S
Sbjct:   159 QESGSSGASASAFNDQQ-DRTSTLGLKRPDSASKLPDSLEKEKFSFALKERQEKLKATES 217

Query:   271 GKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGAD 330
              KA+ +FREKLPAFKMK EFL +V++NQVLVVSGETGCGKTTQLPQFILEEE+SSLRGAD
Sbjct:   218 VKALKAFREKLPAFKMKEEFLNSVSQNQVLVVSGETGCGKTTQLPQFILEEEISSLRGAD 277

Query:   331 CNIICTQPXXXXXXXXXXXXXXERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQL 390
             CNIICTQP              ERGE++GE+VGYQIRLESKRS QTRLLFCTTGVLLR+L
Sbjct:   278 CNIICTQPRRISAISVASRISAERGESIGESVGYQIRLESKRSDQTRLLFCTTGVLLRRL 337

Query:   391 VEDPDLSCVSHLLVDEIHERGMNEDFXXXXXXXXXXXXXXXXXXXMSATINADLFSKYFG 450
             +EDP+L+ VSHLLVDEIHERGMNEDF                   MSATINAD+FS YFG
Sbjct:   338 IEDPNLTNVSHLLVDEIHERGMNEDFLLIILRDLLPRRPDLRLILMSATINADMFSTYFG 397

Query:   451 NAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDS--FQGNXXXXXXQ-DSKKDHLTAL 507
             N+PT+HIPG TFPV +LFLEDVLEK+RY + S  DS  +QG+      + +SKKD LT L
Sbjct:   398 NSPTMHIPGFTFPVAELFLEDVLEKSRYNIKSS-DSGNYQGSSRGRRRESESKKDDLTTL 456

Query:   508 FEDVDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDI 567
             FED+DI+S+YK+Y ++TR SLEAWS  QID+ LVE+TIE+ICR EG GAILVFLTGW++I
Sbjct:   457 FEDIDINSHYKSYSSATRNSLEAWSGAQIDVDLVEATIEHICRLEGGGAILVFLTGWDEI 516

Query:   568 SKLLDQIKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITI 627
             SKLL++I +N FLGD +KFLVLPLHGSMPT+NQREIFDRPPPNKRKIVLATNIAESSITI
Sbjct:   517 SKLLEKINMNNFLGDSSKFLVLPLHGSMPTVNQREIFDRPPPNKRKIVLATNIAESSITI 576

Query:   628 DDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIH 687
             DDVVYVVDCGKAKETSYDALNK+ACLLPSWISKASAHQRRGRAGRVQ GVCY+LYP++I+
Sbjct:   577 DDVVYVVDCGKAKETSYDALNKVACLLPSWISKASAHQRRGRAGRVQAGVCYRLYPKVIY 636

Query:   688 DAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGAL 747
             DA   YQLPEI+RTPLQELCLHIKSLQ+G++GSFL+KALQPPD LAV+NAIELLKTIGAL
Sbjct:   637 DAFPQYQLPEIIRTPLQELCLHIKSLQVGSIGSFLAKALQPPDALAVENAIELLKTIGAL 696

Query:   748 DDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKE 807
             +D+E LTPLGRHLCTLPVDPNIGKMLL+GAIFQC+NPALTIAAALA+R+PFVLP+N ++E
Sbjct:   697 NDVEELTPLGRHLCTLPVDPNIGKMLLIGAIFQCVNPALTIAAALAYRSPFVLPLNRKEE 756

Query:   808 VDEAKRSFAGDSCSDHIALLKAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFL 867
              DEAKR FAGDSCSDHIALLKA++GY+DAKR   E+DFCW+NFLSP+TL+MMEDMR+QFL
Sbjct:   757 ADEAKRYFAGDSCSDHIALLKAYEGYRDAKRGGNEKDFCWQNFLSPVTLRMMEDMRNQFL 816

Query:   868 DLLSDIGFVDKSKGPSVRSYIF 889
             DLLSDIGFVDKSK  +   Y +
Sbjct:   817 DLLSDIGFVDKSKPNAYNQYSY 838
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0004386 "helicase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
TAIR|locus:2008144 AT1G48650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954904 ABO6 "ABA overly sensitive 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038796 AT2G01130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E7EWK3 DHX36 "Probable ATP-dependent RNA helicase DHX36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2U1 DHX36 "Probable ATP-dependent RNA helicase DHX36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1919412 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B79 DHX36 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1308767 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6V8H1 DHX36 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.13LOW CONFIDENCE prediction!
3rd Layer3.6.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00160626
hypothetical protein (1022 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query908
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-110
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 2e-99
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 3e-90
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 7e-79
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 4e-40
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 4e-35
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 3e-34
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 3e-33
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 2e-29
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 3e-23
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 4e-23
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 9e-23
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 2e-16
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-15
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-14
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-11
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 7e-09
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-07
pfam1096191 pfam10961, DUF2763, Protein of unknown function (D 5e-07
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 7e-07
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-06
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 3e-06
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 3e-06
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 6e-06
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-05
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-05
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 3e-05
pfam0717291 pfam07172, GRP, Glycine rich protein family 3e-05
pfam12810248 pfam12810, Gly_rich, Glycine rich protein 1e-04
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 2e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 2e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 2e-04
pfam1386576 pfam13865, FoP_duplication, C-terminal duplication 2e-04
COG1512271 COG1512, COG1512, Beta-propeller domains of methan 2e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 3e-04
PTZ00070257 PTZ00070, PTZ00070, 40S ribosomal protein S2; Prov 3e-04
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 4e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 5e-04
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 6e-04
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 8e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 8e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 0.001
pfam1175961 pfam11759, KRTAP, Keratin-associated matrix 0.001
PLN03138796 PLN03138, PLN03138, Protein TOC75; Provisional 0.001
pfam0717291 pfam07172, GRP, Glycine rich protein family 0.002
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 0.002
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 0.002
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.003
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information 
 Score =  368 bits (947), Expect = e-110
 Identities = 211/641 (32%), Positives = 333/641 (51%), Gaps = 78/641 (12%)

Query: 243 SPPQSDSAKERLNVILKERQ---EKLKSSDSGKAMLSFREKLPAFKMKAEFLKAVAENQV 299
                D A   L    +      +K+++       + + + LP    + +  +A+AENQV
Sbjct: 25  KDHDQDRAIAALAKFRERIDAACDKVEARRQAVPEIRYPDNLPVSAKREDIAEAIAENQV 84

Query: 300 LVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARVSSERGENLG 359
           ++++GETG GKTTQLP+  LE    S  G    I  TQPRR++A +VA R++ E G  LG
Sbjct: 85  VIIAGETGSGKTTQLPKICLELGRGS-HGL---IGHTQPRRLAARTVAQRIAEELGTPLG 140

Query: 360 ETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLI 419
           E VGY++R   + S+ T +   T G+LL +  +D  LS    +++DE HER +N DFLL 
Sbjct: 141 EKVGYKVRFHDQVSSNTLVKLMTDGILLAETQQDRFLSRYDTIIIDEAHERSLNIDFLLG 200

Query: 420 ILRDLLPRRPDLRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYK 479
            L+ LLPRRPDL++I+ SATI+ + FS++F NAP + + G T+PV          + RY+
Sbjct: 201 YLKQLLPRRPDLKIIITSATIDPERFSRHFNNAPIIEVSGRTYPV----------EVRYR 250

Query: 480 MNSKLDSFQGNSRRSRRQDSKKDHLTALFEDVDIDSNYKNYRASTRASLEAWSAEQIDLG 539
               L   Q         D   D L A+ + VD                           
Sbjct: 251 ---PLVEEQE--------DDDLDQLEAILDAVD--------------------------E 273

Query: 540 LVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLHGSMPTIN 599
           L           EG G IL+FL G  +I    + ++            +LPL+  +    
Sbjct: 274 LFA---------EGPGDILIFLPGEREIRDAAEILRKRNLRHTE----ILPLYARLSNKE 320

Query: 600 QREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWIS 659
           Q+ +F   P + R+IVLATN+AE+S+T+  + YV+D G A+ + Y    K+  L    IS
Sbjct: 321 QQRVFQ--PHSGRRIVLATNVAETSLTVPGIHYVIDTGTARISRYSYRTKVQRLPIEPIS 378

Query: 660 KASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVG 719
           +ASA+QR+GR GRV PG+C +LY     ++   +  PEILRT L  + L + +L+LG + 
Sbjct: 379 QASANQRKGRCGRVAPGICIRLYSEEDFNSRPEFTDPEILRTNLASVILQMLALRLGDIA 438

Query: 720 SFLSKALQPPDPLAVQNAIELLKTIGALDDME---NLTPLGRHLCTLPVDPNIGKMLLMG 776
           +F    ++ PDP A+++   LL+ +GALDD E    LTP+GR L  LPVDP + +MLL  
Sbjct: 439 AF--PFIEAPDPRAIRDGFRLLEELGALDDDEAEPQLTPIGRQLAQLPVDPRLARMLLEA 496

Query: 777 AIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLKAFDGYKDA 836
               CL   L IA+AL+ ++P   P+  Q+  D+A   F  D  SD ++ +  +   ++ 
Sbjct: 497 HRLGCLQEVLIIASALSIQDPRERPMEKQQAADQAHARFK-DPRSDFLSRVNLWRHIEEQ 555

Query: 837 KRNRRE---RDFCWENFLSPITLQMMEDMRSQFLDLLSDIG 874
           ++       R+ C + +L+ + ++  +D+  Q   ++ ++G
Sbjct: 556 RQALSANQFRNACRKQYLNYLRVREWQDIYRQLTQVVKELG 596

This model represents HrpA, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterized, is about 800 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing [Unknown function, Enzymes of unknown specificity]. Length = 1283
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|220915 pfam10961, DUF2763, Protein of unknown function (DUF2763) Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|221784 pfam12810, Gly_rich, Glycine rich protein Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|222425 pfam13865, FoP_duplication, C-terminal duplication domain of Friend of PRMT1 Back     alignment and domain information
>gnl|CDD|224429 COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only] Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|240255 PTZ00070, PTZ00070, 40S ribosomal protein S2; Provisional Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|221210 pfam11759, KRTAP, Keratin-associated matrix Back     alignment and domain information
>gnl|CDD|215598 PLN03138, PLN03138, Protein TOC75; Provisional Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 908
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00110545 helicase; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0354746 consensus DEAD-box like helicase [General function 99.98
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
PRK09401 1176 reverse gyrase; Reviewed 99.97
PHA02558501 uvsW UvsW helicase; Provisional 99.97
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.96
PRK13766773 Hef nuclease; Provisional 99.96
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.96
PRK14701 1638 reverse gyrase; Provisional 99.96
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.95
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.95
COG1205 851 Distinct helicase family with a unique C-terminal 99.95
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.95
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.94
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.94
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.94
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.94
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.94
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.94
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.94
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.93
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.93
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.93
PRK05580679 primosome assembly protein PriA; Validated 99.92
PRK09694878 helicase Cas3; Provisional 99.92
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.91
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.91
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.91
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.9
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.9
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.89
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.89
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.89
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.87
PRK04914 956 ATP-dependent helicase HepA; Validated 99.87
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.86
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.83
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.81
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.8
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.79
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.79
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.77
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.76
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.74
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.73
COG4096 875 HsdR Type I site-specific restriction-modification 99.72
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.67
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.66
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.66
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.65
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.63
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.58
smart00487201 DEXDc DEAD-like helicases superfamily. 99.54
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.53
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.52
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.5
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.47
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.45
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.44
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.42
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.42
PRK05298652 excinuclease ABC subunit B; Provisional 99.41
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.41
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.4
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.37
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.36
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.32
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.31
KOG1123776 consensus RNA polymerase II transcription initiati 99.29
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.27
smart0049082 HELICc helicase superfamily c-terminal domain. 99.23
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.22
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.11
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.09
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.08
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.06
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.02
COG4889 1518 Predicted helicase [General function prediction on 98.88
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.86
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.8
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.79
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.77
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.74
KOG0387923 consensus Transcription-coupled repair protein CSB 98.73
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.7
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.65
PRK14873665 primosome assembly protein PriA; Provisional 98.63
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.57
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.48
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.36
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.23
KOG2340698 consensus Uncharacterized conserved protein [Funct 98.11
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.11
COG0610962 Type I site-specific restriction-modification syst 98.08
PF1324576 AAA_19: Part of AAA domain 98.01
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.0
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 97.99
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.93
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.89
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 97.89
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.85
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.77
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.75
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.72
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.63
KOG1803649 consensus DNA helicase [Replication, recombination 97.62
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.6
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.6
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.6
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.55
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.53
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.53
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 97.47
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.47
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.47
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.46
cd0600759 R3H_DEXH_helicase R3H domain of a group of protein 97.44
PRK15483 986 type III restriction-modification system StyLTI en 97.44
cd0264060 R3H_NRF R3H domain of the NF-kappaB-repression fac 97.43
PRK10536262 hypothetical protein; Provisional 97.41
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.4
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.37
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.36
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.32
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.23
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.22
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.21
PRK13889988 conjugal transfer relaxase TraA; Provisional 97.21
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.21
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.17
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.13
KOG4439901 consensus RNA polymerase II transcription terminat 97.11
PF05729166 NACHT: NACHT domain 97.11
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.08
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.02
PRK06526254 transposase; Provisional 97.01
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.0
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 96.95
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.93
PRK04296190 thymidine kinase; Provisional 96.89
PRK14974336 cell division protein FtsY; Provisional 96.88
PRK08181269 transposase; Validated 96.83
cd0264160 R3H_Smubp-2_like R3H domain of Smubp-2_like protei 96.8
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.73
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.69
PHA03333752 putative ATPase subunit of terminase; Provisional 96.61
TIGR00376637 DNA helicase, putative. The gene product may repre 96.6
smart00382148 AAA ATPases associated with a variety of cellular 96.54
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.51
PRK07952244 DNA replication protein DnaC; Validated 96.45
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 96.39
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.35
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 96.35
PRK06835329 DNA replication protein DnaC; Validated 96.29
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.25
PRK09112351 DNA polymerase III subunit delta'; Validated 96.25
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.23
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.17
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 96.16
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.16
PTZ00146293 fibrillarin; Provisional 96.09
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.0
COG3587 985 Restriction endonuclease [Defense mechanisms] 95.97
PRK00771437 signal recognition particle protein Srp54; Provisi 95.96
PF13173128 AAA_14: AAA domain 95.92
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 95.88
PTZ001121164 origin recognition complex 1 protein; Provisional 95.87
PRK10416318 signal recognition particle-docking protein FtsY; 95.86
PRK11054684 helD DNA helicase IV; Provisional 95.79
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.78
PRK06893229 DNA replication initiation factor; Validated 95.78
PHA02533534 17 large terminase protein; Provisional 95.78
PRK07471365 DNA polymerase III subunit delta'; Validated 95.78
PRK05642234 DNA replication initiation factor; Validated 95.77
PRK09183259 transposase/IS protein; Provisional 95.73
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.72
PTZ00146293 fibrillarin; Provisional 95.71
PRK08727233 hypothetical protein; Validated 95.7
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 95.7
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 95.69
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.69
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.68
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 95.67
PRK08116268 hypothetical protein; Validated 95.64
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 95.61
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.6
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.6
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 95.59
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 95.59
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.58
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 95.58
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 95.57
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.54
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.49
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 95.49
TIGR00064272 ftsY signal recognition particle-docking protein F 95.47
cd0264658 R3H_G-patch R3H domain of a group of fungal and pl 95.46
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.39
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 95.36
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.35
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.35
PRK05707328 DNA polymerase III subunit delta'; Validated 95.32
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.31
PRK08084235 DNA replication initiation factor; Provisional 95.3
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.29
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.28
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.26
PRK10867433 signal recognition particle protein; Provisional 95.21
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 95.17
PHA03368738 DNA packaging terminase subunit 1; Provisional 95.11
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 95.1
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.09
PRK12402337 replication factor C small subunit 2; Reviewed 95.08
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.08
PRK00149450 dnaA chromosomal replication initiation protein; R 95.02
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 95.02
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.0
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 95.0
PRK12377248 putative replication protein; Provisional 94.98
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.97
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 94.93
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 94.92
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 94.9
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 94.86
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 94.86
TIGR00959428 ffh signal recognition particle protein. This mode 94.81
PRK13833323 conjugal transfer protein TrbB; Provisional 94.76
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.76
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.75
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 94.7
PRK14087450 dnaA chromosomal replication initiation protein; P 94.66
PF00004132 AAA: ATPase family associated with various cellula 94.56
cd0263960 R3H_RRM R3H domain of mainly fungal proteins which 94.52
PRK08939306 primosomal protein DnaI; Reviewed 94.51
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.49
PRK06921266 hypothetical protein; Provisional 94.47
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.47
PRK08769319 DNA polymerase III subunit delta'; Validated 94.43
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.37
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 94.3
COG3973747 Superfamily I DNA and RNA helicases [General funct 94.28
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.27
TIGR02928365 orc1/cdc6 family replication initiation protein. M 94.24
PRK06964342 DNA polymerase III subunit delta'; Validated 94.22
cd03115173 SRP The signal recognition particle (SRP) mediates 94.16
PRK07940394 DNA polymerase III subunit delta'; Validated 94.14
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 94.13
COG2256436 MGS1 ATPase related to the helicase subunit of the 94.1
PRK14088440 dnaA chromosomal replication initiation protein; P 94.04
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 94.03
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 94.02
COG0470325 HolB ATPase involved in DNA replication [DNA repli 93.99
PRK13851344 type IV secretion system protein VirB11; Provision 93.99
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 93.97
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 93.97
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 93.95
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.92
KOG18051100 consensus DNA replication helicase [Replication, r 93.92
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 93.89
PRK12422445 chromosomal replication initiation protein; Provis 93.88
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 93.72
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 93.68
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 93.65
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 93.64
PRK06871325 DNA polymerase III subunit delta'; Validated 93.56
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.47
COG4626546 Phage terminase-like protein, large subunit [Gener 93.45
PHA02544316 44 clamp loader, small subunit; Provisional 93.42
PLN03025319 replication factor C subunit; Provisional 93.29
cd01124187 KaiC KaiC is a circadian clock protein primarily f 93.21
CHL00181287 cbbX CbbX; Provisional 93.2
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 93.2
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 93.16
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.12
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 93.05
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 93.01
PRK00440319 rfc replication factor C small subunit; Reviewed 92.95
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 92.95
PRK13342413 recombination factor protein RarA; Reviewed 92.95
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 92.94
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 92.91
PRK07993334 DNA polymerase III subunit delta'; Validated 92.83
KOG1132945 consensus Helicase of the DEAD superfamily [Replic 92.83
PRK14086617 dnaA chromosomal replication initiation protein; P 92.76
TIGR00767415 rho transcription termination factor Rho. Members 92.75
PRK07399314 DNA polymerase III subunit delta'; Validated 92.65
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.64
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 92.6
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.53
PHA00729226 NTP-binding motif containing protein 92.5
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.41
PRK04195482 replication factor C large subunit; Provisional 92.37
PRK08058329 DNA polymerase III subunit delta'; Validated 92.35
PRK06620214 hypothetical protein; Validated 92.32
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 92.29
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 92.22
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 92.19
PTZ00293211 thymidine kinase; Provisional 91.92
PRK11823446 DNA repair protein RadA; Provisional 91.86
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.84
PRK09087226 hypothetical protein; Validated 91.82
PRK06090319 DNA polymerase III subunit delta'; Validated 91.72
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 91.66
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 91.55
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.5
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 91.5
PRK08699325 DNA polymerase III subunit delta'; Validated 91.47
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 91.46
KOG2028554 consensus ATPase related to the helicase subunit o 91.44
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.34
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 91.2
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 91.03
KOG1131 755 consensus RNA polymerase II transcription initiati 91.01
PRK05564313 DNA polymerase III subunit delta'; Validated 90.97
PRK06067234 flagellar accessory protein FlaH; Validated 90.94
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 90.9
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 90.86
cd01393226 recA_like RecA is a bacterial enzyme which has rol 90.65
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 90.54
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 90.52
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 90.46
PRK10865857 protein disaggregation chaperone; Provisional 90.45
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 90.3
PRK13341725 recombination factor protein RarA/unknown domain f 90.25
cd03246173 ABCC_Protease_Secretion This family represents the 90.25
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 89.99
PF1355562 AAA_29: P-loop containing region of AAA domain 89.95
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 89.94
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 89.92
COG0552340 FtsY Signal recognition particle GTPase [Intracell 89.89
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 89.89
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 89.74
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 89.62
TIGR02688449 conserved hypothetical protein TIGR02688. Members 89.6
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 89.42
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 89.37
KOG2543438 consensus Origin recognition complex, subunit 5 [R 89.37
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 89.36
PRK09376416 rho transcription termination factor Rho; Provisio 89.29
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 89.13
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 89.11
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 89.11
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 89.04
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 88.99
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 88.95
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 88.84
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 88.82
cd03216163 ABC_Carb_Monos_I This family represents the domain 88.74
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 88.7
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 88.43
cd01128249 rho_factor Transcription termination factor rho is 88.42
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 88.41
KOG2036 1011 consensus Predicted P-loop ATPase fused to an acet 88.39
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 88.35
PF12846304 AAA_10: AAA-like domain 88.34
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 88.28
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 88.24
PRK05580 679 primosome assembly protein PriA; Validated 88.18
smart0039379 R3H Putative single-stranded nucleic acids-binding 87.88
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 87.78
PRK09354349 recA recombinase A; Provisional 87.77
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 87.54
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 87.52
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 87.41
PRK03992389 proteasome-activating nucleotidase; Provisional 87.28
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 87.13
PF05894333 Podovirus_Gp16: Podovirus DNA encapsidation protei 87.09
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 87.07
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 87.03
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 86.86
PF0142463 R3H: R3H domain; InterPro: IPR001374 The R3H motif 86.83
PHA00149331 DNA encapsidation protein 86.74
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 86.7
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 86.56
TIGR00595 505 priA primosomal protein N'. All proteins in this f 86.54
KOG0780483 consensus Signal recognition particle, subunit Srp 86.45
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 86.43
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 86.01
PRK13764602 ATPase; Provisional 85.98
PRK10436462 hypothetical protein; Provisional 85.95
PRK05917290 DNA polymerase III subunit delta'; Validated 85.95
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 85.94
PRK04841 903 transcriptional regulator MalT; Provisional 85.76
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 85.67
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 85.55
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 85.45
cd03239178 ABC_SMC_head The structural maintenance of chromos 85.42
KOG0347 731 consensus RNA helicase [RNA processing and modific 85.2
TIGR00643630 recG ATP-dependent DNA helicase RecG. 85.15
COG1126240 GlnQ ABC-type polar amino acid transport system, A 85.1
KOG2228408 consensus Origin recognition complex, subunit 4 [R 85.05
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 85.01
COG2255332 RuvB Holliday junction resolvasome, helicase subun 85.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 84.79
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 84.75
TIGR02533486 type_II_gspE general secretory pathway protein E. 84.51
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 84.51
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 84.4
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 84.35
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 84.1
PRK14873 665 primosome assembly protein PriA; Provisional 84.1
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 84.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 83.88
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 83.88
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 83.59
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 83.52
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 83.48
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 83.39
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 83.38
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 83.34
PRK05973237 replicative DNA helicase; Provisional 83.31
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 83.26
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 83.1
CHL00176638 ftsH cell division protein; Validated 83.02
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 83.01
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 82.9
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 82.9
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 82.82
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 82.81
PRK05298652 excinuclease ABC subunit B; Provisional 82.79
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 82.73
COG0593408 DnaA ATPase involved in DNA replication initiation 82.73
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 82.69
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 82.67
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 82.56
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 82.38
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 82.25
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 82.23
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 82.23
PRK04328249 hypothetical protein; Provisional 82.16
smart00491142 HELICc2 helicase superfamily c-terminal domain. 82.05
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 81.9
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 81.79
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=1e-113  Score=950.32  Aligned_cols=561  Identities=41%  Similarity=0.669  Sum_probs=515.6

Q ss_pred             HHHHHHhhcCCCchHHHHHHHHHHHhCCeEEEEecCCCCccchHHHHHHHHHHhccCCCCcEEEEEcccHHHHHHHHHHH
Q 002552          271 GKAMLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNIICTQPRRISAISVAARV  350 (908)
Q Consensus       271 ~~~~~~~r~~lpi~~~Q~~~i~~i~~~~~vii~a~TGSGKTt~~~~~il~~~~~~~~~~~~~ilv~~P~r~la~qi~~rv  350 (908)
                      ..++.++|+.|||++++.+++..+.+++++||.|+||||||||+||++++..+.+    .++|.||||||++|+++|+||
T Consensus        40 ~~~i~~qR~~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~----~g~I~~TQPRRVAavslA~RV  115 (674)
T KOG0922|consen   40 NLSIQEQRESLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFAS----SGKIACTQPRRVAAVSLAKRV  115 (674)
T ss_pred             ccCHHHhhccCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhccccc----CCcEEeecCchHHHHHHHHHH
Confidence            3457788999999999999999999999999999999999999999999998764    345999999999999999999


Q ss_pred             HHHhCCCCCCEEeEEeeccccCCCCCcEEEEchHHHHHHHhcCCCCCcceEEEEechhccchhhHHHHHHHHHHCccCCC
Q 002552          351 SSERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVEDPDLSCVSHLLVDEIHERGMNEDFLLIILRDLLPRRPD  430 (908)
Q Consensus       351 ~~~~~~~~g~~vg~~~~~~~~~~~~~~Iiv~T~g~Ll~~l~~~~~l~~~~~iIiDEaHeR~~~~d~ll~~lk~~~~~~~~  430 (908)
                      +.|++..+|..|||++|+++..+..|+|.|+|+|+|||.+..||.|++|++|||||||||++.+|+++++||.+++++++
T Consensus       116 AeE~~~~lG~~VGY~IRFed~ts~~TrikymTDG~LLRE~l~Dp~LskYsvIIlDEAHERsl~TDiLlGlLKki~~~R~~  195 (674)
T KOG0922|consen  116 AEEMGCQLGEEVGYTIRFEDSTSKDTRIKYMTDGMLLREILKDPLLSKYSVIILDEAHERSLHTDILLGLLKKILKKRPD  195 (674)
T ss_pred             HHHhCCCcCceeeeEEEecccCCCceeEEEecchHHHHHHhcCCccccccEEEEechhhhhhHHHHHHHHHHHHHhcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEecccCChHHHHhhhCCCCccccCCccccceeeehhhHHHhhhcccCcccccccccccccccccchhhhHhhhhhc
Q 002552          431 LRLILMSATINADLFSKYFGNAPTVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNSRRSRRQDSKKDHLTALFED  510 (908)
Q Consensus       431 ~qiIlmSAT~~~~~~~~~f~~~~~i~v~~~~~~v~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  510 (908)
                      +|+|+||||+|++.|++||++++++.|+||.|||++.|+...                           ..|++..    
T Consensus       196 LklIimSATlda~kfS~yF~~a~i~~i~GR~fPVei~y~~~p---------------------------~~dYv~a----  244 (674)
T KOG0922|consen  196 LKLIIMSATLDAEKFSEYFNNAPILTIPGRTFPVEILYLKEP---------------------------TADYVDA----  244 (674)
T ss_pred             ceEEEEeeeecHHHHHHHhcCCceEeecCCCCceeEEeccCC---------------------------chhhHHH----
Confidence            999999999999999999999999999999999999997521                           0111111    


Q ss_pred             ccccccccchhhhhHhhHhhhhhhhhchHHHHHHHHHHHhccCCCcEEEecCCHHHHHHHHHHHHhcc-cCCCCCceEEE
Q 002552          511 VDIDSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNK-FLGDPNKFLVL  589 (908)
Q Consensus       511 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~l~~i~~~~~~g~iLVF~~~~~~i~~l~~~L~~~~-~~~~~~~~~v~  589 (908)
                                                    ....+..|+.++++|+||||+++.++|+.+++.|.+.. .........++
T Consensus       245 ------------------------------~~~tv~~Ih~~E~~GDILvFLtGqeEIe~~~~~l~e~~~~~~~~~~~~~l  294 (674)
T KOG0922|consen  245 ------------------------------ALITVIQIHLTEPPGDILVFLTGQEEIEAACELLRERAKSLPEDCPELIL  294 (674)
T ss_pred             ------------------------------HHHHHHHHHccCCCCCEEEEeCCHHHHHHHHHHHHHHhhhccccCcceee
Confidence                                          23456678888999999999999999999999998631 11111223789


Q ss_pred             eccCCCChHhHHhhhCCCCCCCcEEEEeccccccccCCCCeEEEEeCCCccceeeccccCccccccccccHhhHHHhccc
Q 002552          590 PLHGSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGR  669 (908)
Q Consensus       590 ~lH~~l~~~er~~v~~~f~~g~~kIlvaT~iae~GidIp~v~~VId~g~~k~~~yd~~~~~~~l~~~~iS~~~~~QR~GR  669 (908)
                      ++||.|+.++|.+||+..+.|.+|||+||||||++||||+|.||||+|+.|.+.||+.+++++|...|||++++.||+||
T Consensus       295 ply~aL~~e~Q~rvF~p~p~g~RKvIlsTNIAETSlTI~GI~YVVDsG~vK~~~y~p~~g~~~L~v~~ISkasA~QRaGR  374 (674)
T KOG0922|consen  295 PLYGALPSEEQSRVFDPAPPGKRKVILSTNIAETSLTIDGIRYVVDSGFVKQKKYNPRTGLDSLIVVPISKASANQRAGR  374 (674)
T ss_pred             eecccCCHHHhhccccCCCCCcceEEEEcceeeeeEEecceEEEEcCCceEEEeeccccCccceeEEechHHHHhhhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCcEEEEecChhhHhhcCCCCCCccccCchHHHHHHHhhcCCCchhhhhhccCCCCCHHHHHHHHHHHHHcCCCCC
Q 002552          670 AGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGALDD  749 (908)
Q Consensus       670 aGR~~~G~~~~l~~~~~~~~l~~~~~pei~r~~L~~~~L~~~~l~~~~~~~fl~~~~~~p~~~~v~~al~~L~~~gal~~  749 (908)
                      |||++||+|||||++++|+.|++.++|||+|++|..++|++|+++++++..|  +|+|||+.+++..|++.|..+||||+
T Consensus       375 AGRt~pGkcyRLYte~~~~~~~~~~~PEI~R~~Ls~~vL~Lkalgi~d~l~F--~f~d~P~~~~l~~AL~~L~~lgald~  452 (674)
T KOG0922|consen  375 AGRTGPGKCYRLYTESAYDKMPLQTVPEIQRVNLSSAVLQLKALGINDPLRF--PFIDPPPPEALEEALEELYSLGALDD  452 (674)
T ss_pred             CCCCCCceEEEeeeHHHHhhcccCCCCceeeechHHHHHHHHhcCCCCcccC--CCCCCCChHHHHHHHHHHHhcCcccC
Confidence            9999999999999999999999999999999999999999999999999999  99999999999999999999999999


Q ss_pred             CCCcCc-cccccccccCCchhhHHHHHhhhccChHHHHHHHhhhccCCCCCCccccHHH-HHHHHHhhcCCCCCcHHHHH
Q 002552          750 MENLTP-LGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKE-VDEAKRSFAGDSCSDHIALL  827 (908)
Q Consensus       750 ~~~lT~-lG~~~~~lpl~p~~~k~l~~~~~~~c~~~~l~i~a~l~~~~~f~~p~~~~~~-~~~~~~~~~~~~~sD~l~~l  827 (908)
                      ++.||. +|+.|+.||++|.++|||+.+..++|++++++|||+|++.++|..|.+.+.+ ++..|.+|+ +..+||+++|
T Consensus       453 ~g~lt~p~G~~ma~~Pl~p~lsk~ll~s~~~gc~~e~l~i~a~Lsv~~~f~~p~~~~~~~a~~~~~kf~-~~eGDh~tlL  531 (674)
T KOG0922|consen  453 RGKLTSPLGRQMAELPLEPHLSKMLLKSSELGCSEEILTIAAMLSVQSVFSRPKDKKAEDADRKRAKFA-NPEGDHLTLL  531 (674)
T ss_pred             cCCcCchHHhhhhhcCCCcchhhhhhhccccCCcchhhhheeeeeccceecCccchhhhhhhHHHHhhc-CcccCHHHHH
Confidence            999998 9999999999999999999999999999999999999999999999988777 888999998 5678999999


Q ss_pred             HHHHHHHHHHcCCcHHHHHHHhcCCHHHHHHHHHHHHHHHHHHHhCCCCcCCCCCCccchhhhhcccCCCChhhh
Q 002552          828 KAFDGYKDAKRNRRERDFCWENFLSPITLQMMEDMRSQFLDLLSDIGFVDKSKGPSVRSYIFYYYRKLSIPSPLL  902 (908)
Q Consensus       828 ~~f~~w~~~~~~~~~~~~c~~~~l~~~~l~~~~~~r~ql~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  902 (908)
                      ++|+.|.+   ++..++||++|||+.+.|+.+.++|+||..++.+.++...+++.+.....-+...+++-|.|.+
T Consensus       532 ~vy~~~~~---~~~~~~wC~en~i~~r~l~~a~~ir~QL~~i~~~~~~~~~s~~~d~~~i~k~l~aGff~N~A~~  603 (674)
T KOG0922|consen  532 NVYESWKE---NGTSKKWCKENFINARSLKRAKDIRKQLRRILDKFGLPVSSCGGDMEKIRKCLCAGFFRNVAER  603 (674)
T ss_pred             HHHHHHHh---cCChhhHHHHhcccHHHHHHHHHHHHHHHHHHHHcCCCccCCCCCHHHHHHHHHHHHHHHHHHh
Confidence            99999998   5667899999999999999999999999999999999998887776555555555555555443

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>cd02640 R3H_NRF R3H domain of the NF-kappaB-repression factor (NRF) Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd02641 R3H_Smubp-2_like R3H domain of Smubp-2_like proteins Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd02646 R3H_G-patch R3H domain of a group of fungal and plant proteins with unknown function, who also contain a G-patch domain Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd02639 R3H_RRM R3H domain of mainly fungal proteins which are associated with a RNA recognition motif (RRM) domain Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>smart00393 R3H Putative single-stranded nucleic acids-binding domain Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PF05894 Podovirus_Gp16: Podovirus DNA encapsidation protein (Gp16); InterPro: IPR008784 This family consists of several DNA encapsidation protein (Gp16) sequences from the phi-29-like viruses Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF01424 R3H: R3H domain; InterPro: IPR001374 The R3H motif: a domain that binds single-stranded nucleic acids Back     alignment and domain information
>PHA00149 DNA encapsidation protein Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query908
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 6e-82
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 6e-82
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 2e-35
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 6e-17
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  302 bits (773), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 205/605 (33%), Positives = 296/605 (48%), Gaps = 69/605 (11%)
Query: 274 MLSFREKLPAFKMKAEFLKAVAENQVLVVSGETGCGKTTQLPQFILEEELSSLRGADCNI 333
           +L  R +LP    + EFLK    NQ++V  GETG GKTTQ+PQF+L +E+  L   +  +
Sbjct: 86  ILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLE--NTQV 143
Query: 334 ICTQPXXXXXXXXXXXXXXERGENLGETVGYQIRLESKRSAQTRLLFCTTGVLLRQLVED 393
            CTQP              E    LGE VGY IR E+K S +T L + T G+LLR+ +ED
Sbjct: 144 ACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMED 203
Query: 394 PDLSCVSHLLVDEIHERGMNEDFXXXXXXXXXXXXXXXXXXXMSATINADLFSKYFGNAP 453
            DLS  S +++DE HER +  D                    MSAT++A+ F +YF +AP
Sbjct: 204 HDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAP 263
Query: 454 TVHIPGLTFPVTDLFLEDVLEKTRYKMNSKLDSFQGNXXXXXXQDSKKDHLTALFEDVDI 513
            + +PG T+PV +L+     ++        LDS           +   D L  L  + +I
Sbjct: 264 LLAVPGRTYPV-ELYYTPEFQR------DYLDSAIRTVLQIHATEEAGDILLFLTGEDEI 316
Query: 514 DSNYKNYRASTRASLEAWSAEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQ 573
           +       A  + SLE                + + R EG G + V+             
Sbjct: 317 ED------AVRKISLEG---------------DQLVREEGCGPLSVY------------- 342
Query: 574 IKVNKFLGDPNKFLVLPLHGSMPTINQREIFDRPPPNK-----RKIVLATNIAESSITID 628
                           PL+GS+P   Q+ IF+  P +      RK+V++TNIAE+S+TID
Sbjct: 343 ----------------PLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTID 386
Query: 629 DVVYVVDCGKAKETSYDALNKLACLLPSWISKASAHQRRGRAGRVQPGVCYKLYP-RIIH 687
            +VYVVD G +K+  Y+   ++  LL S ISKASA QR GRAGR +PG C++LY      
Sbjct: 387 GIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQ 446
Query: 688 DAMLPYQLPEILRTPLQELCLHIKSLQLGTVGSFLSKALQPPDPLAVQNAIELLKTIGAL 747
             ++    PEILR+ L    L +K L +  +  F    + PP P  +  A+E L  +  L
Sbjct: 447 KELIEQSYPEILRSNLSSTVLELKKLGIDDLVHF--DFMDPPAPETMMRALEELNYLACL 504
Query: 748 DDMENLTPLGRHLCTLPVDPNIGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKE 807
           DD  NLTPLGR     P+DP +  ML+    FQC    LTI A L+  N F+ P   +K 
Sbjct: 505 DDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKR 564
Query: 808 VDEAKRSFAGDSCSDHIALLKAFDGYK-DAKRNRRERDFCWENFLSPITLQMMEDMRSQF 866
            D+AK  FA     DHI LL  +  +K D         +C +++L+  +L   +++RSQ 
Sbjct: 565 ADDAKNIFAHPD-GDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQL 623
Query: 867 LDLLS 871
             L++
Sbjct: 624 ERLMN 628
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 908
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 6e-42
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 3e-24
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 6e-22
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-18
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 1e-12
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-04
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 0.001
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 0.001
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 0.002
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  153 bits (388), Expect = 6e-42
 Identities = 53/310 (17%), Positives = 87/310 (28%), Gaps = 31/310 (10%)

Query: 533 AEQIDLGLVESTIEYICRHEGDGAILVFLTGWNDISKLLDQIKVNKFLGDPNKFLVLPLH 592
              I      +  ++I   +       FL      + +   ++            V+ L+
Sbjct: 17  QTDIPSEPWNTGHDWILADKRP--TAWFLPSIRAANVMAASLR-------KAGKSVVVLN 67

Query: 593 GSMPTINQREIFDRPPPNKRKIVLATNIAESSITIDDVVYVVDCGKA-KETSYDALNKLA 651
                     I       K   +LAT+IAE    +  V  V+DC  A K    D   K+A
Sbjct: 68  RKTFEREYPTIKQ----KKPDFILATDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVA 122

Query: 652 CLLPSWISKASAHQRRGRAGRVQPGVCYKLYPRIIHDAMLPYQLPEILRTPLQELCLHIK 711
              P  IS +SA QRRGR GR         Y     +         +       L  +++
Sbjct: 123 IKGPLRISASSAAQRRGRIGRNPNR-DGDSY--YYSEPTSENNAHHVCWLEASMLLDNME 179

Query: 712 SLQLGTVGSFLSKA---LQPPDPLAVQNAIELLKTIGALDDMENLTPLGRHLCTLPVDPN 768
            ++ G V                       +       + + +    L   +    +  N
Sbjct: 180 -VRGGMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELVRNCDLPVWLSWQVAKAGLKTN 238

Query: 769 IGKMLLMGAIFQCLNPALTIAAALAHRNPFVLPVNMQKEVDEAKRSFAGDSCSDHIALLK 828
             K    G           I            P   +K +    R       SD  A L 
Sbjct: 239 DRKWCFEGP------EEHEILNDSGETVKCRAPGGAKKPL--RPRWCDERVSSDQSA-LS 289

Query: 829 AFDGYKDAKR 838
            F  + + +R
Sbjct: 290 EFIKFAEGRR 299
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query908
d1smyd_1504 RNA-polymerase beta-prime {Thermus thermophilus [T 100.0
d1twfa_1449 RBP1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 100.0
d1muka_1264 Reovirus polymerase lambda3 {Reovirus [TaxId: 1089 100.0
d1twfb_1207 RBP2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 100.0
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 100.0
d1urja_1122 Infected cell protein 8, ICP8 {Herpes simplex viru 100.0
d1smyc_1119 RNA-polymerase beta {Thermus thermophilus [TaxId: 100.0
d1y5ia21074 Respiratory nitrate reductase 1 alpha chain {Esche 100.0
d1uf2a_967 RDV p3 {Rice dwarf virus [TaxId: 10991]} 100.0
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 100.0
d1jqoa_936 Phosphoenolpyruvate carboxylase {Escherichia coli 100.0
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 100.0
d1mswd_882 T7 RNA polymerase {Bacteriophage T7 [TaxId: 10760] 100.0
d1jqna_880 Phosphoenolpyruvate carboxylase {Escherichia coli 100.0
d1ygpa_876 Glycogen phosphorylase {Baker's yeast (Saccharomyc 100.0
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 100.0
d2btva_845 BTV vp3 {Bluetongue virus, strain 1 [TaxId: 40051] 100.0
d2gj4a1824 Glycogen phosphorylase {Rabbit (Oryctolagus cunicu 100.0
d1kqfa2817 Formate dehydrogenase N, alpha subunit {Escherichi 100.0
d1h0ha2812 Tungsten containing formate dehydrogenase, large s 100.0
d1ofda2809 Alpha subunit of glutamate synthase, central and F 100.0
d1l5wa_796 Maltodextrin phosphorylase (MALP) {Escherichia col 100.0
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 100.0
d1r9da_786 Glycerol dehydratase DhaB1 {Clostridium butyricum 100.0
d2pgga1774 Viral RNA polymerase {Avian infectious bursal dise 100.0
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 100.0
g1gk9.1765 Penicillin acylase {Escherichia coli [TaxId: 562]} 100.0
d1bjta_760 DNA topoisomerase II, C-terminal fragment (residue 100.0
d1h16a_759 Pyruvate formate-lyase, PFL {Escherichia coli [Tax 100.0
g1cp9.1750 Penicillin acylase {Providencia rettgeri [TaxId: 5 100.0
d1jb0a_743 Apoprotein a1, PsaA {Synechococcus elongatus [TaxI 100.0
d1itwa_740 Monomeric isocitrate dehydrogenase {Azotobacter vi 100.0
d1jb0b_739 Apoprotein a2, PsaB {Synechococcus elongatus [TaxI 100.0
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1oaoc_729 Bifunctional carbon monoxide dehydrogenase/acetyl- 100.0
d1vlfm2728 Transhydroxylase alpha subunit, AthL {Pelobacter a 100.0
d1n8ia_726 Malate synthase G {Mycobacterium tuberculosis [Tax 100.0
d1acca_722 Anthrax protective antigen {Anthrax bacillus (Baci 100.0
d1l1la_721 B12-dependent (class II) ribonucleotide reductase 100.0
d1d8ca_720 Malate synthase G {Escherichia coli [TaxId: 562]} 100.0
d1fepa_714 Ferric enterobactin receptor FepA {Escherichia col 100.0
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 100.0
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1by5a_697 Ferric hydroxamate uptake receptor FhuA {Escherich 100.0
d1dmta_696 Neutral endopeptidase (neprilysin) {Human (Homo sa 100.0
d1w27a_692 Phenylalanine ammonia-lyase, PAL {Parsley (Petrose 100.0
d3bnea1690 Lipoxigenase, C-terminal domain {Soybean (Glycine 100.0
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 100.0
d1g8ka2679 Arsenite oxidase large subunit {Alcaligenes faecal 100.0
d1t6ja_678 Phenylalanine ammonia-lyase, PAL {Fungi (Rhodospor 100.0
g1or0.1674 Cephalosporin acylase {Pseudomonas sp., glutarylam 100.0
d1oaoa_673 Bifunctional carbon monoxide dehydrogenase/acetyl- 100.0
d1r6va_671 Fervidolysin {Fervidobacterium pennivorans [TaxId: 100.0
d1ogya2670 Periplasmic nitrate reductase alpha chain {Rhodoba 100.0
g1jmu.1666 Membrane penetration protein mu1 {Reovirus [TaxId: 100.0
d1i1ip_665 Neurolysin (endopeptidase 24.16, thimet oligopepti 100.0
d1hhsa_664 dsRNA phage RNA-dependent RNA-polymerase {Bacterio 100.0
d1n62b2663 Carbon monoxide (CO) dehydrogenase molybdoprotein 100.0
d1kmoa_661 Outer membrane transporter FecA {Escherichia coli 100.0
d1ffvb2657 Carbon monoxide (CO) dehydrogenase molybdoprotein 100.0
d1jrob2654 Xanthine dehydrogenase chain B, C-terminal domain 100.0
d1s4bp_654 Neurolysin (endopeptidase 24.16, thimet oligopepti 100.0
d1mqsa_653 Sly1P protein {Baker's yeast (Saccharomyces cerevi 100.0
d1iv8a2653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 100.0
d1m1ca_651 L-A virus major coat protein {Saccharomyces cerevi 100.0
d1p2za1646 Adenovirus hexon {Human adenovirus type 2 [TaxId: 100.0
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 100.0
d1l1ya_642 Processive endocellulase CelF (Cel48F) {Clostridiu 100.0
d1ry2a_640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 100.0
d1v97a5638 Xanthine oxidase, C-terminal domain {Cow (Bos taur 100.0
d1rm6a2636 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, 100.0
d1su7a_633 Ni-containing carbon monoxide dehydrogenase {Carbo 100.0
d1g9ga_629 Processive endocellulase CelF (Cel48F) {Clostridiu 100.0
d2b3ya2629 Iron-responsive element binding protein 1, N-termi 100.0
d2a3la1628 AMP deaminase (AMPD), catalytic domain {Thale cres 100.0
d1tmoa2627 Trimethylamine N-oxide reductase {Shewanella massi 100.0
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 100.0
d1eu1a2622 Dimethylsulfoxide reductase (DMSO reductase) {Rhod 100.0
d1t3qb2621 Quinoline 2-oxidoreductase large subunit QorL {Pse 100.0
d1i7da_620 DNA topoisomerase III {Escherichia coli [TaxId: 56 100.0
d2guma1615 Glycoprotein B {Human herpesvirus 1 [TaxId: 10298] 100.0
d1jqka_610 Ni-containing carbon monoxide dehydrogenase {Rhodo 100.0
d1j36a_598 Angiotensin converting enzyme, ACE {Fruit fly (Dro 100.0
d2jioa2597 Periplasmic nitrate reductase alpha chain {Desulfo 100.0
d2ajfa1597 Angiotensin converting enzyme 2, ACE2 {Human (Homo 100.0
d1vlba4597 Aldehyde oxidoreductase {Desulfovibrio gigas [TaxI 100.0
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 100.0
d1dgja4596 Aldehyde oxidoreductase {Desulfovibrio desulfurica 100.0
d1qhba_595 Haloperoxidase (bromoperoxidase) {Red algae (Coral 100.0
d1mw9x_591 DNA topoisomerase I, 67K N-terminal domain {Escher 100.0
d2gufa1591 Outer membrane cobalamin transporter BtuB {Escheri 100.0
d1epua_590 Neuronal Sec1, NSec1 {Longfin inshore squid (Lolig 100.0
d1dn1a_589 Neuronal Sec1, NSec1 {Rat (Rattus norvegicus) [Tax 100.0
d1s48a_588 Viral RNA polymerase {Bovine viral diarrhea virus 100.0
d1b3ua_588 Constant regulatory domain of protein phosphatase 100.0
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 100.0
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 100.0
d1cjya2580 Cytosolic phospholipase A2 catalytic domain {Human 100.0
d1uzea_579 Angiotensin converting enzyme, ACE {Human (Homo sa 100.0
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 100.0
d2bcea_579 Bile-salt activated lipase (cholesterol esterase) 100.0
d1vnsa_574 Chloroperoxidase {Curvularia inaequalis [TaxId: 38 100.0
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 100.0
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 100.0
d1p80a2571 Catalase II {Escherichia coli, HPII [TaxId: 562]} 100.0
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 100.0
d1dx4a_571 Acetylcholinesterase {Fruit fly (Drosophila melano 100.0
g1cxp.1570 Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606 100.0
d2iv2x2564 Formate dehydrogenase H {Escherichia coli [TaxId: 100.0
d2fhfa5563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 100.0
d1no7a_562 Major capsid protein VP5 {Herpes simplex virus 1 [ 100.0
d1h41a1561 alpha-D-glucuronidase catalytic domain {Pseudomona 100.0
d1hk8a_561 Class III anaerobic ribonucleotide reductase NRDD 100.0
d1q50a_561 Phosphoglucose isomerase, PGI {Leishmania mexicana 100.0
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 100.0
d7reqa1557 Methylmalonyl-CoA mutase alpha subunit, domain 1 { 100.0
d1iata_556 Phosphoglucose isomerase, PGI {Human (Homo sapiens 100.0
d1gkub3556 Topoisomerase "domain" of reverse gyrase {Archaeon 100.0
d1n7va_555 Adsorption protein p2 {Bacteriophage prd1 [TaxId: 100.0
d1qi9a_555 Haloperoxidase (bromoperoxidase) {Ascophyllum nodo 100.0
d1uwka_554 Urocanate hydratase HutU {Pseudomonas putida [TaxI 100.0
d1tywa_554 P22 tailspike protein {Salmonella phage P22 [TaxId 100.0
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 100.0
d1p49a_553 Steryl-sulfatase {Human (Homo sapiens) [TaxId: 960 100.0
d1gnta_553 Hybrid cluster protein (prismane protein) {Desulfo 100.0
d1eexa_551 Diol dehydratase, alpha subunit {Klebsiella oxytoc 100.0
d2p0ma1551 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [T 100.0
d2b7ma1551 Exocyst complex component EXO70 {Baker's yeast (Sa 100.0
d2f48a1550 Pyrophosphate-dependent phosphofructokinase {Lyme 100.0
d1eg7a_549 Formyltetrahydrofolate synthetase {Moorella thermo 100.0
d1mvma_549 Parvovirus (panleukopenia virus) capsid protein {M 100.0
d1xmea1549 Bacterial ba3 type cytochrome c oxidase subunit I 100.0
d1c8da_548 Parvovirus (panleukopenia virus) capsid protein {C 100.0
d1x87a_545 Urocanate hydratase HutU {Bacillus stearothermophi 100.0
d1thga_544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 100.0
d1gnla_543 Hybrid cluster protein (prismane protein) {Desulfo 100.0
d1frfl_543 Nickel-iron hydrogenase, large subunit {Desulfovib 100.0
d2bvla1542 Toxin B {Clostridium difficile [TaxId: 1496]} 100.0
d1k3va_542 Parvovirus (panleukopenia virus) capsid protein {P 100.0
d2ha2a1542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 100.0
g2dg5.1541 Gamma-glutamyltranspeptidase, GGT {Escherichia col 100.0
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 100.0
d2vk9a1540 Alpha-toxin {Clostridium novyi [TaxId: 1542]} 100.0
d1daba_539 Virulence factor P.69 pertactin {Bordetella pertus 100.0
d1ohfa_539 Tetraomegavirus capsid protein {Nudaurelia capensi 100.0
d3dtua1538 Bacterial aa3 type cytochrome c oxidase subunit I 100.0
d2nlza1537 Cephalosporin acylase {Bacillus halodurans [TaxId: 100.0
d1mt5a_537 Fatty acid amide hydrolase (oleamide hydrolase) {R 100.0
d1e3db_537 Nickel-iron hydrogenase, large subunit {Desulfovib 100.0
d1l8na1536 alpha-D-glucuronidase catalytic domain {Bacillus s 100.0
d1s58a_536 Parvovirus (panleukopenia virus) capsid protein {H 100.0
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 100.0
d1vr5a1535 Oligo-peptide binding protein (OPPA) {Thermotoga m 100.0
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 100.0
d1llfa_534 Type-B carboxylesterase/lipase {Candida cylindrace 100.0
d1wuil1534 Nickel-iron hydrogenase, large subunit {Desulfovib 100.0
g2nqo.1533 Gamma-glutamyltranspeptidase, GGT {Helicobacter py 100.0
d1epwa3533 Botulinum neurotoxin {Clostridium botulinum, serot 100.0
d2h7ca1532 Mammalian carboxylesterase (liver carboxylesterase 100.0
d1ea5a_532 Acetylcholinesterase {Pacific electric ray (Torped 100.0
d1v7wa1531 Chitobiose phosphorylase ChbP {Vibrio proteolyticu 100.0
d1gx5a_530 Viral RNA polymerase {Hepatitis C virus [TaxId: 11 100.0
d1yq9h1530 Nickel-iron hydrogenase, large subunit {Desulfovib 100.0
d1yova1529 Amyloid beta precursor protein-binding protein 1, 100.0
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ih7a2528 Family B DNA polymerase {Bacteriophage RB69 [TaxId 100.0
d1acoa2527 Aconitase A, N-terminal domain {Cow (Bos taurus) [ 100.0
d1p0ia_526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 100.0
d1mioa_525 Nitrogenase iron-molybdenum protein, alpha chain { 100.0
d1peqa2525 R1 subunit of ribonucleotide reductase, C-terminal 100.0
d1rlra2525 R1 subunit of ribonucleotide reductase, C-terminal 100.0
d1hdha_525 Arylsulfatase B (4-sulfatase) {Pseudomonas aerugin 100.0
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 100.0
d1x1na1523 Amylomaltase MalQ {Potato (Solanum tuberosum) [Tax 100.0
d1m1nb_522 Nitrogenase iron-molybdenum protein, beta chain {A 100.0
d3bvua2522 Golgi alpha-mannosidase II {Fruit fly (Drosophila 100.0
d1lp3a_519 Dependovirus capsid protein {Adeno-associated viru 100.0
d1qh8b_519 Nitrogenase iron-molybdenum protein, beta chain {K 100.0
d1dqua_519 Isocitrate lyase {Aspergillus nidulans [TaxId: 162 100.0
d2d32a1518 Gamma-glutamylcysteine synthetase GshA {Escherichi 100.0
d1i7qa_517 Anthranilate synthase aminodeoxyisochorismate synt 100.0
d1jeta_517 Oligo-peptide binding protein (OPPA) {Salmonella t 100.0
d1ukca_517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 100.0
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 100.0
d1xrsa_516 D-lysine 5,6-aminomutase alpha subunit, KamD {Clos 100.0
d2i3oa1516 Hypothetical protein Ta0994 {Thermoplasma acidophi 100.0
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 100.0
d1v54a_514 Mitochondrial cytochrome c oxidase, subunit I {Cow 100.0
d1amua_514 Phenylalanine activating domain of gramicidin synt 100.0
d2i7xa1514 Cleavage factor two protein 2, CFT2 {Baker's yeast 100.0
d1mtyd_512 Methane monooxygenase hydrolase alpha subunit {Met 100.0
d2jg0a1511 Periplasmic trehalase TreA {Escherichia coli [TaxI 100.0
d1dl2a_511 Class I alpha-1;2-mannosidase, catalytic domain {B 100.0
d1kl7a_511 Threonine synthase {Baker's yeast (Saccharomyces c 100.0
d1cvua1511 Prostaglandin H2 synthase {Mouse (Mus musculus) [T 100.0
d1q4ga1511 Prostaglandin H2 synthase {Sheep (Ovis aries) [Tax 100.0
d1ut9a1511 Cellulose 1,4-beta-cellobiosidase CbhA {Clostridiu 100.0
d3ckca1510 Starch utilization system protein SusD {Bacteroide 100.0
d1gkma_509 Histidine ammonia-lyase (HAL) {Pseudomonas putida 100.0
d1y5ib1509 Respiratory nitrate reductase 1 beta chain {Escher 100.0
d2a65a1509 Na(+):neurotransmitter symporter homologue LeuT {A 100.0
d1k8ta_509 Adenylylcyclase toxin (the edema factor) {Bacillus 100.0
d1dpea_507 Dipeptide-binding protein {Escherichia coli [TaxId 100.0
d3cgha1507 Uncharacterized protein BT3984 {Bacteroides thetai 100.0
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 100.0
d2cvca1505 16-heme cytochrome c HmcA {Desulfovibrio vulgaris 100.0
d1rt8a_505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 100.0
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 100.0
d1xoca1504 Oligo-peptide binding protein (OPPA) {Bacillus sub 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 100.0
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 100.0
d1sh0a_502 Viral RNA polymerase {Norwalk virus [TaxId: 11983] 100.0
d1ffta_501 Cytochrome O ubiquinol oxidase, subunit I {Escheri 100.0
d1jv1a_501 UDP-N-acetylglucosamine pyrophosphorylase {Human ( 100.0
d1b1ya_500 beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 100.0
d1eswa_500 Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} 100.0
d1pxya_500 Fimbrin (Plastin), actin-crosslinking domain {Thal 100.0
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 100.0
d1zlqa1499 Nickel-binding periplasmic protein NikA {Escherich 100.0
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 100.0
d1fgja_499 Hydroxylamine oxidoreductase, HAO {Nitrosomonas eu 100.0
d1fa2a_498 beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI 100.0
d1gwea_498 Catalase I {Micrococcus lysodeikticus [TaxId: 1270 100.0
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1kvpa_497 Microvirus capsid proteins {Bacteriophage phi-X174 100.0
d1k9xa_497 Thermostable carboxypeptidase 1 {Archaeon Pyrococc 100.0
d1dgfa_497 Catalase I {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1khva_497 Viral RNA polymerase {Rabbit hemorrhagic disease v 100.0
d1q47a_495 Semaphorin 3a {Mouse (Mus musculus) [TaxId: 10090] 100.0
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 100.0
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 100.0
d1x9ma2494 T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 100.0
d1h3na3494 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 100.0
d1ab4a_493 DNA Gyrase A {Escherichia coli [TaxId: 562]} 100.0
d1ihma_492 Calicivirus capsid protein {Norwalk virus [TaxId: 100.0
d1fsua_492 Arylsulfatase B (4-sulfatase) {Human (Homo sapiens 100.0
d1j1na_492 Alginate-binding periplasmic protein AlgQ2 {Sphing 100.0
d2fbaa1492 Glucoamylase {Yeast (Saccharomycopsis fibuligera) 100.0
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 100.0
d2inca1491 Toluene, o-xylene monooxygenase oxygenase subunit 100.0
d1qwla_491 Catalase I {Helicobacter pylori [TaxId: 210]} 100.0
d1m22a_490 Peptide amidase Pam {Stenotrophomonas maltophilia 100.0
d2f2aa1485 Glutamyl-tRNA(Gln) amidotransferase subunit A {Sta 100.0
d1tz7a1485 Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] 100.0
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 100.0
d1auka_485 Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606 100.0
d1wdpa1490 beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} 100.0
d1h54a1485 Lactobacillus maltose phosphorylase, central domai 100.0
d1l5ja3490 Aconitase B, C-terminal domain {Escherichia coli [ 100.0
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 100.0
g1o7d.2490 Lysosomal alpha-mannosidase {Cow (Bos taurus) [Tax 100.0
d1m7sa_484 Catalase I {Pseudomonas syringae [TaxId: 317]} 100.0
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 100.0
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 100.0
d2axtb1488 Photosystem II core light harvesting protein PsbB 100.0
d1ccwb_483 Glutamate mutase, large subunit {Clostridium cochl 100.0
d1qe3a_483 Thermophilic para-nitrobenzyl esterase (PNB estera 100.0
d2slia2483 Leech intramolecular trans-sialidase, C-terminal d 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1hcua_488 Class I alpha-1;2-mannosidase, catalytic domain {T 100.0
d1a4ea_488 Catalase I {Baker's yeast (Saccharomyces cerevisia 100.0
d1uqwa_487 Hypothetical protein YliB {Escherichia coli [TaxId 100.0
d1oaha_482 Cytochrome c nitrite reductase {Desulfovibrio desu 100.0
d1cc1l_487 Nickel-iron hydrogenase, large subunit {Desulfomic 100.0
d1nvus_481 Son of sevenless protein homolog 1 (sos-1) {Human 100.0
d1ofla_481 Chondroitinase B {Pedobacter heparinus [TaxId: 984 100.0
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 100.0
d2f2aa1485 Glutamyl-tRNA(Gln) amidotransferase subunit A {Sta 100.0
d1uc2a_480 Hypothetical protein PH1602 {Archaeon Pyrococcus h 100.0
d1auka_485 Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606 100.0
d1tz7a1485 Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] 100.0
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 100.0
d1h54a1485 Lactobacillus maltose phosphorylase, central domai 100.0
d1zeda1479 Alkaline phosphatase {Human (Homo sapiens) [TaxId: 100.0
d1m7sa_484 Catalase I {Pseudomonas syringae [TaxId: 317]} 100.0
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 100.0
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d1ccwb_483 Glutamate mutase, large subunit {Clostridium cochl 100.0
d1olza2478 Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1qe3a_483 Thermophilic para-nitrobenzyl esterase (PNB estera 100.0
d2slia2483 Leech intramolecular trans-sialidase, C-terminal d 100.0
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d1t8sa_477 AMP nucleosidase {Escherichia coli [TaxId: 562]} 100.0
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 100.0
d1m1na_477 Nitrogenase iron-molybdenum protein, alpha chain { 100.0
d1e5xa_477 Threonine synthase {Mouse-ear cress (Arabidopsis t 100.0
d1ewka_477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 100.0
d1oaha_482 Cytochrome c nitrite reductase {Desulfovibrio desu 100.0
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 100.0
d1nvus_481 Son of sevenless protein homolog 1 (sos-1) {Human 100.0
d1e93a_476 Catalase I {Proteus mirabilis [TaxId: 584]} 100.0
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 100.0
d1k7ha_476 Alkaline phosphatase {Northern shrimp (Pandalus bo 100.0
d1u09a_476 Viral RNA polymerase {Foot-and-mouth disease virus 100.0
d1shyb1476 Hepatocyte growth factor receptor {Human (Homo sap 100.0
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 100.0
d1ofla_481 Chondroitinase B {Pedobacter heparinus [TaxId: 984 100.0
d2gi3a1475 Glutamyl-tRNA(Gln) amidotransferase subunit A {The 100.0
d2ri9a1475 Class I alpha-1;2-mannosidase, catalytic domain {F 100.0
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 100.0
d1lmla_475 Leishmanolysin {Leishmania major [TaxId: 5664]} 100.0
d1uc2a_480 Hypothetical protein PH1602 {Archaeon Pyrococcus h 100.0
d1musa_474 Transposase inhibitor (Tn5 transposase) {Escherich 100.0
d1si8a_474 Catalase I {Enterococcus faecalis [TaxId: 1351]} 100.0
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 100.0
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 100.0
d1zeda1479 Alkaline phosphatase {Human (Homo sapiens) [TaxId: 100.0
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d1auia_473 Protein phosphatase-2B (PP-2B, calcineurin A subun 100.0
d1szqa_473 2-methylcitrate dehydratase PrpD {Escherichia coli 100.0
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 100.0
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d1olza2478 Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1t8sa_477 AMP nucleosidase {Escherichia coli [TaxId: 562]} 100.0
d1wpga4472 Calcium ATPase, transmembrane domain M {Rabbit (Or 100.0
d1e5xa_477 Threonine synthase {Mouse-ear cress (Arabidopsis t 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1gaia_472 Glucoamylase {Aspergillus awamori, variant x100 [T 100.0
d1m1na_477 Nitrogenase iron-molybdenum protein, alpha chain { 100.0
d1ewka_477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 100.0
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 100.0
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 100.0
d1pfoa_471 Perfringolysin {Clostridium perfringens [TaxId: 15 100.0
d1k7ha_476 Alkaline phosphatase {Northern shrimp (Pandalus bo 100.0
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 100.0
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 100.0
d1fs7a_471 Cytochrome c nitrite reductase {Wolinella succinog 100.0
d1e93a_476 Catalase I {Proteus mirabilis [TaxId: 584]} 100.0
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 100.0
d1u09a_476 Viral RNA polymerase {Foot-and-mouth disease virus 100.0
d1shyb1476 Hepatocyte growth factor receptor {Human (Homo sap 100.0
d2gi3a1475 Glutamyl-tRNA(Gln) amidotransferase subunit A {The 100.0
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 100.0
d1w36c2470 Exodeoxyribonuclease V gamma chain (RecC), N-termi 100.0
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 100.0
d2ri9a1475 Class I alpha-1;2-mannosidase, catalytic domain {F 100.0
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 100.0
d1lmla_475 Leishmanolysin {Leishmania major [TaxId: 5664]} 100.0
d1musa_474 Transposase inhibitor (Tn5 transposase) {Escherich 100.0
d2iqha1469 Nucleocapsid protein {Influenza A virus [TaxId: 11 100.0
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 100.0
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 100.0
d1si8a_474 Catalase I {Enterococcus faecalis [TaxId: 1351]} 100.0
d2ga9d1468 Poly(A) polymerase catalytic subunit, PAPL {Vaccin 100.0
d1auia_473 Protein phosphatase-2B (PP-2B, calcineurin A subun 100.0
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 100.0
d1szqa_473 2-methylcitrate dehydratase PrpD {Escherichia coli 100.0
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 100.0
d1gaia_472 Glucoamylase {Aspergillus awamori, variant x100 [T 100.0
d1wpga4472 Calcium ATPase, transmembrane domain M {Rabbit (Or 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1nxca_467 Class I alpha-1;2-mannosidase, catalytic domain {M 100.0
d2qxfa1467 Exonuclease I {Escherichia coli K12 (Escherichia c 100.0
d1w79a1467 D-alanyl-D-alanine carboxypeptidase Dac {Actinomad 100.0
d1gc5a_467 ADP-dependent glucokinase {Archaeon Thermococcus l 100.0
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1fs7a_471 Cytochrome c nitrite reductase {Wolinella succinog 100.0
d1pfoa_471 Perfringolysin {Clostridium perfringens [TaxId: 15 100.0
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 100.0
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 100.0
d1w36c2470 Exodeoxyribonuclease V gamma chain (RecC), N-termi 100.0
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 100.0
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 100.0
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 100.0
d2iqha1469 Nucleocapsid protein {Influenza A virus [TaxId: 11 100.0
d1h80a_464 iota-carrageenase {Alteromonas sp., atcc 43554 [Ta 100.0
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 100.0
d2ga9d1468 Poly(A) polymerase catalytic subunit, PAPL {Vaccin 100.0
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 100.0
d1w79a1467 D-alanyl-D-alanine carboxypeptidase Dac {Actinomad 100.0
d2b7oa1462 Probable DAHP synthetase AroG, phenylalanine-repre 100.0
d1j3ua_462 L-aspartate ammonia lyase {Bacillus sp., ym55-1 [T 100.0
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 100.0
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 100.0
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1nxca_467 Class I alpha-1;2-mannosidase, catalytic domain {M 100.0
d2qxfa1467 Exonuclease I {Escherichia coli K12 (Escherichia c 100.0
d1gc5a_467 ADP-dependent glucokinase {Archaeon Thermococcus l 100.0
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 100.0
d2p3ya1461 Hypothetical protein VPA0735 {Vibrio parahaemolyti 100.0
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 100.0
d1ra6a_461 Viral RNA polymerase {Poliovirus type 1, strain Ma 100.0
d1vdka_460 Fumarase {Thermus thermophilus [TaxId: 274]} 100.0
d7reqb1460 Methylmalonyl-CoA mutase beta subunit, domain 1 {P 100.0
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 100.0
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d1tf4a1460 Endo/exocellulase:cellobiose E-4, N-terminal domai 100.0
d1xr7a_460 Viral RNA polymerase {Human rhinovirus 16, HRV-16 100.0
d1xr5a_460 Viral RNA polymerase {Human rhinovirus 14, HRV-14 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1w7ca1460 Lysyl oxidase PplO, domain 3 {Yeast (Pichia pastor 100.0
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 100.0
d1k62b_459 Argininosuccinate lyase/delta-crystallin {Human (H 100.0
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 100.0
d1jswa_459 L-aspartate ammonia lyase {Escherichia coli [TaxId 100.0
d1yfma_459 Fumarase {Baker's yeast (Saccharomyces cerevisiae) 100.0
d3ejna1459 Uncharacterized protein BF3025 {Bacteroides fragil 100.0
d1h80a_464 iota-carrageenase {Alteromonas sp., atcc 43554 [Ta 100.0
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 100.0
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 100.0
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 100.0
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 100.0
d1w5da1458 Penicillin-binding protein DacC {Bacillus subtilis 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1j3ua_462 L-aspartate ammonia lyase {Bacillus sp., ym55-1 [T 100.0
d1ntha_457 Monomethylamine methyltransferase MtmB {Archaeon M 100.0
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1miob_457 Nitrogenase iron-molybdenum protein, beta chain {C 100.0
d2b7oa1462 Probable DAHP synthetase AroG, phenylalanine-repre 100.0
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 100.0
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 100.0
d1wp1a_456 Outer membrane protein OprM {Pseudomonas aeruginos 100.0
d2p3ya1461 Hypothetical protein VPA0735 {Vibrio parahaemolyti 100.0
d2ex2a1456 DD-carboxypeptidase DacB {Escherichia coli [TaxId: 100.0
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 100.0
d1fuoa_456 Fumarase {Escherichia coli [TaxId: 562]} 100.0
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 100.0
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 100.0
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 100.0
d1ra6a_461 Viral RNA polymerase {Poliovirus type 1, strain Ma 100.0
d1w7ca1460 Lysyl oxidase PplO, domain 3 {Yeast (Pichia pastor 100.0
d1tf4a1460 Endo/exocellulase:cellobiose E-4, N-terminal domai 100.0
d1dzla_455 Papillomavirus L1 protein {Human papillomavirus ty 100.0
d1tj7a_455 Argininosuccinate lyase/delta-crystallin {Escheric 100.0
d7reqb1460 Methylmalonyl-CoA mutase beta subunit, domain 1 {P 100.0
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d1vdka_460 Fumarase {Thermus thermophilus [TaxId: 274]} 100.0
d1xr7a_460 Viral RNA polymerase {Human rhinovirus 16, HRV-16 100.0
d1xr5a_460 Viral RNA polymerase {Human rhinovirus 14, HRV-14 100.0
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 100.0
d1yfma_459 Fumarase {Baker's yeast (Saccharomyces cerevisiae) 100.0
d1ua4a_454 ADP-dependent glucokinase {Archaeon Pyrococcus fur 100.0
d3ejna1459 Uncharacterized protein BF3025 {Bacteroides fragil 100.0
d1g87a1454 Endo/exocellulase:cellobiose E-4, N-terminal domai 100.0
d1jswa_459 L-aspartate ammonia lyase {Escherichia coli [TaxId 100.0
d1k62b_459 Argininosuccinate lyase/delta-crystallin {Human (H 100.0
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 100.0
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 100.0
d1k0ga_453 P-aminobenzoate synthase component I {Escherichia 100.0
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 100.0
d2o6ia1453 Hypothetical protein EF1143 {Enterococcus faecalis 100.0
d1x9da1453 Class I alpha-1;2-mannosidase, catalytic domain {H 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d2bg1a1453 Penicillin-binding protein 1b, transpeptidase doma 100.0
d1w5da1458 Penicillin-binding protein DacC {Bacillus subtilis 100.0
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1lsha3452 Lipovitellin-phosvitin complex; beta-sheet shell r 100.0
d1miob_457 Nitrogenase iron-molybdenum protein, beta chain {C 100.0
d1ntha_457 Monomethylamine methyltransferase MtmB {Archaeon M 100.0
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 100.0
d1tyea_452 Integrin alpha N-terminal domain {Human (Homo sapi 100.0
d1ilea3452 Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop 100.0
d1wp1a_456 Outer membrane protein OprM {Pseudomonas aeruginos 100.0
d1fuoa_456 Fumarase {Escherichia coli [TaxId: 562]} 100.0
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 100.0
d2i7ta1451 Cleavage and polyadenylation specificity factor su 100.0
d1j5sa_451 Uronate isomerase TM0064 {Thermotoga maritima [Tax 100.0
d1l2la_451 ADP-dependent glucokinase {Archaeon Thermococcus l 100.0
d2ex2a1456 DD-carboxypeptidase DacB {Escherichia coli [TaxId: 100.0
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 100.0
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 100.0
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 100.0
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 100.0
d1u2xa_450 ADP-specific phosphofructokinase {Pyrococcus horik 100.0
d1dzla_455 Papillomavirus L1 protein {Human papillomavirus ty 100.0
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 100.0
d1tj7a_455 Argininosuccinate lyase/delta-crystallin {Escheric 100.0
d1ffya3450 Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus 100.0
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 100.0
d1tjva_449 Argininosuccinate lyase/delta-crystallin {Domestic 100.0
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 100.0
d1g87a1454 Endo/exocellulase:cellobiose E-4, N-terminal domai 100.0
d1y6va1449 Alkaline phosphatase {Escherichia coli [TaxId: 562 100.0
d1ua4a_454 ADP-dependent glucokinase {Archaeon Pyrococcus fur 100.0
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 100.0
d2o6ia1453 Hypothetical protein EF1143 {Enterococcus faecalis 100.0
d1usra_448 Paramyxovirus hemagglutinin-neuraminidase head dom 100.0
d1re5a_448 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) { 100.0
d1w6ka1448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 100.0
d1k0ga_453 P-aminobenzoate synthase component I {Escherichia 100.0
d1x9da1453 Class I alpha-1;2-mannosidase, catalytic domain {H 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d2bg1a1453 Penicillin-binding protein 1b, transpeptidase doma 100.0
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 100.0
d2c42a2447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 100.0
d2axtc1447 Photosystem II CP43 protein PsbC {Thermosynechococ 100.0
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 100.0
d1lsha3452 Lipovitellin-phosvitin complex; beta-sheet shell r 100.0
>d1smyd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: beta and beta-prime subunits of DNA dependent RNA-polymerase
superfamily: beta and beta-prime subunits of DNA dependent RNA-polymerase
family: RNA-polymerase beta-prime
domain: RNA-polymerase beta-prime
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=0  Score=114867.95  Aligned_cols=1  Identities=0%  Similarity=-0.427  Sum_probs=0.0

Q ss_pred             C-------------------------------------------------------------------------------
Q ss_conf             9-------------------------------------------------------------------------------
Q 002552           54 N-------------------------------------------------------------------------------   54 (908)
Q Consensus        54 ~-------------------------------------------------------------------------------   54 (908)
                      .                                                                               
T Consensus         1 ~~~~~~i~i~lASpe~Ir~Ws~GeV~kpeTinYrT~KPE~dGLFcerIFGP~kd~eC~CGKyk~~~~~g~vC~~CgVevt   80 (1504)
T d1smyd_           1 KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVT   80 (1504)
T ss_dssp             CCCCCEEEEECCCHHHHHHHEEEECCSCCCBCTTSSSBCSSSSSCHHHHCCSSSSSCSSCSCCSSSSSSCCCSSSCCCCS
T ss_pred             CCCCCEEEEEECCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEECCCCCCCCCCCEECCCCCCEEC
T ss_conf             98555379984488999874475638987656577899887853410008883766728776652519977799986877


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus        81 ~s~vRR~RmGhIeLa~PV~HiWy~k~~PS~i~~lL~~~~k~lE~v~Y~~~yiv~~~~~~~~~~~~~~~~~~l~~~~~~~~  160 (1504)
T d1smyd_          81 KSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYREL  160 (1504)
T ss_dssp             STHHHHHCEEEEEEEEEEECGGGTSSSSCHHHHHTTSCTTHHHHHHHTSCCCEECSCCCSCSSSSCCTTCBCCHHHHHHH
T ss_pred             CCCHHHHCCCCCCCCCCCEEECCCCCCCHHHHHHCCCCHHHHHHEEEECCEEEECCCCCCCCCCCHHHHCCCCHHHHHHH
T ss_conf             30167653587003687434374588605999980999888251012001687457855456673254222549999987


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (1504)
T d1smyd_         161 RYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEI  240 (1504)
T ss_dssp             HTCSCEECCCCSTTTHHHHHTGGGTBSCCCCTTEECCSSSCCEECSCSCEEECCCCSSCCCSCCTTTTTTTGGGTSSSCT
T ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             64012101233213444200245430022211344310024443333333355655443210002444444442011556


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (1504)
T d1smyd_         241 LAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAAQ  320 (1504)
T ss_dssp             TTTSTTTTCC----------------------------------------------------------------------
T ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCHHHHHCCHHHHHHHHHHH
T ss_conf             65420001110001013566555321122101222221101244344422122012210010000000001233444444


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  400 (1504)
T d1smyd_         321 VEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVY  400 (1504)
T ss_dssp             ------------------------------------------CCCCCSSCCCSSCCBTTBCSCCCCCCCEEEECSEEESS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCCHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
T ss_conf             33332100112222221035410012333443454200000121000024766643333210000123210012332334


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       401 ~~~~~~~~~~g~r~~~~d~~~~~~~~~~~l~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  480 (1504)
T d1smyd_         401 PFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEM  480 (1504)
T ss_dssp             CCCCTTSSCCSCCSSSCCCSCCSSCCCCSSCCEEEEETTTTEEEEECCCCCCEECSHHHHHHHHHSCCHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             32121111347622401321012321003565556778888886512201444455899999987410356677888764


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       481 ~~~~~~~~~~~~~~~~~~~~f~~~~~rPe~mil~~lPVpP~~~RP~v~~~~~~~~~ddlt~~~~~II~~N~~Lk~~~~~~  560 (1504)
T d1smyd_         481 KHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQG  560 (1504)
T ss_dssp             HSSCHHHHHHHHHHHHHHHHHHTTSCCGGGGEEEEEEECCSTTSCEEECSTTCEEECTHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEECCCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             02046788999998999998876599857858631458997778718968986667730589999999989999998759


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       561 ap~~~i~~~~~~LQ~~V~~l~dn~~~g~~~~~~~~~rplksi~~rLkGK~GRfR~NLmGKRVDfSgRSVIspDP~L~l~E  640 (1504)
T d1smyd_         561 APEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQ  640 (1504)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHCTTSSCCCBCSTTCCCBCCCHHHHHHTTTTHHHHHTTCEEESSEEEEEEEECTTCCTTE
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHCCCCEEECCCCCCCCCCCCCCEECCCCCCCCCC
T ss_conf             95778999999999999999743466887546666876521888860225601024566645654775143899865200


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       641 vGvP~~mA~~Lt~P~~v~~l~~~~~~~~ik~~~~~i~~~~~~~~~v~~Vlrhli~GD~VL~NRQPTLHR~SImAh~~~l~  720 (1504)
T d1smyd_         641 CGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLV  720 (1504)
T ss_dssp             EBCBHHHHHHHTHHHHHHHHHHSTTCSSHHHHHHHHHSGGGCCTHHHHHHHHHHSSCCEEEECSSCCSGGGEEEEEECCB
T ss_pred             CCCHHHHHHHCCCCEEEEHHHHCCCCCCCCHHHHHHHHCCCCCCCCCHHHEEEECCCEEEECCCCCCCCCEEEEEEEEEC
T ss_conf             46758898839520777717664887774177764310221231001021013559888746888636151057888970


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       721 ~gkTiRLnp~vC~pyNADFDGDEMNvHvPQS~eAraEa~~LM~~~~nilsP~~G~PIi~~iQD~ilG~ylLT~~~~~~k~  800 (1504)
T d1smyd_         721 EGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKG  800 (1504)
T ss_dssp             SSSSEEECSGGGTTTTCCSSSCEEEEECCCSHHHHHHHHHHSBSTTCCBCSSSSSBSSCCCSHHHHHHHHHSCCCCCCCC
T ss_pred             CCCEEEECCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHCCCCCCCCCCCCCEEEEHHHHHHHHHEEEEEEECCCCC
T ss_conf             78436624212455557887746898657888899999998626356633899981442005655232012442034456


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       801 ~~~~f~~~~e~l~a~~~~~i~l~~pi~~k~k~l~tGkq~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~tt~G~i~  880 (1504)
T d1smyd_         801 AGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRIL  880 (1504)
T ss_dssp             SCCCTTSCSHHHHHHHHHHHTTSSCSSCCCSSCCHHHHHCEESSHHHHHHHHHTTSSCTTSCCEEEETTEEECCCHHHHH
T ss_pred             CEEEECCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
T ss_conf             31572679999864140531457885323455555622343046664310035776564334543447863447787255


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       881 ~~~~~~~~v~~~~~~~~~~~~~~~~~k~~l~~LI~~i~~~yG~~~t~~fLd~lk~Lg~~~l~~~GfSiGI~Di~~~~~k~  960 (1504)
T d1smyd_         881 FARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKK  960 (1504)
T ss_dssp             HHHHHHHHSSCHHHHHHSCCTTSCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHHHTCCCCGGGSCCCTHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHH
T ss_conf             15555444353312311221344556762788999999996959899999999999999987567753224334687888


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus       961 ~~I~~a~~~v~~i~~~~~~G~lt~~er~~~v~~~~~~~~~~v~~~~~~~L~~~~p~N~l~~Mv~SGAKGS~~NIsQl~G~ 1040 (1504)
T d1smyd_         961 QYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGL 1040 (1504)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCTTCHHHHHHHSSSSCCHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHCC
T ss_conf             99999998889999987547674068899999999999998755566545423888745887505666698999877356


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus      1041 rGL~~~PsG~~ie~pI~sSF~eGLtP~EFFFHtMGGREGLIDTAVKTA~SGYLqRRLVKvlEDl~V~~dd~~~~~~~~i~ 1120 (1504)
T d1smyd_        1041 RGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVP 1120 (1504)
T ss_dssp             CCCCBCSSSCBCSSCCCCCSSSCCCHHHHHHHHHHHHHHHHHHHHHHSCSHHHHHHHHHTTTTCBCCCSCCSCCCCEECC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCEEEE
T ss_conf             24235898755577654550012878999851478762056554054654101477898732523777513554756998


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus      1121 ~~~~~e~~~~l~~~~~~d~~~~~~~r~l~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~i~~v~vrs~ltc~~~~gvc 1200 (1504)
T d1smyd_        1121 LFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVC 1200 (1504)
T ss_dssp             CEECTTSSSCCEECCHHHHHHHHTTCBBSSCEECSSCEECTTCBCCHHHHHHHHHHHHHSSCSCCEECCGGGCSSTTBCC
T ss_pred             EEECCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHH
T ss_conf             76377433003454201045554412556667641521202430544169999988986286687315754266576689


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus      1201 ~kcyg~~la~~~~V~pGEaVGiIAAQSIGEPgTQMTLnTFH~aGVag~~nIT~GvPRl~EIi~a~kpk~~~iisei~g~v 1280 (1504)
T d1smyd_        1201 QKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVV 1280 (1504)
T ss_dssp             HHHHCSCSSSSSCCCSSCCHHHHHHHHHHHHHTTSCCSCTTCSCSSTTCCCCCHHHHHHHHHTTCCCTTBCCBCSSCEEE
T ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEECCEE
T ss_conf             99877778608908998878787745368337767786554034677776057770079887415789986488625669


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus      1281 ~i~~~~~~~~v~i~~~~~~~~~~ip~~~~l~V~~gd~V~~g~~l~~g~i~p~~iL~~~g~~~~~~~lv~eiq~vyr~qgv 1360 (1504)
T d1smyd_        1281 RIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGV 1360 (1504)
T ss_dssp             EECCCSSCCCEEEECSSCEEEECCCTTCCCCCCTTCEECTTCBCSSSBCCHHHHHHHHCHHHHHHHHHHHHHHHHHTTTC
T ss_pred             EEEECCCEEEEEECCCCEEEEEECCCCCEEEEECCCEEECCCEECCCCCCHHHHHHHHCHHHHHHHHHHHHHHHHHHCCE
T ss_conf             99854771699985798079998489986897489999469872158999899988509999999999987787763475


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 002552           55 --------------------------------------------------------------------------------   54 (908)
Q Consensus        55 --------------------------------------------------------------------------------   54 (908)
                                                                                                      
T Consensus      1361 ~i~dKhievi~rqml~~v~i~d~gdt~~~~ge~v~~~~ie~~~~~~~~e~~~~~t~~g~llgITr~gl~~~s~Ls~ASFe 1440 (1504)
T d1smyd_        1361 KLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQ 1440 (1504)
T ss_dssp             CCCHHHHHHHHHHHTCEEEESSCSSSCSSCCEEHHHHHHHHHHHHHTSCSCCCCCEEECCCCHHHHHHTCSCHHHHTTST
T ss_pred             EECCCCEEHHHHHHCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHCCCCCCEECEEEEEECCCCCCCCCHHHHHHHH
T ss_conf             76355010787752122699968975202555455564999999999809982224518860030722243799883024


Q ss_pred             ----------------------------------------------------------C
Q ss_conf             ----------------------------------------------------------9
Q 002552           55 ----------------------------------------------------------Y   55 (908)
Q Consensus        55 ----------------------------------------------------------~   55 (908)
                                                                                .
T Consensus      1441 eT~~vL~~AAi~g~~D~l~GvsEnVI~G~liP~GTG~~~~~~~~~~~~~~~~~~e~~~~ 1499 (1504)
T d1smyd_        1441 NTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARK 1499 (1504)
T ss_dssp             THHHHHHHHHHHTCEEECCSHHHHHHTTCCCSSSTTCTTTSSCEEEEHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHCHHHHCHHHHHHH
T ss_conf             17799999998469776768008772779766777944776677514433010577787
>d1twfa_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1muka_ e.8.1.4 (A:) Reovirus polymerase lambda3 {Reovirus [TaxId: 10891]} Back     information, alignment and structure
>d1twfb_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urja_ e.58.1.1 (A:) Infected cell protein 8, ICP8 {Herpes simplex virus 1 [TaxId: 10298]} Back     information, alignment and structure
>d1smyc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y5ia2 c.81.1.1 (A:1-1074) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf2a_ e.28.1.2 (A:) RDV p3 {Rice dwarf virus [TaxId: 10991]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jqoa_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mswd_ e.8.1.3 (D:) T7 RNA polymerase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1jqna_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2btva_ e.28.1.1 (A:) BTV vp3 {Bluetongue virus, strain 1 [TaxId: 40051]} Back     information, alignment and structure
>d2gj4a1 c.87.1.4 (A:12-835) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kqfa2 c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0ha2 c.81.1.1 (A:1-812) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1l5wa_ c.87.1.4 (A:) Maltodextrin phosphorylase (MALP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1r9da_ c.7.1.1 (A:) Glycerol dehydratase DhaB1 {Clostridium butyricum [TaxId: 1492]} Back     information, alignment and structure
>d2pgga1 e.8.1.4 (A:31-804) Viral RNA polymerase {Avian infectious bursal disease virus [TaxId: 10995]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1bjta_ e.11.1.1 (A:) DNA topoisomerase II, C-terminal fragment (residues 410-1202) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h16a_ c.7.1.1 (A:) Pyruvate formate-lyase, PFL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jb0a_ f.29.1.1 (A:) Apoprotein a1, PsaA {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1itwa_ c.77.1.2 (A:) Monomeric isocitrate dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jb0b_ f.29.1.1 (B:) Apoprotein a2, PsaB {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1oaoc_ e.26.1.3 (C:) Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) alpha (ACS) subunit {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1vlfm2 c.81.1.1 (M:1-728) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1n8ia_ c.1.13.1 (A:) Malate synthase G {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1acca_ f.11.1.1 (A:) Anthrax protective antigen {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} Back     information, alignment and structure
>d1l1la_ c.7.1.4 (A:) B12-dependent (class II) ribonucleotide reductase {Lactobacillus leichmannii [TaxId: 28039]} Back     information, alignment and structure
>d1d8ca_ c.1.13.1 (A:) Malate synthase G {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fepa_ f.4.3.3 (A:) Ferric enterobactin receptor FepA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1by5a_ f.4.3.3 (A:) Ferric hydroxamate uptake receptor FhuA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dmta_ d.92.1.4 (A:) Neutral endopeptidase (neprilysin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bnea1 a.119.1.1 (A:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1 [TaxId: 3847]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1g8ka2 c.81.1.1 (A:4-682) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1oaoa_ e.26.1.2 (A:) Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) beta (CODH) subunit {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans [TaxId: 93466]} Back     information, alignment and structure
>d1ogya2 c.81.1.1 (A:12-681) Periplasmic nitrate reductase alpha chain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1i1ip_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hhsa_ e.8.1.6 (A:) dsRNA phage RNA-dependent RNA-polymerase {Bacteriophage PHI-6 [TaxId: 10879]} Back     information, alignment and structure
>d1n62b2 d.133.1.1 (B:147-809) Carbon monoxide (CO) dehydrogenase molybdoprotein {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1kmoa_ f.4.3.3 (A:) Outer membrane transporter FecA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ffvb2 d.133.1.1 (B:147-803) Carbon monoxide (CO) dehydrogenase molybdoprotein {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1jrob2 d.133.1.1 (B:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1s4bp_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqsa_ e.25.1.1 (A:) Sly1P protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m1ca_ e.42.1.1 (A:) L-A virus major coat protein {Saccharomyces cerevisiae virus L-A [TaxId: 11008]} Back     information, alignment and structure
>d1p2za1 b.121.2.2 (A:5-650) Adenovirus hexon {Human adenovirus type 2 [TaxId: 10515]} Back     information, alignment and structure
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1l1ya_ a.102.1.2 (A:) Processive endocellulase CelF (Cel48F) {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v97a5 d.133.1.1 (A:695-1332) Xanthine oxidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rm6a2 d.133.1.1 (A:134-769) 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, C-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1su7a_ e.26.1.2 (A:) Ni-containing carbon monoxide dehydrogenase {Carboxydothermus hydrogenoformans [TaxId: 129958]} Back     information, alignment and structure
>d1g9ga_ a.102.1.2 (A:) Processive endocellulase CelF (Cel48F) {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d2b3ya2 c.83.1.1 (A:2-630) Iron-responsive element binding protein 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a3la1 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tmoa2 c.81.1.1 (A:5-631) Trimethylamine N-oxide reductase {Shewanella massilia [TaxId: 76854]} Back     information, alignment and structure
>d1eu1a2 c.81.1.1 (A:4-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1t3qb2 d.133.1.1 (B:166-786) Quinoline 2-oxidoreductase large subunit QorL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1i7da_ e.10.1.1 (A:) DNA topoisomerase III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2guma1 e.76.1.1 (A:111-725) Glycoprotein B {Human herpesvirus 1 [TaxId: 10298]} Back     information, alignment and structure
>d1jqka_ e.26.1.2 (A:) Ni-containing carbon monoxide dehydrogenase {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1j36a_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2jioa2 c.81.1.1 (A:4-600) Periplasmic nitrate reductase alpha chain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d2ajfa1 d.92.1.5 (A:19-615) Angiotensin converting enzyme 2, ACE2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlba4 d.133.1.1 (A:311-907) Aldehyde oxidoreductase {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1dgja4 d.133.1.1 (A:311-906) Aldehyde oxidoreductase {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1qhba_ a.111.1.2 (A:) Haloperoxidase (bromoperoxidase) {Red algae (Corallina officinalis) [TaxId: 35170]} Back     information, alignment and structure
>d1mw9x_ e.10.1.1 (X:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gufa1 f.4.3.3 (A:4-594) Outer membrane cobalamin transporter BtuB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1epua_ e.25.1.1 (A:) Neuronal Sec1, NSec1 {Longfin inshore squid (Loligo pealei) [TaxId: 6621]} Back     information, alignment and structure
>d1dn1a_ e.25.1.1 (A:) Neuronal Sec1, NSec1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s48a_ e.8.1.4 (A:) Viral RNA polymerase {Bovine viral diarrhea virus [TaxId: 11099]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjya2 c.19.1.2 (A:142-721) Cytosolic phospholipase A2 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzea_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vnsa_ a.111.1.3 (A:) Chloroperoxidase {Curvularia inaequalis [TaxId: 38902]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2iv2x2 c.81.1.1 (X:1-564) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1no7a_ e.48.1.1 (A:) Major capsid protein VP5 {Herpes simplex virus 1 [TaxId: 10298]} Back     information, alignment and structure
>d1h41a1 c.1.8.10 (A:152-712) alpha-D-glucuronidase catalytic domain {Pseudomonas cellulosa [TaxId: 155077]} Back     information, alignment and structure
>d1hk8a_ c.7.1.3 (A:) Class III anaerobic ribonucleotide reductase NRDD subunit {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1q50a_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d7reqa1 c.1.19.1 (A:4-560) Methylmalonyl-CoA mutase alpha subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1iata_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub3 e.10.1.1 (B:499-1054) Topoisomerase "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n7va_ b.126.1.1 (A:) Adsorption protein p2 {Bacteriophage prd1 [TaxId: 10658]} Back     information, alignment and structure
>d1qi9a_ a.111.1.2 (A:) Haloperoxidase (bromoperoxidase) {Ascophyllum nodosum [TaxId: 52969]} Back     information, alignment and structure
>d1uwka_ e.51.1.1 (A:) Urocanate hydratase HutU {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tywa_ b.80.1.6 (A:) P22 tailspike protein {Salmonella phage P22 [TaxId: 10754]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1p49a_ c.76.1.2 (A:) Steryl-sulfatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnta_ e.26.1.1 (A:) Hybrid cluster protein (prismane protein) {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1eexa_ c.1.19.3 (A:) Diol dehydratase, alpha subunit {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d2p0ma1 a.119.1.2 (A:113-663) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2b7ma1 a.118.17.2 (A:73-623) Exocyst complex component EXO70 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f48a1 c.89.1.1 (A:4-553) Pyrophosphate-dependent phosphofructokinase {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1mvma_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Murine minute virus, strain i [TaxId: 10794]} Back     information, alignment and structure
>d1xmea1 f.24.1.1 (A:14-562) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c8da_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Canine parvovirus [TaxId: 10788]} Back     information, alignment and structure
>d1x87a_ e.51.1.1 (A:) Urocanate hydratase HutU {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1gnla_ e.26.1.1 (A:) Hybrid cluster protein (prismane protein) {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1frfl_ e.18.1.1 (L:) Nickel-iron hydrogenase, large subunit {Desulfovibrio fructosovorans [TaxId: 878]} Back     information, alignment and structure
>d2bvla1 c.68.1.22 (A:1-542) Toxin B {Clostridium difficile [TaxId: 1496]} Back     information, alignment and structure
>d1k3va_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Porcine parvovirus [TaxId: 10796]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
>d2vk9a1 c.68.1.22 (A:2-541) Alpha-toxin {Clostridium novyi [TaxId: 1542]} Back     information, alignment and structure
>d1daba_ b.80.1.7 (A:) Virulence factor P.69 pertactin {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure
>d1ohfa_ b.121.4.8 (A:) Tetraomegavirus capsid protein {Nudaurelia capensis omega virus [TaxId: 12541]} Back     information, alignment and structure
>d3dtua1 f.24.1.1 (A:14-551) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2nlza1 d.153.1.6 (A:3-539) Cephalosporin acylase {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e3db_ e.18.1.1 (B:) Nickel-iron hydrogenase, large subunit {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1l8na1 c.1.8.10 (A:143-678) alpha-D-glucuronidase catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s58a_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Human parvovirus B19 [TaxId: 10798]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vr5a1 c.94.1.1 (A:23-557) Oligo-peptide binding protein (OPPA) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1wuil1 e.18.1.1 (L:19-552) Nickel-iron hydrogenase, large subunit {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1epwa3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1v7wa1 a.102.1.4 (A:271-801) Chitobiose phosphorylase ChbP {Vibrio proteolyticus [TaxId: 671]} Back     information, alignment and structure
>d1gx5a_ e.8.1.4 (A:) Viral RNA polymerase {Hepatitis C virus [TaxId: 11103]} Back     information, alignment and structure
>d1yq9h1 e.18.1.1 (H:7-536) Nickel-iron hydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ih7a2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]} Back     information, alignment and structure
>d1acoa2 c.83.1.1 (A:2-528) Aconitase A, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mioa_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1peqa2 c.7.1.2 (A:175-699) R1 subunit of ribonucleotide reductase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rlra2 c.7.1.2 (A:222-748) R1 subunit of ribonucleotide reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1m1nb_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3bvua2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1lp3a_ b.121.5.2 (A:) Dependovirus capsid protein {Adeno-associated virus, aav-2 [TaxId: 272636]} Back     information, alignment and structure
>d1qh8b_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1dqua_ c.1.12.7 (A:) Isocitrate lyase {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2d32a1 d.128.1.4 (A:1-518) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i7qa_ d.161.1.1 (A:) Anthranilate synthase aminodeoxyisochorismate synthase/lyase subunit, TrpE {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1jeta_ c.94.1.1 (A:) Oligo-peptide binding protein (OPPA) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1xrsa_ c.1.19.4 (A:) D-lysine 5,6-aminomutase alpha subunit, KamD {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d2i3oa1 d.153.1.6 (A:1-516) Hypothetical protein Ta0994 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v54a_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mtyd_ a.25.1.2 (D:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d2jg0a1 a.102.1.9 (A:37-547) Periplasmic trehalase TreA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dl2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ut9a1 a.102.1.2 (A:306-816) Cellulose 1,4-beta-cellobiosidase CbhA {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d3ckca1 a.118.8.6 (A:42-551) Starch utilization system protein SusD {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a65a1 f.54.1.1 (A:5-513) Na(+):neurotransmitter symporter homologue LeuT {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1k8ta_ e.41.1.1 (A:) Adenylylcyclase toxin (the edema factor) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1dpea_ c.94.1.1 (A:) Dipeptide-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cgha1 a.118.8.6 (A:31-537) Uncharacterized protein BT3984 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvca1 a.138.1.1 (A:40-544) 16-heme cytochrome c HmcA {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1xoca1 c.94.1.1 (A:17-520) Oligo-peptide binding protein (OPPA) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1sh0a_ e.8.1.4 (A:) Viral RNA polymerase {Norwalk virus [TaxId: 11983]} Back     information, alignment and structure
>d1ffta_ f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subunit I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} Back     information, alignment and structure
>d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1zlqa1 c.94.1.1 (A:3-501) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1fgja_ a.138.1.3 (A:) Hydroxylamine oxidoreductase, HAO {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kvpa_ b.121.5.1 (A:) Microvirus capsid proteins {Bacteriophage phi-X174 [TaxId: 10847]} Back     information, alignment and structure
>d1k9xa_ d.92.1.5 (A:) Thermostable carboxypeptidase 1 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khva_ e.8.1.4 (A:) Viral RNA polymerase {Rabbit hemorrhagic disease virus [TaxId: 11976]} Back     information, alignment and structure
>d1q47a_ b.69.12.1 (A:) Semaphorin 3a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1x9ma2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ab4a_ e.11.1.1 (A:) DNA Gyrase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihma_ b.121.4.3 (A:) Calicivirus capsid protein {Norwalk virus [TaxId: 11983]} Back     information, alignment and structure
>d1fsua_ c.76.1.2 (A:) Arylsulfatase B (4-sulfatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1na_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]} Back     information, alignment and structure
>d2fbaa1 a.102.1.1 (A:1-492) Glucoamylase {Yeast (Saccharomycopsis fibuligera) [TaxId: 4944]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2inca1 a.25.1.2 (A:2-492) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1auka_ c.76.1.2 (A:) Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1h54a1 a.102.1.4 (A:269-753) Lactobacillus maltose phosphorylase, central domain {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1l5ja3 c.83.1.1 (A:373-862) Aconitase B, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d2axtb1 f.55.1.1 (B:2-489) Photosystem II core light harvesting protein PsbB {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1ccwb_ c.1.19.2 (B:) Glutamate mutase, large subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2slia2 b.68.1.1 (A:277-759) Leech intramolecular trans-sialidase, C-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1hcua_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uqwa_ c.94.1.1 (A:) Hypothetical protein YliB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaha_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1cc1l_ e.18.1.1 (L:) Nickel-iron hydrogenase, large subunit {Desulfomicrobium baculatum [TaxId: 899]} Back     information, alignment and structure
>d1nvus_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1uc2a_ d.261.1.1 (A:) Hypothetical protein PH1602 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1auka_ c.76.1.2 (A:) Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h54a1 a.102.1.4 (A:269-753) Lactobacillus maltose phosphorylase, central domain {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1zeda1 c.76.1.1 (A:1-479) Alkaline phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ccwb_ c.1.19.2 (B:) Glutamate mutase, large subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1olza2 b.69.12.1 (A:3-480) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2slia2 b.68.1.1 (A:277-759) Leech intramolecular trans-sialidase, C-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1t8sa_ c.56.2.1 (A:) AMP nucleosidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m1na_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oaha_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nvus_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k7ha_ c.76.1.1 (A:) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]} Back     information, alignment and structure
>d1u09a_ e.8.1.4 (A:) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]} Back     information, alignment and structure
>d1shyb1 b.69.12.1 (B:40-515) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Back     information, alignment and structure
>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ri9a1 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uc2a_ d.261.1.1 (A:) Hypothetical protein PH1602 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1musa_ c.55.3.4 (A:) Transposase inhibitor (Tn5 transposase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1zeda1 c.76.1.1 (A:1-479) Alkaline phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szqa_ e.44.1.1 (A:) 2-methylcitrate dehydratase PrpD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1olza2 b.69.12.1 (A:3-480) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t8sa_ c.56.2.1 (A:) AMP nucleosidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gaia_ a.102.1.1 (A:) Glucoamylase {Aspergillus awamori, variant x100 [TaxId: 105351]} Back     information, alignment and structure
>d1m1na_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pfoa_ f.9.1.1 (A:) Perfringolysin {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1k7ha_ c.76.1.1 (A:) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fs7a_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1u09a_ e.8.1.4 (A:) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]} Back     information, alignment and structure
>d1shyb1 b.69.12.1 (B:40-515) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d2ri9a1 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1musa_ c.55.3.4 (A:) Transposase inhibitor (Tn5 transposase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iqha1 e.75.1.1 (A:21-489) Nucleocapsid protein {Influenza A virus [TaxId: 11320]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ga9d1 e.69.1.1 (D:12-479) Poly(A) polymerase catalytic subunit, PAPL {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1szqa_ e.44.1.1 (A:) 2-methylcitrate dehydratase PrpD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1gaia_ a.102.1.1 (A:) Glucoamylase {Aspergillus awamori, variant x100 [TaxId: 105351]} Back     information, alignment and structure
>d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nxca_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} Back     information, alignment and structure
>d1w79a1 e.3.1.3 (A:1-467) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]} Back     information, alignment and structure
>d1gc5a_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs7a_ a.138.1.3 (A:) Cytochrome c nitrite reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1pfoa_ f.9.1.1 (A:) Perfringolysin {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iqha1 e.75.1.1 (A:21-489) Nucleocapsid protein {Influenza A virus [TaxId: 11320]} Back     information, alignment and structure
>d1h80a_ b.80.1.8 (A:) iota-carrageenase {Alteromonas sp., atcc 43554 [TaxId: 232]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2ga9d1 e.69.1.1 (D:12-479) Poly(A) polymerase catalytic subunit, PAPL {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1w79a1 e.3.1.3 (A:1-467) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]} Back     information, alignment and structure
>d2b7oa1 c.1.10.8 (A:1-462) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j3ua_ a.127.1.1 (A:) L-aspartate ammonia lyase {Bacillus sp., ym55-1 [TaxId: 1409]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nxca_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]} Back     information, alignment and structure
>d1gc5a_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2p3ya1 e.65.1.1 (A:22-482) Hypothetical protein VPA0735 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ra6a_ e.8.1.4 (A:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]} Back     information, alignment and structure
>d1vdka_ a.127.1.1 (A:) Fumarase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d7reqb1 c.1.19.1 (B:16-475) Methylmalonyl-CoA mutase beta subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf4a1 a.102.1.2 (A:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1xr7a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 16, HRV-16 [TaxId: 31708]} Back     information, alignment and structure
>d1xr5a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 14, HRV-14 [TaxId: 12131]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1w7ca1 b.30.2.1 (A:316-775) Lysyl oxidase PplO, domain 3 {Yeast (Pichia pastoris) [TaxId: 4922]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k62b_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jswa_ a.127.1.1 (A:) L-aspartate ammonia lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yfma_ a.127.1.1 (A:) Fumarase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3ejna1 a.118.8.6 (A:32-490) Uncharacterized protein BF3025 {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1h80a_ b.80.1.8 (A:) iota-carrageenase {Alteromonas sp., atcc 43554 [TaxId: 232]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d1w5da1 e.3.1.3 (A:5-462) Penicillin-binding protein DacC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ua_ a.127.1.1 (A:) L-aspartate ammonia lyase {Bacillus sp., ym55-1 [TaxId: 1409]} Back     information, alignment and structure
>d1ntha_ c.1.25.1 (A:) Monomethylamine methyltransferase MtmB {Archaeon Methanosarcina barkeri [TaxId: 2208]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1miob_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2b7oa1 c.1.10.8 (A:1-462) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1wp1a_ f.5.1.1 (A:) Outer membrane protein OprM {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2p3ya1 e.65.1.1 (A:22-482) Hypothetical protein VPA0735 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ex2a1 e.3.1.3 (A:22-477) DD-carboxypeptidase DacB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuoa_ a.127.1.1 (A:) Fumarase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ra6a_ e.8.1.4 (A:) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]} Back     information, alignment and structure
>d1w7ca1 b.30.2.1 (A:316-775) Lysyl oxidase PplO, domain 3 {Yeast (Pichia pastoris) [TaxId: 4922]} Back     information, alignment and structure
>d1tf4a1 a.102.1.2 (A:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1dzla_ b.121.6.1 (A:) Papillomavirus L1 protein {Human papillomavirus type 16 [TaxId: 333760]} Back     information, alignment and structure
>d1tj7a_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7reqb1 c.1.19.1 (B:16-475) Methylmalonyl-CoA mutase beta subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdka_ a.127.1.1 (A:) Fumarase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xr7a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 16, HRV-16 [TaxId: 31708]} Back     information, alignment and structure
>d1xr5a_ e.8.1.4 (A:) Viral RNA polymerase {Human rhinovirus 14, HRV-14 [TaxId: 12131]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1yfma_ a.127.1.1 (A:) Fumarase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ua4a_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3ejna1 a.118.8.6 (A:32-490) Uncharacterized protein BF3025 {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1g87a1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]} Back     information, alignment and structure
>d1jswa_ a.127.1.1 (A:) L-aspartate ammonia lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k62b_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k0ga_ d.161.1.1 (A:) P-aminobenzoate synthase component I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o6ia1 a.211.1.1 (A:1-453) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2bg1a1 e.3.1.1 (A:337-789) Penicillin-binding protein 1b, transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1w5da1 e.3.1.3 (A:5-462) Penicillin-binding protein DacC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lsha3 f.7.1.1 (A:621-1073) Lipovitellin-phosvitin complex; beta-sheet shell regions {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1miob_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ntha_ c.1.25.1 (A:) Monomethylamine methyltransferase MtmB {Archaeon Methanosarcina barkeri [TaxId: 2208]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tyea_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]} Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp1a_ f.5.1.1 (A:) Outer membrane protein OprM {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fuoa_ a.127.1.1 (A:) Fumarase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j5sa_ c.1.9.8 (A:) Uronate isomerase TM0064 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2la_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2ex2a1 e.3.1.3 (A:22-477) DD-carboxypeptidase DacB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2xa_ c.72.1.3 (A:) ADP-specific phosphofructokinase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dzla_ b.121.6.1 (A:) Papillomavirus L1 protein {Human papillomavirus type 16 [TaxId: 333760]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1tj7a_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjva_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId: 8839]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1g87a1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]} Back     information, alignment and structure
>d1y6va1 c.76.1.1 (A:1-449) Alkaline phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ua4a_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o6ia1 a.211.1.1 (A:1-453) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1usra_ b.68.1.1 (A:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus [TaxId: 11176]} Back     information, alignment and structure
>d1re5a_ a.127.1.1 (A:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Pseudomonas putida, strain KT2440 [TaxId: 303]} Back     information, alignment and structure
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ga_ d.161.1.1 (A:) P-aminobenzoate synthase component I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2bg1a1 e.3.1.1 (A:337-789) Penicillin-binding protein 1b, transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2axtc1 f.55.1.1 (C:27-473) Photosystem II CP43 protein PsbC {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1lsha3 f.7.1.1 (A:621-1073) Lipovitellin-phosvitin complex; beta-sheet shell regions {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure